F318698
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 209 | 155 | 418 | 326 |
Family's Representative Sequence
| Representative Sequence | 3300005334|Ga0068869_100123010|Ga0068869_1001230102 |
| Length | 367 |
| Sequence | MRTLRLFEPNTTALILKKPWSSEMNVKSVAGQLGERRARFALLSHSARPLAGHRSVSDFAALTKPRVMMLAVFTALVGLSSAPSRLDPLTTFAAVLAIAAGAGAAGVLNMWYDADIDAVMTRTAMRPIPRGKISRFEALVFGLVLGGFAVAVLALATNLTTILFYIVVYTAWLKRATRQNIVIGGAAGALPPVIGWIAATGEIGLEPLALFLIIFLWTPPHFWALALNRADDYARAGVPMLPVVAGRVATTRQILIYSGLMVLASGLPWLLGFAGTIYGVIVAISGAAFLLLALQLNRSIGADRRAAQRLFLFSVAYLFLLFAALLIDSGAISSRDTRPAVKSAPAASLSRDLRTAHNFTIATADEV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 4 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 18 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 19 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 20 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 21 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 22 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 24 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 25 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 29 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 30 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 31 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 32 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 33 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 34 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 35 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 44 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 63 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 64 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 65 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 66 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 67 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 68 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 69 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 70 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 71 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 72 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 92 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 93 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 94 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 95 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 96 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 97 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 98 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 99 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 100 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 101 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 102 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 103 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 104 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 105 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 106 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 107 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 108 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 109 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 110 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 111 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 112 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 113 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 114 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 115 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 116 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 117 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 118 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 119 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 120 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 121 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 122 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 123 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 124 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 125 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 126 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 127 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 128 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 129 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 130 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 131 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 132 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 133 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 134 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 135 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 136 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 137 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 138 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 139 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 140 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 141 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 142 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 143 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 144 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 145 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 146 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 147 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 148 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 149 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 150 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 151 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 152 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 153 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 154 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 155 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.47 |
| Metatranscriptomes | 0 |
| Isolates | 21.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11 |
| Nodule | 18.66 |
| Rhizoplane | 1.44 |
| Rhizosphere | 59.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068869_100123010 | 3300005334 | Bacteria | 1986 |
| 2 | JGI24750J21931_1005684 | 3300002070 | Bacteria | 1537 |
| 3 | Ga0068869_100000485 | 3300005334 | Bacteria | 22024 |
| 4 | Ga0070692_10074001 | 3300005345 | Bacteria | 1821 |
| 5 | Ga0070668_100126009 | 3300005347 | Bacteria | 2051 |
| 6 | Ga0070668_100216011 | 3300005347 | Bacteria | 1579 |
| 7 | Ga0070669_100031084 | 3300005353 | Bacteria | 3855 |
| 8 | Ga0070667_100002926 | 3300005367 | Bacteria | 14672 |
| 9 | Ga0070709_10000143 | 3300005434 | Bacteria | 47770 |
| 10 | Ga0070709_10000745 | 3300005434 | Bacteria | 18426 |
| 11 | Ga0070714_100001062 | 3300005435 | Bacteria | 19632 |
| 12 | Ga0070714_100025084 | 3300005435 | Bacteria | 4917 |
| 13 | Ga0070714_100039761 | 3300005435 | Bacteria | 3961 |
| 14 | Ga0070714_100125514 | 3300005435 | Bacteria | 2288 |
| 15 | Ga0070713_100004537 | 3300005436 | Bacteria | 9354 |
| 16 | Ga0070713_100006491 | 3300005436 | Bacteria | 8113 |
| 17 | Ga0070713_100101774 | 3300005436 | Bacteria | 2489 |
| 18 | Ga0070713_100187362 | 3300005436 | Bacteria | 1863 |
| 19 | Ga0070710_10000126 | 3300005437 | Bacteria | 35287 |
| 20 | Ga0070710_10000322 | 3300005437 | Bacteria | 22854 |
| 21 | Ga0070710_10000608 | 3300005437 | Bacteria | 17022 |
| 22 | Ga0070711_100001017 | 3300005439 | Bacteria | 14917 |
| 23 | Ga0070711_100004554 | 3300005439 | Bacteria | 8201 |
| 24 | Ga0070711_100016374 | 3300005439 | Bacteria | 4708 |
| 25 | Ga0070705_100194709 | 3300005440 | Bacteria | 1385 |
| 26 | Ga0070694_100021046 | 3300005444 | Bacteria | 4163 |
| 27 | Ga0070662_100026858 | 3300005457 | Bacteria | 3990 |
| 28 | Ga0070698_100011573 | 3300005471 | Bacteria | 9362 |
| 29 | Ga0070698_100067102 | 3300005471 | Bacteria | 3609 |
| 30 | Ga0070699_100125688 | 3300005518 | Bacteria | 2258 |
| 31 | Ga0068861_100152344 | 3300005719 | Bacteria | 1898 |
| 32 | Ga0068861_100211053 | 3300005719 | Bacteria | 1635 |
| 33 | Ga0068858_100125989 | 3300005842 | Bacteria | 2399 |
| 34 | Ga0068860_100000071 | 3300005843 | Bacteria | 178413 |
| 35 | Ga0068860_100012301 | 3300005843 | Bacteria | 8431 |
| 36 | Ga0068860_100047840 | 3300005843 | Bacteria | 4076 |
| 37 | Ga0068862_100186021 | 3300005844 | Bacteria | 1866 |
| 38 | Ga0081540_1023735 | 3300005983 | Bacteria | 3577 |
| 39 | Ga0070717_10000743 | 3300006028 | Bacteria | 21255 |
| 40 | Ga0070717_10096820 | 3300006028 | Bacteria | 2500 |
| 41 | Ga0070717_10176364 | 3300006028 | Bacteria | 1861 |
| 42 | Ga0075368_10016656 | 3300006042 | Bacteria | 2741 |
| 43 | Ga0075363_100045232 | 3300006048 | Bacteria | 2334 |
| 44 | Ga0070715_10003801 | 3300006163 | Bacteria | 4873 |
| 45 | Ga0070716_100001137 | 3300006173 | Bacteria | 11726 |
| 46 | Ga0070716_100004201 | 3300006173 | Bacteria | 6853 |
| 47 | Ga0070712_100007306 | 3300006175 | Bacteria | 6893 |
| 48 | Ga0070712_100007543 | 3300006175 | Bacteria | 6800 |
| 49 | Ga0070712_100044449 | 3300006175 | Bacteria | 3063 |
| 50 | Ga0075367_10025355 | 3300006178 | Bacteria | 3353 |
| 51 | Ga0075369_10059772 | 3300006186 | Bacteria | 1661 |
| 52 | Ga0075366_10048400 | 3300006195 | Bacteria | 2521 |
| 53 | Ga0075370_10004570 | 3300006353 | Bacteria | 6743 |
| 54 | Ga0075434_100185047 | 3300006871 | Bacteria | 2103 |
| 55 | Ga0075435_100211753 | 3300007076 | Bacteria | 1645 |
| 56 | Ga0099794_10076557 | 3300007265 | Bacteria | 1645 |
| 57 | Ga0105250_10008683 | 3300009092 | Bacteria | 4304 |
| 58 | Ga0105243_10260727 | 3300009148 | Bacteria | 1552 |
| 59 | Ga0105243_10391223 | 3300009148 | Bacteria | 1289 |
| 60 | Ga0105249_10034569 | 3300009553 | Bacteria | 4582 |
| 61 | Ga0105239_10004627 | 3300010375 | Bacteria | 16355 |
| 62 | Ga0105239_10340903 | 3300010375 | Bacteria | 1691 |
| 63 | Ga0163162_10125339 | 3300013306 | Bacteria | 2674 |
| 64 | Ga0163163_10249128 | 3300014325 | Bacteria | 1827 |
| 65 | Ga0157379_10132140 | 3300014968 | Bacteria | 2247 |
| 66 | Ga0163161_10203837 | 3300017792 | Bacteria | 1525 |
| 67 | Ga0209256_1036137 | 3300025299 | Bacteria | 1298 |
| 68 | Ga0207696_1013086 | 3300025711 | Bacteria | 2908 |
| 69 | Ga0207692_10000353 | 3300025898 | Bacteria | 15820 |
| 70 | Ga0207692_10000427 | 3300025898 | Bacteria | 14774 |
| 71 | Ga0207692_10007503 | 3300025898 | Bacteria | 4473 |
| 72 | Ga0207692_10052805 | 3300025898 | Bacteria | 2067 |
| 73 | Ga0207685_10122211 | 3300025905 | Bacteria | 1144 |
| 74 | Ga0207699_10000213 | 3300025906 | Bacteria | 34254 |
| 75 | Ga0207699_10000802 | 3300025906 | Bacteria | 15010 |
| 76 | Ga0207693_10007423 | 3300025915 | Bacteria | 9015 |
| 77 | Ga0207693_10015259 | 3300025915 | Bacteria | 6165 |
| 78 | Ga0207693_10052773 | 3300025915 | Bacteria | 3189 |
| 79 | Ga0207693_10105604 | 3300025915 | Bacteria | 2209 |
| 80 | Ga0207663_10000618 | 3300025916 | Bacteria | 15747 |
| 81 | Ga0207663_10000933 | 3300025916 | Bacteria | 13325 |
| 82 | Ga0207681_10016754 | 3300025923 | Bacteria | 4592 |
| 83 | Ga0207700_10054465 | 3300025928 | Bacteria | 3003 |
| 84 | Ga0207664_10007216 | 3300025929 | Bacteria | 7698 |
| 85 | Ga0207664_10015539 | 3300025929 | Bacteria | 5529 |
| 86 | Ga0207664_10110308 | 3300025929 | Bacteria | 2288 |
| 87 | Ga0207664_10118393 | 3300025929 | Bacteria | 2212 |
| 88 | Ga0207706_10015582 | 3300025933 | Bacteria | 6868 |
| 89 | Ga0207665_10000154 | 3300025939 | Bacteria | 46682 |
| 90 | Ga0207665_10001647 | 3300025939 | Bacteria | 15037 |
| 91 | Ga0207689_10000572 | 3300025942 | Bacteria | 35176 |
| 92 | Ga0207689_10047532 | 3300025942 | Bacteria | 3542 |
| 93 | Ga0207712_10005412 | 3300025961 | Bacteria | 8055 |
| 94 | Ga0207712_10027546 | 3300025961 | Bacteria | 3796 |
| 95 | Ga0207668_10001282 | 3300025972 | Bacteria | 14975 |
| 96 | Ga0207668_10089097 | 3300025972 | Bacteria | 2261 |
| 97 | Ga0207668_10194233 | 3300025972 | Bacteria | 1611 |
| 98 | Ga0207641_10014342 | 3300026088 | Bacteria | 6495 |
| 99 | Ga0207675_100007783 | 3300026118 | Bacteria | 10108 |
| 100 | Ga0207675_100029894 | 3300026118 | Bacteria | 5072 |
| 101 | Ga0207675_100127979 | 3300026118 | Bacteria | 2407 |
| 102 | Ga0268265_10001129 | 3300028380 | Bacteria | 23587 |
| 103 | Ga0268264_10000073 | 3300028381 | Bacteria | 260615 |
| 104 | Ga0268264_10129096 | 3300028381 | Bacteria | 2238 |
| 105 | Ga0268264_10266984 | 3300028381 | Bacteria | 1597 |
| 106 | Ga0307515_10163222 | 3300028794 | Bacteria | 2260 |
| 107 | Ga0307511_10030723 | 3300030521 | Bacteria | 4819 |
| 108 | Ga0307513_10124655 | 3300031456 | Bacteria | 2535 |
| 109 | Ga0307509_10180580 | 3300031507 | Bacteria | 1976 |
| 110 | Ga0265314_10059049 | 3300031711 | Bacteria | 2626 |
| 111 | Ga0307516_10005693 | 3300031730 | Bacteria | 14771 |
| 112 | Ga0307507_10012192 | 3300033179 | Bacteria | 10667 |
| 113 | Ga0307510_10135007 | 3300033180 | Bacteria | 2128 |
| 114 | Ga0307510_10172462 | 3300033180 | Bacteria | 1740 |
| 115 | Ga0373935_0027075 | 3300035692 | Bacteria | 3544 |
| 116 | Ga0373947_0162550 | 3300035725 | Bacteria | 1445 |
| 117 | Ga0495594_0083704 | 3300046499 | Bacteria | 1783 |
| 118 | Ga0495606_0001928 | 3300046507 | Bacteria | 25740 |
| 119 | Ga0495631_0105107 | 3300046518 | Bacteria | 1215 |
| 120 | Ga0495632_0156168 | 3300046519 | Bacteria | 1053 |
| 121 | Ga0495643_0129060 | 3300046522 | Bacteria | 1271 |
| 122 | Ga0495648_0004938 | 3300046524 | Bacteria | 11210 |
| 123 | Ga0495648_0013676 | 3300046524 | Bacteria | 5985 |
| 124 | Ga0495656_0071983 | 3300046615 | Bacteria | 1538 |
| 125 | Ga0495668_0086299 | 3300046616 | Bacteria | 1721 |
| 126 | Ga0495634_0154194 | 3300046642 | Bacteria | 1451 |
| 127 | Ga0495611_0072188 | 3300046648 | Bacteria | 1579 |
| 128 | Ga0495611_0073452 | 3300046648 | Bacteria | 1566 |
| 129 | Ga0495625_0251598 | 3300046660 | Bacteria | 1147 |
| 130 | Ga0495659_0033490 | 3300046664 | Bacteria | 1804 |
| 131 | Ga0495588_0008065 | 3300046674 | Bacteria | 4815 |
| 132 | Ga0495671_0110920 | 3300046692 | Bacteria | 1340 |
| 133 | Ga0495649_0082572 | 3300046694 | Bacteria | 1717 |
| 134 | Ga0495636_0033837 | 3300047318 | Bacteria | 2102 |
| 135 | Ga0495636_0090362 | 3300047318 | Bacteria | 1329 |
| 136 | Ga0495672_0015323 | 3300047320 | Bacteria | 5210 |
| 137 | Ga0495676_0029201 | 3300047321 | Bacteria | 4697 |
| 138 | Ga0495673_0060343 | 3300047469 | Bacteria | 1627 |
| 139 | Ga0496103_0154541 | 3300048906 | Bacteria | 1470 |
| 140 | Ga0496108_0185053 | 3300048911 | Bacteria | 1804 |
| 141 | Ga0496111_0035735 | 3300048914 | Bacteria | 3553 |
| 142 | Ga0496117_0059106 | 3300048920 | Bacteria | 2651 |
| 143 | Ga0496118_0227834 | 3300048921 | Bacteria | 1078 |
| 144 | Ga0496121_0000578 | 3300048924 | Bacteria | 68826 |
| 145 | Ga0496121_0149307 | 3300048924 | Bacteria | 1722 |
| 146 | Ga0496126_0000602 | 3300048929 | Bacteria | 67975 |
| 147 | nmdc:mga0yw44_41377_c1 | 3300050492 | Bacteria | 2201 |
| 148 | nmdc:mga0k408_20553_c1 | 3300050493 | Bacteria | 3700 |
| 149 | nmdc:mga04h51_7257_c1 | 3300050495 | Bacteria | 2916 |
| 150 | nmdc:mga07m45_2395_c1 | 3300050496 | Bacteria | 8792 |
| 151 | nmdc:mga0n895_483352_c1 | 3300050512 | Bacteria | 1249 |
| 152 | nmdc:mga0rr50_196490_c1 | 3300050513 | Bacteria | 1656 |
| 153 | nmdc:mga0sz30_106223_c1 | 3300050516 | Bacteria | 1229 |
| 154 | nmdc:mga0sz30_84929_c1 | 3300050516 | Bacteria | 1373 |
| 155 | Ga0500566_0018447 | 3300053094 | Bacteria | 4097 |
| 156 | Ga0500555_002647 | 3300053103 | Bacteria | 5154 |
| 157 | Ga0500556_0000005 | 3300053104 | Bacteria | 581135 |
| 158 | Ga0500642_0041135 | 3300053130 | Bacteria | 1998 |
| 159 | Ga0500642_0041142 | 3300053130 | Bacteria | 1998 |
| 160 | Ga0500568_0006097 | 3300053139 | Bacteria | 6111 |
| 161 | Ga0500577_0021633 | 3300053142 | Bacteria | 2122 |
| 162 | Ga0500639_044664 | 3300053163 | Bacteria | 2320 |
| 163 | Ga0500639_089489 | 3300053163 | Bacteria | 1536 |
| 164 | Ga0500552_007800 | 3300053733 | Bacteria | 1247 |
| 165 | 2824662246 | 2824661429 | Bacteria | 9877870 |
| 166 | 2874632558 | 2874628541 | Bacteria | 8630250 |
| 167 | 2879107400 | 2879099564 | Bacteria | 10442239 |
| 168 | 2885416162 | 2885409591 | Bacteria | 9235467 |
| 169 | 2903757275 | 2903748898 | Bacteria | 9972761 |
| 170 | 2932797111 | 2932794094 | Bacteria | 7915132 |
| 171 | 2932807459 | 2932801729 | Bacteria | 7987968 |
| 172 | 2932816193 | 2932809354 | Bacteria | 9135765 |
| 173 | 2932819595 | 2932818245 | Bacteria | 9955613 |
| 174 | 2932836222 | 2932828146 | Bacteria | 9745859 |
| 175 | 2935616967 | 2935616580 | Bacteria | 9032984 |
| 176 | 2935636329 | 2935630451 | Bacteria | 8169952 |
| 177 | 2935675280 | 2935675223 | Bacteria | 9928132 |
| 178 | 2935687622 | 2935684952 | Bacteria | 9590419 |
| 179 | 2935711718 | 2935703347 | Bacteria | 10242284 |
| 180 | 2935719082 | 2935713505 | Bacteria | 9608509 |
| 181 | 2935728734 | 2935722832 | Bacteria | 9608746 |
| 182 | 2935736670 | 2935732158 | Bacteria | 9706831 |
| 183 | 2935746329 | 2935741537 | Bacteria | 9707219 |
| 184 | 2935753588 | 2935750917 | Bacteria | 9590372 |
| 185 | 2935764766 | 2935760218 | Bacteria | 9817913 |
| 186 | 2935810136 | 2935801545 | Bacteria | 9301974 |
| 187 | 2935813741 | 2935810662 | Bacteria | 9401221 |
| 188 | 2935855591 | 2935855204 | Bacteria | 9035059 |
| 189 | 2935867164 | 2935864058 | Bacteria | 9784707 |
| 190 | 2935870060 | 2935864058 | Bacteria | 9784707 |
| 191 | 2935876016 | 2935873716 | Bacteria | 9632195 |
| 192 | 2936003957 | 2936002035 | Bacteria | 9362176 |
| 193 | 2936042913 | 2936037263 | Bacteria | 9446081 |
| 194 | 2940559501 | 2940556831 | Bacteria | 9590747 |
| 195 | 2941512960 | 2941507105 | Bacteria | 8166816 |
| 196 | 2941520738 | 2941515067 | Bacteria | 8166720 |
| 197 | 2941528753 | 2941523033 | Bacteria | 8169134 |
| 198 | 3005712808 | 3005710791 | Bacteria | 7622528 |
| 199 | 8006986709 | 8006984368 | Bacteria | 9651211 |
| 200 | 8006993961 | 8006984368 | Bacteria | 9651211 |
| 201 | 8016521607 | 8016511872 | Bacteria | 9921665 |
| 202 | 8016631167 | 8016630954 | Bacteria | 9217207 |
| 203 | 8017064033 | 8017057580 | Bacteria | 10023680 |
| 204 | 8019559349 | 8019555841 | Bacteria | 9642137 |
| 205 | 8019565949 | 8019565922 | Bacteria | 9639779 |
| 206 | 8019583355 | 8019576017 | Bacteria | 10049540 |
| 207 | 8019591166 | 8019586578 | Bacteria | 10212056 |
| 208 | 8019600171 | 8019597564 | Bacteria | 10041141 |
| 209 | 8019618370 | 8019608314 | Bacteria | 10042931 |
| 210 | Ga0068869_100123010 | |||
| 211 | JGI24750J21931_1005684 | |||
| 212 | Ga0068869_100000485 | |||
| 213 | Ga0070692_10074001 | |||
| 214 | Ga0070668_100126009 | |||
| 215 | Ga0070668_100216011 | |||
| 216 | Ga0070669_100031084 | |||
| 217 | Ga0070667_100002926 | |||
| 218 | Ga0070709_10000143 | |||
| 219 | Ga0070709_10000745 | |||
| 220 | Ga0070714_100001062 | |||
| 221 | Ga0070714_100025084 | |||
| 222 | Ga0070714_100039761 | |||
| 223 | Ga0070714_100125514 | |||
| 224 | Ga0070713_100004537 | |||
| 225 | Ga0070713_100006491 | |||
| 226 | Ga0070713_100101774 | |||
| 227 | Ga0070713_100187362 | |||
| 228 | Ga0070710_10000126 | |||
| 229 | Ga0070710_10000322 | |||
| 230 | Ga0070710_10000608 | |||
| 231 | Ga0070711_100001017 | |||
| 232 | Ga0070711_100004554 | |||
| 233 | Ga0070711_100016374 | |||
| 234 | Ga0070705_100194709 | |||
| 235 | Ga0070694_100021046 | |||
| 236 | Ga0070662_100026858 | |||
| 237 | Ga0070698_100011573 | |||
| 238 | Ga0070698_100067102 | |||
| 239 | Ga0070699_100125688 | |||
| 240 | Ga0068861_100152344 | |||
| 241 | Ga0068861_100211053 | |||
| 242 | Ga0068858_100125989 | |||
| 243 | Ga0068860_100000071 | |||
| 244 | Ga0068860_100012301 | |||
| 245 | Ga0068860_100047840 | |||
| 246 | Ga0068862_100186021 | |||
| 247 | Ga0081540_1023735 | |||
| 248 | Ga0070717_10000743 | |||
| 249 | Ga0070717_10096820 | |||
| 250 | Ga0070717_10176364 | |||
| 251 | Ga0075368_10016656 | |||
| 252 | Ga0075363_100045232 | |||
| 253 | Ga0070715_10003801 | |||
| 254 | Ga0070716_100001137 | |||
| 255 | Ga0070716_100004201 | |||
| 256 | Ga0070712_100007306 | |||
| 257 | Ga0070712_100007543 | |||
| 258 | Ga0070712_100044449 | |||
| 259 | Ga0075367_10025355 | |||
| 260 | Ga0075369_10059772 | |||
| 261 | Ga0075366_10048400 | |||
| 262 | Ga0075370_10004570 | |||
| 263 | Ga0075434_100185047 | |||
| 264 | Ga0075435_100211753 | |||
| 265 | Ga0099794_10076557 | |||
| 266 | Ga0105250_10008683 | |||
| 267 | Ga0105243_10260727 | |||
| 268 | Ga0105243_10391223 | |||
| 269 | Ga0105249_10034569 | |||
| 270 | Ga0105239_10004627 | |||
| 271 | Ga0105239_10340903 | |||
| 272 | Ga0163162_10125339 | |||
| 273 | Ga0163163_10249128 | |||
| 274 | Ga0157379_10132140 | |||
| 275 | Ga0163161_10203837 | |||
| 276 | Ga0209256_1036137 | |||
| 277 | Ga0207696_1013086 | |||
| 278 | Ga0207692_10000353 | |||
| 279 | Ga0207692_10000427 | |||
| 280 | Ga0207692_10007503 | |||
| 281 | Ga0207692_10052805 | |||
| 282 | Ga0207685_10122211 | |||
| 283 | Ga0207699_10000213 | |||
| 284 | Ga0207699_10000802 | |||
| 285 | Ga0207693_10007423 | |||
| 286 | Ga0207693_10015259 | |||
| 287 | Ga0207693_10052773 | |||
| 288 | Ga0207693_10105604 | |||
| 289 | Ga0207663_10000618 | |||
| 290 | Ga0207663_10000933 | |||
| 291 | Ga0207681_10016754 | |||
| 292 | Ga0207700_10054465 | |||
| 293 | Ga0207664_10007216 | |||
| 294 | Ga0207664_10015539 | |||
| 295 | Ga0207664_10110308 | |||
| 296 | Ga0207664_10118393 | |||
| 297 | Ga0207706_10015582 | |||
| 298 | Ga0207665_10000154 | |||
| 299 | Ga0207665_10001647 | |||
| 300 | Ga0207689_10000572 | |||
| 301 | Ga0207689_10047532 | |||
| 302 | Ga0207712_10005412 | |||
| 303 | Ga0207712_10027546 | |||
| 304 | Ga0207668_10001282 | |||
| 305 | Ga0207668_10089097 | |||
| 306 | Ga0207668_10194233 | |||
| 307 | Ga0207641_10014342 | |||
| 308 | Ga0207675_100007783 | |||
| 309 | Ga0207675_100029894 | |||
| 310 | Ga0207675_100127979 | |||
| 311 | Ga0268265_10001129 | |||
| 312 | Ga0268264_10000073 | |||
| 313 | Ga0268264_10129096 | |||
| 314 | Ga0268264_10266984 | |||
| 315 | Ga0307515_10163222 | |||
| 316 | Ga0307511_10030723 | |||
| 317 | Ga0307513_10124655 | |||
| 318 | Ga0307509_10180580 | |||
| 319 | Ga0265314_10059049 | |||
| 320 | Ga0307516_10005693 | |||
| 321 | Ga0307507_10012192 | |||
| 322 | Ga0307510_10135007 | |||
| 323 | Ga0307510_10172462 | |||
| 324 | Ga0373935_0027075 | |||
| 325 | Ga0373947_0162550 | |||
| 326 | Ga0495594_0083704 | |||
| 327 | Ga0495606_0001928 | |||
| 328 | Ga0495631_0105107 | |||
| 329 | Ga0495632_0156168 | |||
| 330 | Ga0495643_0129060 | |||
| 331 | Ga0495648_0004938 | |||
| 332 | Ga0495648_0013676 | |||
| 333 | Ga0495656_0071983 | |||
| 334 | Ga0495668_0086299 | |||
| 335 | Ga0495634_0154194 | |||
| 336 | Ga0495611_0072188 | |||
| 337 | Ga0495611_0073452 | |||
| 338 | Ga0495625_0251598 | |||
| 339 | Ga0495659_0033490 | |||
| 340 | Ga0495588_0008065 | |||
| 341 | Ga0495671_0110920 | |||
| 342 | Ga0495649_0082572 | |||
| 343 | Ga0495636_0033837 | |||
| 344 | Ga0495636_0090362 | |||
| 345 | Ga0495672_0015323 | |||
| 346 | Ga0495676_0029201 | |||
| 347 | Ga0495673_0060343 | |||
| 348 | Ga0496103_0154541 | |||
| 349 | Ga0496108_0185053 | |||
| 350 | Ga0496111_0035735 | |||
| 351 | Ga0496117_0059106 | |||
| 352 | Ga0496118_0227834 | |||
| 353 | Ga0496121_0000578 | |||
| 354 | Ga0496121_0149307 | |||
| 355 | Ga0496126_0000602 | |||
| 356 | nmdc:mga0yw44_41377_c1 | |||
| 357 | nmdc:mga0k408_20553_c1 | |||
| 358 | nmdc:mga04h51_7257_c1 | |||
| 359 | nmdc:mga07m45_2395_c1 | |||
| 360 | nmdc:mga0n895_483352_c1 | |||
| 361 | nmdc:mga0rr50_196490_c1 | |||
| 362 | nmdc:mga0sz30_106223_c1 | |||
| 363 | nmdc:mga0sz30_84929_c1 | |||
| 364 | Ga0500566_0018447 | |||
| 365 | Ga0500555_002647 | |||
| 366 | Ga0500556_0000005 | |||
| 367 | Ga0500642_0041135 | |||
| 368 | Ga0500642_0041142 | |||
| 369 | Ga0500568_0006097 | |||
| 370 | Ga0500577_0021633 | |||
| 371 | Ga0500639_044664 | |||
| 372 | Ga0500639_089489 | |||
| 373 | Ga0500552_007800 | |||
| 374 | 2824662246 | |||
| 375 | 2874632558 | |||
| 376 | 2879107400 | |||
| 377 | 2885416162 | |||
| 378 | 2903757275 | |||
| 379 | 2932797111 | |||
| 380 | 2932807459 | |||
| 381 | 2932816193 | |||
| 382 | 2932819595 | |||
| 383 | 2932836222 | |||
| 384 | 2935616967 | |||
| 385 | 2935636329 | |||
| 386 | 2935675280 | |||
| 387 | 2935687622 | |||
| 388 | 2935711718 | |||
| 389 | 2935719082 | |||
| 390 | 2935728734 | |||
| 391 | 2935736670 | |||
| 392 | 2935746329 | |||
| 393 | 2935753588 | |||
| 394 | 2935764766 | |||
| 395 | 2935810136 | |||
| 396 | 2935813741 | |||
| 397 | 2935855591 | |||
| 398 | 2935867164 | |||
| 399 | 2935870060 | |||
| 400 | 2935876016 | |||
| 401 | 2936003957 | |||
| 402 | 2936042913 | |||
| 403 | 2940559501 | |||
| 404 | 2941512960 | |||
| 405 | 2941520738 | |||
| 406 | 2941528753 | |||
| 407 | 3005712808 | |||
| 408 | 8006986709 | |||
| 409 | 8006993961 | |||
| 410 | 8016521607 | |||
| 411 | 8016631167 | |||
| 412 | 8017064033 | |||
| 413 | 8019559349 | |||
| 414 | 8019565949 | |||
| 415 | 8019583355 | |||
| 416 | 8019591166 | |||
| 417 | 8019600171 | |||
| 418 | 8019618370 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fdo-assembly1.cif.gz_C | sars-cov-2 fusion peptide epitope scaffold fp15 bound to dh1058 | 0.6968 | 139 | 247 |
| 8fdo-assembly1.cif.gz_C | sars-cov-2 fusion peptide epitope scaffold fp15 bound to dh1058 | 0.6634 | 139 | 247 |
| 7bpu-assembly1.cif.gz_A | structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes | 0.6164 | 4 | 257 |
| 6gow-assembly1.cif.gz_E | crystal structure of the flagellin-flis complex from bacillus subtilis crystallized in spacegroup p22121 | 0.5812 | 125 | 253 |
| 7uuw-assembly1.cif.gz_G | cryogenic electron microscopy 3d map of f-actin bound by the actin binding domain of alpha-catenin ortholog, hmp1 | 0.5801 | 139 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57727_161_283_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.9172 | 134 | 256 | 1.20.120.1780 |
| af_P0AEA5_183_296_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.9095 | 155 | 254 | 1.20.1070.10 |
| af_Q57727_161_283_1.20.120.1780 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase | 0.8895 | 134 | 256 | 1.20.120.1780 |
| af_F1LVF4_308_442_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8731 | 134 | 254 | 1.20.120.550 |
| af_P9WFR7_179_308_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8639 | 134 | 256 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4V1V452-F1-model_v4 | Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) | 0.9569 | 117 | 258 |
GO:0005886
GO:0006783 GO:0008495 |
| AF-A0A4S0RQE1-F1-model_v4 | Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) | 0.9531 | 129 | 265 |
GO:0005886
GO:0006783 GO:0008495 |
| AF-A0A532D535-F1-model_v4 | Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) | 0.9511 | 120 | 264 |
GO:0005886
GO:0006783 GO:0008495 |
| AF-A0A7V8HIX6-F1-model_v4 | deleted | 0.9352 | 133 | 255 |
|
| AF-A0A4S0RQE1-F1-model_v4 | Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) | 0.927 | 129 | 265 |
GO:0005886
GO:0006783 GO:0008495 |