F318704

General Info

Members Datasets Scaffolds Average Seq Length
209 177 418 264

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10153786|Ga0070666_101537861
Length 288
Sequence MPTSAAACDRAGPLAPTTAVQSCPRVRGALVTLAVRVIPCLDVDAGRVVKGVNFVGLRDAGDPVELARRYDAEGADELTFLDITASSAGRETTYAVVRRTAEQVFIPLTVGGGVRTSADVDRLLRAGADKVGVNTAAVRRPELLGEIAHRFGRQVLVLSVDARRVPPGAGSTPSGFEVTTHGGRNGTGIDAVAWAATAAELGAGEILLNSMDADGTKDGFDLELIRLVRAAVTVPVIASGGAGRAQHFPAAVAAGADAVLAASVFHFGQLTIGAVKSELAAAGLPVRA

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
98 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
99 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
103 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
104 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
105 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
127 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
164 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
165 2643221679 Angustibacter sp. Root456 Isolate Unclassified
166 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
167 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
168 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
169 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
170 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
171 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
172 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
173 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
174 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
175 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
176 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
177 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.87
Metatranscriptomes 0.96
Isolates 7.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 0
Rhizoplane 6.22
Rhizosphere 84.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10153786 3300005335 Bacteria 1606
2 JGI24740J21852_10013339 3300001979 Bacteria 3068
3 JGI24735J21928_10021861 3300002067 Bacteria 1951
4 Ga0070658_10042346 3300005327 Bacteria 3677
5 Ga0070658_10284049 3300005327 Bacteria 1409
6 Ga0070683_100278860 3300005329 Bacteria 1590
7 Ga0070680_100438450 3300005336 Bacteria 1115
8 Ga0070680_100487550 3300005336 Bacteria 1054
9 Ga0070660_100523533 3300005339 Bacteria 988
10 Ga0070692_10068401 3300005345 Bacteria 1887
11 Ga0070668_100024323 3300005347 Bacteria 4588
12 Ga0070688_100201797 3300005365 Bacteria 1392
13 Ga0070659_100076530 3300005366 Bacteria 2668
14 Ga0070667_100165433 3300005367 Bacteria 1951
15 Ga0070709_10299833 3300005434 Bacteria 1173
16 Ga0070714_100004428 3300005435 Bacteria 10573
17 Ga0070714_100139609 3300005435 Bacteria 2173
18 Ga0070710_10039922 3300005437 Bacteria 2584
19 Ga0070701_10045511 3300005438 Bacteria 2252
20 Ga0070700_100159407 3300005441 Bacteria 1552
21 Ga0070694_100149288 3300005444 Bacteria 1705
22 Ga0070708_100123299 3300005445 Bacteria 2392
23 Ga0070708_100384253 3300005445 Bacteria 1324
24 Ga0070678_100112473 3300005456 Bacteria 2132
25 Ga0070681_10183754 3300005458 Bacteria 2012
26 Ga0070706_100028358 3300005467 Bacteria 5155
27 Ga0070679_100011782 3300005530 Bacteria 8337
28 Ga0070679_100493122 3300005530 Bacteria 1169
29 Ga0070697_100116478 3300005536 Bacteria 2232
30 Ga0070686_100220120 3300005544 Bacteria 1371
31 Ga0070696_100001381 3300005546 Bacteria 15875
32 Ga0070696_100033681 3300005546 Bacteria 3521
33 Ga0070665_100145609 3300005548 Bacteria 2372
34 Ga0070704_100367048 3300005549 Bacteria 1219
35 Ga0068855_100189781 3300005563 Bacteria 2319
36 Ga0070664_100225211 3300005564 Bacteria 1679
37 Ga0068854_100263134 3300005578 Bacteria 1382
38 Ga0068864_100183056 3300005618 Bacteria 1916
39 Ga0068861_100009125 3300005719 Bacteria 6839
40 Ga0068851_10032921 3300005834 Bacteria 2581
41 Ga0081540_1006994 3300005983 Bacteria 8116
42 Ga0081539_10007530 3300005985 Bacteria 9868
43 Ga0070717_10066123 3300006028 Bacteria 3006
44 Ga0075364_10391478 3300006051 Bacteria 948
45 Ga0070715_10017091 3300006163 Bacteria 2740
46 Ga0070716_100004741 3300006173 Bacteria 6524
47 Ga0068865_100085303 3300006881 Bacteria 2278
48 Ga0068865_100288616 3300006881 Bacteria 1309
49 Ga0105240_10000007 3300009093 Bacteria 619357
50 Ga0105240_10014143 3300009093 Bacteria 10902
51 Ga0111539_10099020 3300009094 Bacteria 3424
52 Ga0105245_10139415 3300009098 Bacteria 2282
53 Ga0105247_10019078 3300009101 Bacteria 4118
54 Ga0114129_10384246 3300009147 Bacteria 1854
55 Ga0105243_10118439 3300009148 Bacteria 2228
56 Ga0105241_10073725 3300009174 Bacteria 2656
57 Ga0105242_10154547 3300009176 Bacteria 2003
58 Ga0105237_10342277 3300009545 Bacteria 1500
59 Ga0105238_10162244 3300009551 Bacteria 2211
60 Ga0105249_10034094 3300009553 Bacteria 4611
61 Ga0105239_10128443 3300010375 Bacteria 2818
62 Ga0105239_10527146 3300010375 Bacteria 1344
63 Ga0157371_10125734 3300013102 Bacteria 1823
64 Ga0157374_10205676 3300013296 Bacteria 1929
65 Ga0163162_10898894 3300013306 Bacteria 999
66 Ga0157372_10198167 3300013307 Bacteria 2326
67 Ga0157375_10008112 3300013308 Bacteria 9189
68 Ga0163163_10146342 3300014325 Bacteria 2407
69 Ga0157379_10129571 3300014968 Bacteria 2270
70 Ga0163161_10030428 3300017792 Bacteria 3842
71 Ga0206353_10970424 3300020082 Bacteria 2362
72 Ga0206353_11297471 3300020082 Bacteria 4907
73 Ga0213876_10011081 3300021384 Bacteria 4824
74 Ga0207642_10041681 3300025899 Bacteria 2012
75 Ga0207710_10065901 3300025900 Bacteria 1652
76 Ga0207688_10038307 3300025901 Bacteria 2660
77 Ga0207647_10001748 3300025904 Bacteria 16661
78 Ga0207685_10063657 3300025905 Bacteria 1470
79 Ga0207705_10216965 3300025909 Bacteria 1452
80 Ga0207684_10041993 3300025910 Bacteria 3876
81 Ga0207707_10105172 3300025912 Bacteria 2467
82 Ga0207695_10043246 3300025913 Bacteria 4801
83 Ga0207671_10145491 3300025914 Bacteria 1828
84 Ga0207671_10213444 3300025914 Bacteria 1510
85 Ga0207693_10038175 3300025915 Bacteria 3783
86 Ga0207652_10006886 3300025921 Bacteria 9158
87 Ga0207694_10298735 3300025924 Bacteria 1325
88 Ga0207687_10216069 3300025927 Bacteria 1507
89 Ga0207700_10389259 3300025928 Bacteria 1220
90 Ga0207664_10015771 3300025929 Bacteria 5496
91 Ga0207664_10211624 3300025929 Bacteria 1678
92 Ga0207706_10023346 3300025933 Bacteria 5555
93 Ga0207704_10437839 3300025938 Bacteria 1040
94 Ga0207665_10000352 3300025939 Bacteria 31877
95 Ga0207711_10313219 3300025941 Bacteria 1449
96 Ga0207689_10027957 3300025942 Bacteria 4718
97 Ga0207689_10408557 3300025942 Bacteria 1132
98 Ga0207679_10191175 3300025945 Bacteria 1702
99 Ga0207667_10424694 3300025949 Bacteria 1352
100 Ga0207712_10094659 3300025961 Bacteria 2207
101 Ga0207668_10128360 3300025972 Bacteria 1932
102 Ga0207640_10269076 3300025981 Bacteria 1332
103 Ga0207658_10249665 3300025986 Bacteria 1507
104 Ga0207678_10000065 3300026067 Bacteria 83028
105 Ga0207678_10054767 3300026067 Bacteria 3436
106 Ga0207708_10074975 3300026075 Bacteria 2593
107 Ga0207702_10114012 3300026078 Bacteria 2408
108 Ga0207683_10003541 3300026121 Bacteria 13618
109 Ga0207683_10075084 3300026121 Bacteria 2992
110 Ga0268266_10512279 3300028379 Bacteria 1146
111 Ga0268264_10294041 3300028381 Bacteria 1526
112 Ga0316575_10000014 3300031665 Bacteria 47640
113 Ga0316579_10000008 3300031691 Bacteria 52798
114 Ga0307416_100057454 3300032002 Bacteria 3148
115 Ga0307411_10205929 3300032005 Bacteria 1515
116 Ga0307415_100062735 3300032126 Bacteria 2579
117 Ga0307415_100365664 3300032126 Bacteria 1220
118 Ga0373929_0063577 3300035085 Bacteria 869
119 Ga0373951_0009514 3300035091 Bacteria 2188
120 Ga0373932_0031716 3300035112 Bacteria 1474
121 Ga0373939_0045957 3300035114 Bacteria 1335
122 Ga0373960_0051985 3300035121 Bacteria 1219
123 Ga0373931_0384383 3300035691 Bacteria 886
124 Ga0395900_0051649 3300037418 Bacteria 4234
125 Ga0395898_0338003 3300037466 Bacteria 1436
126 Ga0436364_1256159 3300037853 Bacteria 2785
127 Ga0395901_0302420 3300038443 Bacteria 1658
128 Ga0436365_1405010 3300039437 Bacteria 1744
129 Ga0466965_0307886 3300044683 Bacteria 861
130 Ga0466966_0066102 3300044684 Bacteria 2273
131 Ga0466961_0169501 3300044693 Bacteria 1358
132 Ga0466963_0010253 3300044694 Bacteria 5669
133 Ga0466963_0287501 3300044694 Bacteria 1156
134 Ga0466963_0310371 3300044694 Bacteria 1110
135 Ga0466963_0485407 3300044694 Bacteria 872
136 Ga0466963_0493454 3300044694 Bacteria 864
137 Ga0466964_0052927 3300044706 Bacteria 1670
138 Ga0466971_0047479 3300044719 Bacteria 1930
139 Ga0466968_0185938 3300044735 Bacteria 968
140 Ga0466957_0004090 3300044842 Bacteria 8079
141 Ga0466960_0024777 3300044901 Bacteria 2710
142 Ga0466960_0144384 3300044901 Bacteria 1266
143 Ga0466959_0102550 3300045049 Bacteria 2048
144 Ga0466959_0160289 3300045049 Bacteria 1582
145 Ga0466959_0163832 3300045049 Bacteria 1562
146 Ga0466958_0061688 3300045836 Bacteria 2284
147 Ga0466958_0064207 3300045836 Bacteria 2239
148 Ga0466967_0020726 3300045976 Bacteria 5322
149 Ga0466967_0040454 3300045976 Bacteria 4013
150 Ga0466967_0042657 3300045976 Bacteria 3922
151 Ga0466967_0241880 3300045976 Bacteria 1722
152 Ga0466967_0534425 3300045976 Bacteria 1153
153 Ga0495603_0321035 3300046455 Bacteria 889
154 Ga0495623_0038768 3300046679 Bacteria 3047
155 Ga0495658_0179778 3300046683 Bacteria 1312
156 Ga0495581_0135913 3300047315 Bacteria 1433
157 Ga0495604_0004607 3300047317 Bacteria 10923
158 Ga0496102_0116946 3300048905 Bacteria 2488
159 Ga0496104_0207628 3300048907 Bacteria 1870
160 Ga0496105_0257403 3300048908 Bacteria 1412
161 Ga0496106_0050481 3300048909 Bacteria 3135
162 Ga0496107_0074608 3300048910 Bacteria 2468
163 Ga0496108_0157966 3300048911 Bacteria 1958
164 Ga0496110_0040009 3300048913 Bacteria 4084
165 Ga0496111_0086590 3300048914 Bacteria 2292
166 Ga0496112_0070204 3300048915 Bacteria 3462
167 Ga0496113_0208083 3300048916 Bacteria 1556
168 Ga0496114_0123547 3300048917 Bacteria 2228
169 Ga0496114_0653883 3300048917 Bacteria 924
170 Ga0496115_0021897 3300048918 Bacteria 4942
171 Ga0496117_0118959 3300048920 Bacteria 1627
172 Ga0496118_0081138 3300048921 Bacteria 2278
173 Ga0496122_0000548 3300048925 Bacteria 77737
174 Ga0496124_0110021 3300048927 Bacteria 2219
175 Ga0496125_0000025 3300048928 Bacteria 440074
176 Ga0501032_0008865 3300049569 Bacteria 7313
177 Ga0501032_0103269 3300049569 Bacteria 1889
178 Ga0501034_0013592 3300049571 Bacteria 8378
179 Ga0501038_0006642 3300049574 Bacteria 10696
180 Ga0501038_0218670 3300049574 Bacteria 1521
181 Ga0501039_0442043 3300049575 Bacteria 1021
182 Ga0501040_0217779 3300049576 Bacteria 1358
183 Ga0501043_0007425 3300049579 Bacteria 8701
184 Ga0501046_0001931 3300049580 Bacteria 19689
185 Ga0501047_0000018 3300049581 Bacteria 274180
186 Ga0501047_0038282 3300049581 Bacteria 4640
187 Ga0501048_0549947 3300049582 Bacteria 828
188 Ga0501070_0144415 3300049586 Bacteria 1964
189 Ga0501083_0291490 3300049744 Bacteria 1061
190 Ga0501044_0011630 3300049823 Bacteria 9539
191 nmdc:mga05p37_284744_c1 3300050507 Bacteria 1969
192 nmdc:mga0rr50_767806_c1 3300050513 Bacteria 823
193 nmdc:mga0sz30_23832_c2 3300050516 Bacteria 1454
194 Ga0501082_0009212 3300060353 Bacteria 8509
195 2644014195 2643221601 Bacteria 7493239
196 2644175415 2643221631 Bacteria 8168043
197 2644445184 2643221679 Bacteria 3839507
198 2729904957 2728369276 Bacteria 5610032
199 2731905579 2731639228 Bacteria 4187555
200 2760307522 2758568522 Bacteria 5953541
201 2812365028 2811994880 Bacteria 4147780
202 2819743333 2818991472 Bacteria 10089953
203 2835191747 2835188231 Bacteria 3476928
204 2873320727 2873314349 Bacteria 8512634
205 2884995329 2884994152 Bacteria 4492978
206 2925329812 2925326138 Bacteria 9652120
207 2932431735 2932431166 Bacteria 4215299
208 8055066855 8055066027 Bacteria 9479577
209 8055178865 8055172936 Bacteria 9305943
210 Ga0070666_10153786
211 JGI24740J21852_10013339
212 JGI24735J21928_10021861
213 Ga0070658_10042346
214 Ga0070658_10284049
215 Ga0070683_100278860
216 Ga0070680_100438450
217 Ga0070680_100487550
218 Ga0070660_100523533
219 Ga0070692_10068401
220 Ga0070668_100024323
221 Ga0070688_100201797
222 Ga0070659_100076530
223 Ga0070667_100165433
224 Ga0070709_10299833
225 Ga0070714_100004428
226 Ga0070714_100139609
227 Ga0070710_10039922
228 Ga0070701_10045511
229 Ga0070700_100159407
230 Ga0070694_100149288
231 Ga0070708_100123299
232 Ga0070708_100384253
233 Ga0070678_100112473
234 Ga0070681_10183754
235 Ga0070706_100028358
236 Ga0070679_100011782
237 Ga0070679_100493122
238 Ga0070697_100116478
239 Ga0070686_100220120
240 Ga0070696_100001381
241 Ga0070696_100033681
242 Ga0070665_100145609
243 Ga0070704_100367048
244 Ga0068855_100189781
245 Ga0070664_100225211
246 Ga0068854_100263134
247 Ga0068864_100183056
248 Ga0068861_100009125
249 Ga0068851_10032921
250 Ga0081540_1006994
251 Ga0081539_10007530
252 Ga0070717_10066123
253 Ga0075364_10391478
254 Ga0070715_10017091
255 Ga0070716_100004741
256 Ga0068865_100085303
257 Ga0068865_100288616
258 Ga0105240_10000007
259 Ga0105240_10014143
260 Ga0111539_10099020
261 Ga0105245_10139415
262 Ga0105247_10019078
263 Ga0114129_10384246
264 Ga0105243_10118439
265 Ga0105241_10073725
266 Ga0105242_10154547
267 Ga0105237_10342277
268 Ga0105238_10162244
269 Ga0105249_10034094
270 Ga0105239_10128443
271 Ga0105239_10527146
272 Ga0157371_10125734
273 Ga0157374_10205676
274 Ga0163162_10898894
275 Ga0157372_10198167
276 Ga0157375_10008112
277 Ga0163163_10146342
278 Ga0157379_10129571
279 Ga0163161_10030428
280 Ga0206353_10970424
281 Ga0206353_11297471
282 Ga0213876_10011081
283 Ga0207642_10041681
284 Ga0207710_10065901
285 Ga0207688_10038307
286 Ga0207647_10001748
287 Ga0207685_10063657
288 Ga0207705_10216965
289 Ga0207684_10041993
290 Ga0207707_10105172
291 Ga0207695_10043246
292 Ga0207671_10145491
293 Ga0207671_10213444
294 Ga0207693_10038175
295 Ga0207652_10006886
296 Ga0207694_10298735
297 Ga0207687_10216069
298 Ga0207700_10389259
299 Ga0207664_10015771
300 Ga0207664_10211624
301 Ga0207706_10023346
302 Ga0207704_10437839
303 Ga0207665_10000352
304 Ga0207711_10313219
305 Ga0207689_10027957
306 Ga0207689_10408557
307 Ga0207679_10191175
308 Ga0207667_10424694
309 Ga0207712_10094659
310 Ga0207668_10128360
311 Ga0207640_10269076
312 Ga0207658_10249665
313 Ga0207678_10000065
314 Ga0207678_10054767
315 Ga0207708_10074975
316 Ga0207702_10114012
317 Ga0207683_10003541
318 Ga0207683_10075084
319 Ga0268266_10512279
320 Ga0268264_10294041
321 Ga0316575_10000014
322 Ga0316579_10000008
323 Ga0307416_100057454
324 Ga0307411_10205929
325 Ga0307415_100062735
326 Ga0307415_100365664
327 Ga0373929_0063577
328 Ga0373951_0009514
329 Ga0373932_0031716
330 Ga0373939_0045957
331 Ga0373960_0051985
332 Ga0373931_0384383
333 Ga0395900_0051649
334 Ga0395898_0338003
335 Ga0436364_1256159
336 Ga0395901_0302420
337 Ga0436365_1405010
338 Ga0466965_0307886
339 Ga0466966_0066102
340 Ga0466961_0169501
341 Ga0466963_0010253
342 Ga0466963_0287501
343 Ga0466963_0310371
344 Ga0466963_0485407
345 Ga0466963_0493454
346 Ga0466964_0052927
347 Ga0466971_0047479
348 Ga0466968_0185938
349 Ga0466957_0004090
350 Ga0466960_0024777
351 Ga0466960_0144384
352 Ga0466959_0102550
353 Ga0466959_0160289
354 Ga0466959_0163832
355 Ga0466958_0061688
356 Ga0466958_0064207
357 Ga0466967_0020726
358 Ga0466967_0040454
359 Ga0466967_0042657
360 Ga0466967_0241880
361 Ga0466967_0534425
362 Ga0495603_0321035
363 Ga0495623_0038768
364 Ga0495658_0179778
365 Ga0495581_0135913
366 Ga0495604_0004607
367 Ga0496102_0116946
368 Ga0496104_0207628
369 Ga0496105_0257403
370 Ga0496106_0050481
371 Ga0496107_0074608
372 Ga0496108_0157966
373 Ga0496110_0040009
374 Ga0496111_0086590
375 Ga0496112_0070204
376 Ga0496113_0208083
377 Ga0496114_0123547
378 Ga0496114_0653883
379 Ga0496115_0021897
380 Ga0496117_0118959
381 Ga0496118_0081138
382 Ga0496122_0000548
383 Ga0496124_0110021
384 Ga0496125_0000025
385 Ga0501032_0008865
386 Ga0501032_0103269
387 Ga0501034_0013592
388 Ga0501038_0006642
389 Ga0501038_0218670
390 Ga0501039_0442043
391 Ga0501040_0217779
392 Ga0501043_0007425
393 Ga0501046_0001931
394 Ga0501047_0000018
395 Ga0501047_0038282
396 Ga0501048_0549947
397 Ga0501070_0144415
398 Ga0501083_0291490
399 Ga0501044_0011630
400 nmdc:mga05p37_284744_c1
401 nmdc:mga0rr50_767806_c1
402 nmdc:mga0sz30_23832_c2
403 Ga0501082_0009212
404 2644014195
405 2644175415
406 2644445184
407 2729904957
408 2731905579
409 2760307522
410 2812365028
411 2819743333
412 2835191747
413 2873320727
414 2884995329
415 2925329812
416 2932431735
417 8055066855
418 8055178865

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

36

271

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gpw-assembly2.cif.gz_C structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. 0.9668 3 260
6vdg-assembly1.cif.gz_A crystal structure of the y182a hisf mutant from thermotoga maritima 0.9666 4 260
2wjz-assembly2.cif.gz_E crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.9627 3 260
7qc9-assembly1.cif.gz_A hisf-c9a-d11e-v33a_l50h_i52h mutant in complex with ni(ii) from t. maritima 0.9588 3 260
6vdg-assembly1.cif.gz_A crystal structure of the y182a hisf mutant from thermotoga maritima 0.9586 4 260
ID Description Score Start End Superfamily
af_Q2FUU3_1_249_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9619 4 257 3.20.20.70
3tdnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9515 124 232 3.40.50.12600
af_Q2FUU3_1_249_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9506 4 257 3.20.20.70
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9436 3 260 3.20.20.70
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9329 3 260 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A655FPA8-F1-model_v4 deleted 0.9912 64 260
AF-A0A2S8MAV5-F1-model_v4 deleted 0.9895 83 260
AF-A0A6J7SHT2-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) 0.9882 64 260 GO:0000105
GO:0000107
GO:0016829
AF-A0A7C8FUZ3-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.3.2.10) (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) (IGPS subunit HisF) 0.9878 1 260 GO:0000105
GO:0000107
GO:0005737
GO:0016829
AF-A0A344W2U6-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.3.2.10) (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) (IGPS subunit HisF) 0.9874 1 260 GO:0000105
GO:0000107
GO:0005737
GO:0016829

Map