F318704
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 209 | 177 | 418 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_10153786|Ga0070666_101537861 |
| Length | 288 |
| Sequence | MPTSAAACDRAGPLAPTTAVQSCPRVRGALVTLAVRVIPCLDVDAGRVVKGVNFVGLRDAGDPVELARRYDAEGADELTFLDITASSAGRETTYAVVRRTAEQVFIPLTVGGGVRTSADVDRLLRAGADKVGVNTAAVRRPELLGEIAHRFGRQVLVLSVDARRVPPGAGSTPSGFEVTTHGGRNGTGIDAVAWAATAAELGAGEILLNSMDADGTKDGFDLELIRLVRAAVTVPVIASGGAGRAQHFPAAVAAGADAVLAASVFHFGQLTIGAVKSELAAAGLPVRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 39 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 42 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 64 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 98 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 99 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 100 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 101 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 102 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 103 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 104 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 105 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 106 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 107 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 108 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 111 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 112 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 113 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 114 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 115 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 116 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 117 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 118 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 119 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 120 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 121 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 122 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 123 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 124 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 125 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 131 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 132 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 133 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 134 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 135 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 136 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 137 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 138 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 139 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 140 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 141 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 142 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 143 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 144 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 145 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 146 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 147 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 148 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 150 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 158 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 162 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 164 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 165 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 166 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 167 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 168 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 169 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 170 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 171 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 172 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 173 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 174 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 175 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 176 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 177 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.87 |
| Metatranscriptomes | 0.96 |
| Isolates | 7.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.96 |
| Nodule | 0 |
| Rhizoplane | 6.22 |
| Rhizosphere | 84.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070666_10153786 | 3300005335 | Bacteria | 1606 |
| 2 | JGI24740J21852_10013339 | 3300001979 | Bacteria | 3068 |
| 3 | JGI24735J21928_10021861 | 3300002067 | Bacteria | 1951 |
| 4 | Ga0070658_10042346 | 3300005327 | Bacteria | 3677 |
| 5 | Ga0070658_10284049 | 3300005327 | Bacteria | 1409 |
| 6 | Ga0070683_100278860 | 3300005329 | Bacteria | 1590 |
| 7 | Ga0070680_100438450 | 3300005336 | Bacteria | 1115 |
| 8 | Ga0070680_100487550 | 3300005336 | Bacteria | 1054 |
| 9 | Ga0070660_100523533 | 3300005339 | Bacteria | 988 |
| 10 | Ga0070692_10068401 | 3300005345 | Bacteria | 1887 |
| 11 | Ga0070668_100024323 | 3300005347 | Bacteria | 4588 |
| 12 | Ga0070688_100201797 | 3300005365 | Bacteria | 1392 |
| 13 | Ga0070659_100076530 | 3300005366 | Bacteria | 2668 |
| 14 | Ga0070667_100165433 | 3300005367 | Bacteria | 1951 |
| 15 | Ga0070709_10299833 | 3300005434 | Bacteria | 1173 |
| 16 | Ga0070714_100004428 | 3300005435 | Bacteria | 10573 |
| 17 | Ga0070714_100139609 | 3300005435 | Bacteria | 2173 |
| 18 | Ga0070710_10039922 | 3300005437 | Bacteria | 2584 |
| 19 | Ga0070701_10045511 | 3300005438 | Bacteria | 2252 |
| 20 | Ga0070700_100159407 | 3300005441 | Bacteria | 1552 |
| 21 | Ga0070694_100149288 | 3300005444 | Bacteria | 1705 |
| 22 | Ga0070708_100123299 | 3300005445 | Bacteria | 2392 |
| 23 | Ga0070708_100384253 | 3300005445 | Bacteria | 1324 |
| 24 | Ga0070678_100112473 | 3300005456 | Bacteria | 2132 |
| 25 | Ga0070681_10183754 | 3300005458 | Bacteria | 2012 |
| 26 | Ga0070706_100028358 | 3300005467 | Bacteria | 5155 |
| 27 | Ga0070679_100011782 | 3300005530 | Bacteria | 8337 |
| 28 | Ga0070679_100493122 | 3300005530 | Bacteria | 1169 |
| 29 | Ga0070697_100116478 | 3300005536 | Bacteria | 2232 |
| 30 | Ga0070686_100220120 | 3300005544 | Bacteria | 1371 |
| 31 | Ga0070696_100001381 | 3300005546 | Bacteria | 15875 |
| 32 | Ga0070696_100033681 | 3300005546 | Bacteria | 3521 |
| 33 | Ga0070665_100145609 | 3300005548 | Bacteria | 2372 |
| 34 | Ga0070704_100367048 | 3300005549 | Bacteria | 1219 |
| 35 | Ga0068855_100189781 | 3300005563 | Bacteria | 2319 |
| 36 | Ga0070664_100225211 | 3300005564 | Bacteria | 1679 |
| 37 | Ga0068854_100263134 | 3300005578 | Bacteria | 1382 |
| 38 | Ga0068864_100183056 | 3300005618 | Bacteria | 1916 |
| 39 | Ga0068861_100009125 | 3300005719 | Bacteria | 6839 |
| 40 | Ga0068851_10032921 | 3300005834 | Bacteria | 2581 |
| 41 | Ga0081540_1006994 | 3300005983 | Bacteria | 8116 |
| 42 | Ga0081539_10007530 | 3300005985 | Bacteria | 9868 |
| 43 | Ga0070717_10066123 | 3300006028 | Bacteria | 3006 |
| 44 | Ga0075364_10391478 | 3300006051 | Bacteria | 948 |
| 45 | Ga0070715_10017091 | 3300006163 | Bacteria | 2740 |
| 46 | Ga0070716_100004741 | 3300006173 | Bacteria | 6524 |
| 47 | Ga0068865_100085303 | 3300006881 | Bacteria | 2278 |
| 48 | Ga0068865_100288616 | 3300006881 | Bacteria | 1309 |
| 49 | Ga0105240_10000007 | 3300009093 | Bacteria | 619357 |
| 50 | Ga0105240_10014143 | 3300009093 | Bacteria | 10902 |
| 51 | Ga0111539_10099020 | 3300009094 | Bacteria | 3424 |
| 52 | Ga0105245_10139415 | 3300009098 | Bacteria | 2282 |
| 53 | Ga0105247_10019078 | 3300009101 | Bacteria | 4118 |
| 54 | Ga0114129_10384246 | 3300009147 | Bacteria | 1854 |
| 55 | Ga0105243_10118439 | 3300009148 | Bacteria | 2228 |
| 56 | Ga0105241_10073725 | 3300009174 | Bacteria | 2656 |
| 57 | Ga0105242_10154547 | 3300009176 | Bacteria | 2003 |
| 58 | Ga0105237_10342277 | 3300009545 | Bacteria | 1500 |
| 59 | Ga0105238_10162244 | 3300009551 | Bacteria | 2211 |
| 60 | Ga0105249_10034094 | 3300009553 | Bacteria | 4611 |
| 61 | Ga0105239_10128443 | 3300010375 | Bacteria | 2818 |
| 62 | Ga0105239_10527146 | 3300010375 | Bacteria | 1344 |
| 63 | Ga0157371_10125734 | 3300013102 | Bacteria | 1823 |
| 64 | Ga0157374_10205676 | 3300013296 | Bacteria | 1929 |
| 65 | Ga0163162_10898894 | 3300013306 | Bacteria | 999 |
| 66 | Ga0157372_10198167 | 3300013307 | Bacteria | 2326 |
| 67 | Ga0157375_10008112 | 3300013308 | Bacteria | 9189 |
| 68 | Ga0163163_10146342 | 3300014325 | Bacteria | 2407 |
| 69 | Ga0157379_10129571 | 3300014968 | Bacteria | 2270 |
| 70 | Ga0163161_10030428 | 3300017792 | Bacteria | 3842 |
| 71 | Ga0206353_10970424 | 3300020082 | Bacteria | 2362 |
| 72 | Ga0206353_11297471 | 3300020082 | Bacteria | 4907 |
| 73 | Ga0213876_10011081 | 3300021384 | Bacteria | 4824 |
| 74 | Ga0207642_10041681 | 3300025899 | Bacteria | 2012 |
| 75 | Ga0207710_10065901 | 3300025900 | Bacteria | 1652 |
| 76 | Ga0207688_10038307 | 3300025901 | Bacteria | 2660 |
| 77 | Ga0207647_10001748 | 3300025904 | Bacteria | 16661 |
| 78 | Ga0207685_10063657 | 3300025905 | Bacteria | 1470 |
| 79 | Ga0207705_10216965 | 3300025909 | Bacteria | 1452 |
| 80 | Ga0207684_10041993 | 3300025910 | Bacteria | 3876 |
| 81 | Ga0207707_10105172 | 3300025912 | Bacteria | 2467 |
| 82 | Ga0207695_10043246 | 3300025913 | Bacteria | 4801 |
| 83 | Ga0207671_10145491 | 3300025914 | Bacteria | 1828 |
| 84 | Ga0207671_10213444 | 3300025914 | Bacteria | 1510 |
| 85 | Ga0207693_10038175 | 3300025915 | Bacteria | 3783 |
| 86 | Ga0207652_10006886 | 3300025921 | Bacteria | 9158 |
| 87 | Ga0207694_10298735 | 3300025924 | Bacteria | 1325 |
| 88 | Ga0207687_10216069 | 3300025927 | Bacteria | 1507 |
| 89 | Ga0207700_10389259 | 3300025928 | Bacteria | 1220 |
| 90 | Ga0207664_10015771 | 3300025929 | Bacteria | 5496 |
| 91 | Ga0207664_10211624 | 3300025929 | Bacteria | 1678 |
| 92 | Ga0207706_10023346 | 3300025933 | Bacteria | 5555 |
| 93 | Ga0207704_10437839 | 3300025938 | Bacteria | 1040 |
| 94 | Ga0207665_10000352 | 3300025939 | Bacteria | 31877 |
| 95 | Ga0207711_10313219 | 3300025941 | Bacteria | 1449 |
| 96 | Ga0207689_10027957 | 3300025942 | Bacteria | 4718 |
| 97 | Ga0207689_10408557 | 3300025942 | Bacteria | 1132 |
| 98 | Ga0207679_10191175 | 3300025945 | Bacteria | 1702 |
| 99 | Ga0207667_10424694 | 3300025949 | Bacteria | 1352 |
| 100 | Ga0207712_10094659 | 3300025961 | Bacteria | 2207 |
| 101 | Ga0207668_10128360 | 3300025972 | Bacteria | 1932 |
| 102 | Ga0207640_10269076 | 3300025981 | Bacteria | 1332 |
| 103 | Ga0207658_10249665 | 3300025986 | Bacteria | 1507 |
| 104 | Ga0207678_10000065 | 3300026067 | Bacteria | 83028 |
| 105 | Ga0207678_10054767 | 3300026067 | Bacteria | 3436 |
| 106 | Ga0207708_10074975 | 3300026075 | Bacteria | 2593 |
| 107 | Ga0207702_10114012 | 3300026078 | Bacteria | 2408 |
| 108 | Ga0207683_10003541 | 3300026121 | Bacteria | 13618 |
| 109 | Ga0207683_10075084 | 3300026121 | Bacteria | 2992 |
| 110 | Ga0268266_10512279 | 3300028379 | Bacteria | 1146 |
| 111 | Ga0268264_10294041 | 3300028381 | Bacteria | 1526 |
| 112 | Ga0316575_10000014 | 3300031665 | Bacteria | 47640 |
| 113 | Ga0316579_10000008 | 3300031691 | Bacteria | 52798 |
| 114 | Ga0307416_100057454 | 3300032002 | Bacteria | 3148 |
| 115 | Ga0307411_10205929 | 3300032005 | Bacteria | 1515 |
| 116 | Ga0307415_100062735 | 3300032126 | Bacteria | 2579 |
| 117 | Ga0307415_100365664 | 3300032126 | Bacteria | 1220 |
| 118 | Ga0373929_0063577 | 3300035085 | Bacteria | 869 |
| 119 | Ga0373951_0009514 | 3300035091 | Bacteria | 2188 |
| 120 | Ga0373932_0031716 | 3300035112 | Bacteria | 1474 |
| 121 | Ga0373939_0045957 | 3300035114 | Bacteria | 1335 |
| 122 | Ga0373960_0051985 | 3300035121 | Bacteria | 1219 |
| 123 | Ga0373931_0384383 | 3300035691 | Bacteria | 886 |
| 124 | Ga0395900_0051649 | 3300037418 | Bacteria | 4234 |
| 125 | Ga0395898_0338003 | 3300037466 | Bacteria | 1436 |
| 126 | Ga0436364_1256159 | 3300037853 | Bacteria | 2785 |
| 127 | Ga0395901_0302420 | 3300038443 | Bacteria | 1658 |
| 128 | Ga0436365_1405010 | 3300039437 | Bacteria | 1744 |
| 129 | Ga0466965_0307886 | 3300044683 | Bacteria | 861 |
| 130 | Ga0466966_0066102 | 3300044684 | Bacteria | 2273 |
| 131 | Ga0466961_0169501 | 3300044693 | Bacteria | 1358 |
| 132 | Ga0466963_0010253 | 3300044694 | Bacteria | 5669 |
| 133 | Ga0466963_0287501 | 3300044694 | Bacteria | 1156 |
| 134 | Ga0466963_0310371 | 3300044694 | Bacteria | 1110 |
| 135 | Ga0466963_0485407 | 3300044694 | Bacteria | 872 |
| 136 | Ga0466963_0493454 | 3300044694 | Bacteria | 864 |
| 137 | Ga0466964_0052927 | 3300044706 | Bacteria | 1670 |
| 138 | Ga0466971_0047479 | 3300044719 | Bacteria | 1930 |
| 139 | Ga0466968_0185938 | 3300044735 | Bacteria | 968 |
| 140 | Ga0466957_0004090 | 3300044842 | Bacteria | 8079 |
| 141 | Ga0466960_0024777 | 3300044901 | Bacteria | 2710 |
| 142 | Ga0466960_0144384 | 3300044901 | Bacteria | 1266 |
| 143 | Ga0466959_0102550 | 3300045049 | Bacteria | 2048 |
| 144 | Ga0466959_0160289 | 3300045049 | Bacteria | 1582 |
| 145 | Ga0466959_0163832 | 3300045049 | Bacteria | 1562 |
| 146 | Ga0466958_0061688 | 3300045836 | Bacteria | 2284 |
| 147 | Ga0466958_0064207 | 3300045836 | Bacteria | 2239 |
| 148 | Ga0466967_0020726 | 3300045976 | Bacteria | 5322 |
| 149 | Ga0466967_0040454 | 3300045976 | Bacteria | 4013 |
| 150 | Ga0466967_0042657 | 3300045976 | Bacteria | 3922 |
| 151 | Ga0466967_0241880 | 3300045976 | Bacteria | 1722 |
| 152 | Ga0466967_0534425 | 3300045976 | Bacteria | 1153 |
| 153 | Ga0495603_0321035 | 3300046455 | Bacteria | 889 |
| 154 | Ga0495623_0038768 | 3300046679 | Bacteria | 3047 |
| 155 | Ga0495658_0179778 | 3300046683 | Bacteria | 1312 |
| 156 | Ga0495581_0135913 | 3300047315 | Bacteria | 1433 |
| 157 | Ga0495604_0004607 | 3300047317 | Bacteria | 10923 |
| 158 | Ga0496102_0116946 | 3300048905 | Bacteria | 2488 |
| 159 | Ga0496104_0207628 | 3300048907 | Bacteria | 1870 |
| 160 | Ga0496105_0257403 | 3300048908 | Bacteria | 1412 |
| 161 | Ga0496106_0050481 | 3300048909 | Bacteria | 3135 |
| 162 | Ga0496107_0074608 | 3300048910 | Bacteria | 2468 |
| 163 | Ga0496108_0157966 | 3300048911 | Bacteria | 1958 |
| 164 | Ga0496110_0040009 | 3300048913 | Bacteria | 4084 |
| 165 | Ga0496111_0086590 | 3300048914 | Bacteria | 2292 |
| 166 | Ga0496112_0070204 | 3300048915 | Bacteria | 3462 |
| 167 | Ga0496113_0208083 | 3300048916 | Bacteria | 1556 |
| 168 | Ga0496114_0123547 | 3300048917 | Bacteria | 2228 |
| 169 | Ga0496114_0653883 | 3300048917 | Bacteria | 924 |
| 170 | Ga0496115_0021897 | 3300048918 | Bacteria | 4942 |
| 171 | Ga0496117_0118959 | 3300048920 | Bacteria | 1627 |
| 172 | Ga0496118_0081138 | 3300048921 | Bacteria | 2278 |
| 173 | Ga0496122_0000548 | 3300048925 | Bacteria | 77737 |
| 174 | Ga0496124_0110021 | 3300048927 | Bacteria | 2219 |
| 175 | Ga0496125_0000025 | 3300048928 | Bacteria | 440074 |
| 176 | Ga0501032_0008865 | 3300049569 | Bacteria | 7313 |
| 177 | Ga0501032_0103269 | 3300049569 | Bacteria | 1889 |
| 178 | Ga0501034_0013592 | 3300049571 | Bacteria | 8378 |
| 179 | Ga0501038_0006642 | 3300049574 | Bacteria | 10696 |
| 180 | Ga0501038_0218670 | 3300049574 | Bacteria | 1521 |
| 181 | Ga0501039_0442043 | 3300049575 | Bacteria | 1021 |
| 182 | Ga0501040_0217779 | 3300049576 | Bacteria | 1358 |
| 183 | Ga0501043_0007425 | 3300049579 | Bacteria | 8701 |
| 184 | Ga0501046_0001931 | 3300049580 | Bacteria | 19689 |
| 185 | Ga0501047_0000018 | 3300049581 | Bacteria | 274180 |
| 186 | Ga0501047_0038282 | 3300049581 | Bacteria | 4640 |
| 187 | Ga0501048_0549947 | 3300049582 | Bacteria | 828 |
| 188 | Ga0501070_0144415 | 3300049586 | Bacteria | 1964 |
| 189 | Ga0501083_0291490 | 3300049744 | Bacteria | 1061 |
| 190 | Ga0501044_0011630 | 3300049823 | Bacteria | 9539 |
| 191 | nmdc:mga05p37_284744_c1 | 3300050507 | Bacteria | 1969 |
| 192 | nmdc:mga0rr50_767806_c1 | 3300050513 | Bacteria | 823 |
| 193 | nmdc:mga0sz30_23832_c2 | 3300050516 | Bacteria | 1454 |
| 194 | Ga0501082_0009212 | 3300060353 | Bacteria | 8509 |
| 195 | 2644014195 | 2643221601 | Bacteria | 7493239 |
| 196 | 2644175415 | 2643221631 | Bacteria | 8168043 |
| 197 | 2644445184 | 2643221679 | Bacteria | 3839507 |
| 198 | 2729904957 | 2728369276 | Bacteria | 5610032 |
| 199 | 2731905579 | 2731639228 | Bacteria | 4187555 |
| 200 | 2760307522 | 2758568522 | Bacteria | 5953541 |
| 201 | 2812365028 | 2811994880 | Bacteria | 4147780 |
| 202 | 2819743333 | 2818991472 | Bacteria | 10089953 |
| 203 | 2835191747 | 2835188231 | Bacteria | 3476928 |
| 204 | 2873320727 | 2873314349 | Bacteria | 8512634 |
| 205 | 2884995329 | 2884994152 | Bacteria | 4492978 |
| 206 | 2925329812 | 2925326138 | Bacteria | 9652120 |
| 207 | 2932431735 | 2932431166 | Bacteria | 4215299 |
| 208 | 8055066855 | 8055066027 | Bacteria | 9479577 |
| 209 | 8055178865 | 8055172936 | Bacteria | 9305943 |
| 210 | Ga0070666_10153786 | |||
| 211 | JGI24740J21852_10013339 | |||
| 212 | JGI24735J21928_10021861 | |||
| 213 | Ga0070658_10042346 | |||
| 214 | Ga0070658_10284049 | |||
| 215 | Ga0070683_100278860 | |||
| 216 | Ga0070680_100438450 | |||
| 217 | Ga0070680_100487550 | |||
| 218 | Ga0070660_100523533 | |||
| 219 | Ga0070692_10068401 | |||
| 220 | Ga0070668_100024323 | |||
| 221 | Ga0070688_100201797 | |||
| 222 | Ga0070659_100076530 | |||
| 223 | Ga0070667_100165433 | |||
| 224 | Ga0070709_10299833 | |||
| 225 | Ga0070714_100004428 | |||
| 226 | Ga0070714_100139609 | |||
| 227 | Ga0070710_10039922 | |||
| 228 | Ga0070701_10045511 | |||
| 229 | Ga0070700_100159407 | |||
| 230 | Ga0070694_100149288 | |||
| 231 | Ga0070708_100123299 | |||
| 232 | Ga0070708_100384253 | |||
| 233 | Ga0070678_100112473 | |||
| 234 | Ga0070681_10183754 | |||
| 235 | Ga0070706_100028358 | |||
| 236 | Ga0070679_100011782 | |||
| 237 | Ga0070679_100493122 | |||
| 238 | Ga0070697_100116478 | |||
| 239 | Ga0070686_100220120 | |||
| 240 | Ga0070696_100001381 | |||
| 241 | Ga0070696_100033681 | |||
| 242 | Ga0070665_100145609 | |||
| 243 | Ga0070704_100367048 | |||
| 244 | Ga0068855_100189781 | |||
| 245 | Ga0070664_100225211 | |||
| 246 | Ga0068854_100263134 | |||
| 247 | Ga0068864_100183056 | |||
| 248 | Ga0068861_100009125 | |||
| 249 | Ga0068851_10032921 | |||
| 250 | Ga0081540_1006994 | |||
| 251 | Ga0081539_10007530 | |||
| 252 | Ga0070717_10066123 | |||
| 253 | Ga0075364_10391478 | |||
| 254 | Ga0070715_10017091 | |||
| 255 | Ga0070716_100004741 | |||
| 256 | Ga0068865_100085303 | |||
| 257 | Ga0068865_100288616 | |||
| 258 | Ga0105240_10000007 | |||
| 259 | Ga0105240_10014143 | |||
| 260 | Ga0111539_10099020 | |||
| 261 | Ga0105245_10139415 | |||
| 262 | Ga0105247_10019078 | |||
| 263 | Ga0114129_10384246 | |||
| 264 | Ga0105243_10118439 | |||
| 265 | Ga0105241_10073725 | |||
| 266 | Ga0105242_10154547 | |||
| 267 | Ga0105237_10342277 | |||
| 268 | Ga0105238_10162244 | |||
| 269 | Ga0105249_10034094 | |||
| 270 | Ga0105239_10128443 | |||
| 271 | Ga0105239_10527146 | |||
| 272 | Ga0157371_10125734 | |||
| 273 | Ga0157374_10205676 | |||
| 274 | Ga0163162_10898894 | |||
| 275 | Ga0157372_10198167 | |||
| 276 | Ga0157375_10008112 | |||
| 277 | Ga0163163_10146342 | |||
| 278 | Ga0157379_10129571 | |||
| 279 | Ga0163161_10030428 | |||
| 280 | Ga0206353_10970424 | |||
| 281 | Ga0206353_11297471 | |||
| 282 | Ga0213876_10011081 | |||
| 283 | Ga0207642_10041681 | |||
| 284 | Ga0207710_10065901 | |||
| 285 | Ga0207688_10038307 | |||
| 286 | Ga0207647_10001748 | |||
| 287 | Ga0207685_10063657 | |||
| 288 | Ga0207705_10216965 | |||
| 289 | Ga0207684_10041993 | |||
| 290 | Ga0207707_10105172 | |||
| 291 | Ga0207695_10043246 | |||
| 292 | Ga0207671_10145491 | |||
| 293 | Ga0207671_10213444 | |||
| 294 | Ga0207693_10038175 | |||
| 295 | Ga0207652_10006886 | |||
| 296 | Ga0207694_10298735 | |||
| 297 | Ga0207687_10216069 | |||
| 298 | Ga0207700_10389259 | |||
| 299 | Ga0207664_10015771 | |||
| 300 | Ga0207664_10211624 | |||
| 301 | Ga0207706_10023346 | |||
| 302 | Ga0207704_10437839 | |||
| 303 | Ga0207665_10000352 | |||
| 304 | Ga0207711_10313219 | |||
| 305 | Ga0207689_10027957 | |||
| 306 | Ga0207689_10408557 | |||
| 307 | Ga0207679_10191175 | |||
| 308 | Ga0207667_10424694 | |||
| 309 | Ga0207712_10094659 | |||
| 310 | Ga0207668_10128360 | |||
| 311 | Ga0207640_10269076 | |||
| 312 | Ga0207658_10249665 | |||
| 313 | Ga0207678_10000065 | |||
| 314 | Ga0207678_10054767 | |||
| 315 | Ga0207708_10074975 | |||
| 316 | Ga0207702_10114012 | |||
| 317 | Ga0207683_10003541 | |||
| 318 | Ga0207683_10075084 | |||
| 319 | Ga0268266_10512279 | |||
| 320 | Ga0268264_10294041 | |||
| 321 | Ga0316575_10000014 | |||
| 322 | Ga0316579_10000008 | |||
| 323 | Ga0307416_100057454 | |||
| 324 | Ga0307411_10205929 | |||
| 325 | Ga0307415_100062735 | |||
| 326 | Ga0307415_100365664 | |||
| 327 | Ga0373929_0063577 | |||
| 328 | Ga0373951_0009514 | |||
| 329 | Ga0373932_0031716 | |||
| 330 | Ga0373939_0045957 | |||
| 331 | Ga0373960_0051985 | |||
| 332 | Ga0373931_0384383 | |||
| 333 | Ga0395900_0051649 | |||
| 334 | Ga0395898_0338003 | |||
| 335 | Ga0436364_1256159 | |||
| 336 | Ga0395901_0302420 | |||
| 337 | Ga0436365_1405010 | |||
| 338 | Ga0466965_0307886 | |||
| 339 | Ga0466966_0066102 | |||
| 340 | Ga0466961_0169501 | |||
| 341 | Ga0466963_0010253 | |||
| 342 | Ga0466963_0287501 | |||
| 343 | Ga0466963_0310371 | |||
| 344 | Ga0466963_0485407 | |||
| 345 | Ga0466963_0493454 | |||
| 346 | Ga0466964_0052927 | |||
| 347 | Ga0466971_0047479 | |||
| 348 | Ga0466968_0185938 | |||
| 349 | Ga0466957_0004090 | |||
| 350 | Ga0466960_0024777 | |||
| 351 | Ga0466960_0144384 | |||
| 352 | Ga0466959_0102550 | |||
| 353 | Ga0466959_0160289 | |||
| 354 | Ga0466959_0163832 | |||
| 355 | Ga0466958_0061688 | |||
| 356 | Ga0466958_0064207 | |||
| 357 | Ga0466967_0020726 | |||
| 358 | Ga0466967_0040454 | |||
| 359 | Ga0466967_0042657 | |||
| 360 | Ga0466967_0241880 | |||
| 361 | Ga0466967_0534425 | |||
| 362 | Ga0495603_0321035 | |||
| 363 | Ga0495623_0038768 | |||
| 364 | Ga0495658_0179778 | |||
| 365 | Ga0495581_0135913 | |||
| 366 | Ga0495604_0004607 | |||
| 367 | Ga0496102_0116946 | |||
| 368 | Ga0496104_0207628 | |||
| 369 | Ga0496105_0257403 | |||
| 370 | Ga0496106_0050481 | |||
| 371 | Ga0496107_0074608 | |||
| 372 | Ga0496108_0157966 | |||
| 373 | Ga0496110_0040009 | |||
| 374 | Ga0496111_0086590 | |||
| 375 | Ga0496112_0070204 | |||
| 376 | Ga0496113_0208083 | |||
| 377 | Ga0496114_0123547 | |||
| 378 | Ga0496114_0653883 | |||
| 379 | Ga0496115_0021897 | |||
| 380 | Ga0496117_0118959 | |||
| 381 | Ga0496118_0081138 | |||
| 382 | Ga0496122_0000548 | |||
| 383 | Ga0496124_0110021 | |||
| 384 | Ga0496125_0000025 | |||
| 385 | Ga0501032_0008865 | |||
| 386 | Ga0501032_0103269 | |||
| 387 | Ga0501034_0013592 | |||
| 388 | Ga0501038_0006642 | |||
| 389 | Ga0501038_0218670 | |||
| 390 | Ga0501039_0442043 | |||
| 391 | Ga0501040_0217779 | |||
| 392 | Ga0501043_0007425 | |||
| 393 | Ga0501046_0001931 | |||
| 394 | Ga0501047_0000018 | |||
| 395 | Ga0501047_0038282 | |||
| 396 | Ga0501048_0549947 | |||
| 397 | Ga0501070_0144415 | |||
| 398 | Ga0501083_0291490 | |||
| 399 | Ga0501044_0011630 | |||
| 400 | nmdc:mga05p37_284744_c1 | |||
| 401 | nmdc:mga0rr50_767806_c1 | |||
| 402 | nmdc:mga0sz30_23832_c2 | |||
| 403 | Ga0501082_0009212 | |||
| 404 | 2644014195 | |||
| 405 | 2644175415 | |||
| 406 | 2644445184 | |||
| 407 | 2729904957 | |||
| 408 | 2731905579 | |||
| 409 | 2760307522 | |||
| 410 | 2812365028 | |||
| 411 | 2819743333 | |||
| 412 | 2835191747 | |||
| 413 | 2873320727 | |||
| 414 | 2884995329 | |||
| 415 | 2925329812 | |||
| 416 | 2932431735 | |||
| 417 | 8055066855 | |||
| 418 | 8055178865 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1gpw-assembly2.cif.gz_C | structural evidence for ammonia tunneling across the (beta/alpha)8 barrel of the imidazole glycerol phosphate synthase bienzyme complex. | 0.9668 | 3 | 260 |
| 6vdg-assembly1.cif.gz_A | crystal structure of the y182a hisf mutant from thermotoga maritima | 0.9666 | 4 | 260 |
| 2wjz-assembly2.cif.gz_E | crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity | 0.9627 | 3 | 260 |
| 7qc9-assembly1.cif.gz_A | hisf-c9a-d11e-v33a_l50h_i52h mutant in complex with ni(ii) from t. maritima | 0.9588 | 3 | 260 |
| 6vdg-assembly1.cif.gz_A | crystal structure of the y182a hisf mutant from thermotoga maritima | 0.9586 | 4 | 260 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUU3_1_249_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9619 | 4 | 257 | 3.20.20.70 |
| 3tdnA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9515 | 124 | 232 | 3.40.50.12600 |
| af_Q2FUU3_1_249_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9506 | 4 | 257 | 3.20.20.70 |
| af_Q57854_1_272_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9436 | 3 | 260 | 3.20.20.70 |
| af_Q57854_1_272_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9329 | 3 | 260 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A655FPA8-F1-model_v4 | deleted | 0.9912 | 64 | 260 |
|
| AF-A0A2S8MAV5-F1-model_v4 | deleted | 0.9895 | 83 | 260 |
|
| AF-A0A6J7SHT2-F1-model_v4 | imidazole glycerol-phosphate synthase (EC 4.3.2.10) | 0.9882 | 64 | 260 |
GO:0000105
GO:0000107 GO:0016829 |
| AF-A0A7C8FUZ3-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (EC 4.3.2.10) (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) (IGPS subunit HisF) | 0.9878 | 1 | 260 |
GO:0000105
GO:0000107 GO:0005737 GO:0016829 |
| AF-A0A344W2U6-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (EC 4.3.2.10) (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) (IGPS subunit HisF) | 0.9874 | 1 | 260 |
GO:0000105
GO:0000107 GO:0005737 GO:0016829 |