F318698

General Info

Members Datasets Scaffolds Average Seq Length
209 155 418 326

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100123010|Ga0068869_1001230102
Length 367
Sequence MRTLRLFEPNTTALILKKPWSSEMNVKSVAGQLGERRARFALLSHSARPLAGHRSVSDFAALTKPRVMMLAVFTALVGLSSAPSRLDPLTTFAAVLAIAAGAGAAGVLNMWYDADIDAVMTRTAMRPIPRGKISRFEALVFGLVLGGFAVAVLALATNLTTILFYIVVYTAWLKRATRQNIVIGGAAGALPPVIGWIAATGEIGLEPLALFLIIFLWTPPHFWALALNRADDYARAGVPMLPVVAGRVATTRQILIYSGLMVLASGLPWLLGFAGTIYGVIVAISGAAFLLLALQLNRSIGADRRAAQRLFLFSVAYLFLLFAALLIDSGAISSRDTRPAVKSAPAASLSRDLRTAHNFTIATADEV

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
69 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
70 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
73 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
74 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
75 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
76 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
77 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
78 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
79 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
80 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
81 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
82 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
83 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
84 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
85 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
86 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
87 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
88 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
89 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
90 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
95 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
99 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
100 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
101 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
104 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
105 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
106 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
107 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
108 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
109 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
110 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
111 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
112 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
113 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
114 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
115 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
116 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
117 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
118 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
119 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
120 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
121 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
122 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
123 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
124 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
125 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
126 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
127 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
128 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
129 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
130 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
131 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
132 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
133 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
134 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
135 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
136 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
137 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
138 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
139 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
140 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
141 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
142 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
143 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
144 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
145 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
146 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
147 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
148 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
149 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
150 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
151 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
152 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
153 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
154 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
155 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.47
Metatranscriptomes 0
Isolates 21.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11
Nodule 18.66
Rhizoplane 1.44
Rhizosphere 59.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100123010 3300005334 Bacteria 1986
2 JGI24750J21931_1005684 3300002070 Bacteria 1537
3 Ga0068869_100000485 3300005334 Bacteria 22024
4 Ga0070692_10074001 3300005345 Bacteria 1821
5 Ga0070668_100126009 3300005347 Bacteria 2051
6 Ga0070668_100216011 3300005347 Bacteria 1579
7 Ga0070669_100031084 3300005353 Bacteria 3855
8 Ga0070667_100002926 3300005367 Bacteria 14672
9 Ga0070709_10000143 3300005434 Bacteria 47770
10 Ga0070709_10000745 3300005434 Bacteria 18426
11 Ga0070714_100001062 3300005435 Bacteria 19632
12 Ga0070714_100025084 3300005435 Bacteria 4917
13 Ga0070714_100039761 3300005435 Bacteria 3961
14 Ga0070714_100125514 3300005435 Bacteria 2288
15 Ga0070713_100004537 3300005436 Bacteria 9354
16 Ga0070713_100006491 3300005436 Bacteria 8113
17 Ga0070713_100101774 3300005436 Bacteria 2489
18 Ga0070713_100187362 3300005436 Bacteria 1863
19 Ga0070710_10000126 3300005437 Bacteria 35287
20 Ga0070710_10000322 3300005437 Bacteria 22854
21 Ga0070710_10000608 3300005437 Bacteria 17022
22 Ga0070711_100001017 3300005439 Bacteria 14917
23 Ga0070711_100004554 3300005439 Bacteria 8201
24 Ga0070711_100016374 3300005439 Bacteria 4708
25 Ga0070705_100194709 3300005440 Bacteria 1385
26 Ga0070694_100021046 3300005444 Bacteria 4163
27 Ga0070662_100026858 3300005457 Bacteria 3990
28 Ga0070698_100011573 3300005471 Bacteria 9362
29 Ga0070698_100067102 3300005471 Bacteria 3609
30 Ga0070699_100125688 3300005518 Bacteria 2258
31 Ga0068861_100152344 3300005719 Bacteria 1898
32 Ga0068861_100211053 3300005719 Bacteria 1635
33 Ga0068858_100125989 3300005842 Bacteria 2399
34 Ga0068860_100000071 3300005843 Bacteria 178413
35 Ga0068860_100012301 3300005843 Bacteria 8431
36 Ga0068860_100047840 3300005843 Bacteria 4076
37 Ga0068862_100186021 3300005844 Bacteria 1866
38 Ga0081540_1023735 3300005983 Bacteria 3577
39 Ga0070717_10000743 3300006028 Bacteria 21255
40 Ga0070717_10096820 3300006028 Bacteria 2500
41 Ga0070717_10176364 3300006028 Bacteria 1861
42 Ga0075368_10016656 3300006042 Bacteria 2741
43 Ga0075363_100045232 3300006048 Bacteria 2334
44 Ga0070715_10003801 3300006163 Bacteria 4873
45 Ga0070716_100001137 3300006173 Bacteria 11726
46 Ga0070716_100004201 3300006173 Bacteria 6853
47 Ga0070712_100007306 3300006175 Bacteria 6893
48 Ga0070712_100007543 3300006175 Bacteria 6800
49 Ga0070712_100044449 3300006175 Bacteria 3063
50 Ga0075367_10025355 3300006178 Bacteria 3353
51 Ga0075369_10059772 3300006186 Bacteria 1661
52 Ga0075366_10048400 3300006195 Bacteria 2521
53 Ga0075370_10004570 3300006353 Bacteria 6743
54 Ga0075434_100185047 3300006871 Bacteria 2103
55 Ga0075435_100211753 3300007076 Bacteria 1645
56 Ga0099794_10076557 3300007265 Bacteria 1645
57 Ga0105250_10008683 3300009092 Bacteria 4304
58 Ga0105243_10260727 3300009148 Bacteria 1552
59 Ga0105243_10391223 3300009148 Bacteria 1289
60 Ga0105249_10034569 3300009553 Bacteria 4582
61 Ga0105239_10004627 3300010375 Bacteria 16355
62 Ga0105239_10340903 3300010375 Bacteria 1691
63 Ga0163162_10125339 3300013306 Bacteria 2674
64 Ga0163163_10249128 3300014325 Bacteria 1827
65 Ga0157379_10132140 3300014968 Bacteria 2247
66 Ga0163161_10203837 3300017792 Bacteria 1525
67 Ga0209256_1036137 3300025299 Bacteria 1298
68 Ga0207696_1013086 3300025711 Bacteria 2908
69 Ga0207692_10000353 3300025898 Bacteria 15820
70 Ga0207692_10000427 3300025898 Bacteria 14774
71 Ga0207692_10007503 3300025898 Bacteria 4473
72 Ga0207692_10052805 3300025898 Bacteria 2067
73 Ga0207685_10122211 3300025905 Bacteria 1144
74 Ga0207699_10000213 3300025906 Bacteria 34254
75 Ga0207699_10000802 3300025906 Bacteria 15010
76 Ga0207693_10007423 3300025915 Bacteria 9015
77 Ga0207693_10015259 3300025915 Bacteria 6165
78 Ga0207693_10052773 3300025915 Bacteria 3189
79 Ga0207693_10105604 3300025915 Bacteria 2209
80 Ga0207663_10000618 3300025916 Bacteria 15747
81 Ga0207663_10000933 3300025916 Bacteria 13325
82 Ga0207681_10016754 3300025923 Bacteria 4592
83 Ga0207700_10054465 3300025928 Bacteria 3003
84 Ga0207664_10007216 3300025929 Bacteria 7698
85 Ga0207664_10015539 3300025929 Bacteria 5529
86 Ga0207664_10110308 3300025929 Bacteria 2288
87 Ga0207664_10118393 3300025929 Bacteria 2212
88 Ga0207706_10015582 3300025933 Bacteria 6868
89 Ga0207665_10000154 3300025939 Bacteria 46682
90 Ga0207665_10001647 3300025939 Bacteria 15037
91 Ga0207689_10000572 3300025942 Bacteria 35176
92 Ga0207689_10047532 3300025942 Bacteria 3542
93 Ga0207712_10005412 3300025961 Bacteria 8055
94 Ga0207712_10027546 3300025961 Bacteria 3796
95 Ga0207668_10001282 3300025972 Bacteria 14975
96 Ga0207668_10089097 3300025972 Bacteria 2261
97 Ga0207668_10194233 3300025972 Bacteria 1611
98 Ga0207641_10014342 3300026088 Bacteria 6495
99 Ga0207675_100007783 3300026118 Bacteria 10108
100 Ga0207675_100029894 3300026118 Bacteria 5072
101 Ga0207675_100127979 3300026118 Bacteria 2407
102 Ga0268265_10001129 3300028380 Bacteria 23587
103 Ga0268264_10000073 3300028381 Bacteria 260615
104 Ga0268264_10129096 3300028381 Bacteria 2238
105 Ga0268264_10266984 3300028381 Bacteria 1597
106 Ga0307515_10163222 3300028794 Bacteria 2260
107 Ga0307511_10030723 3300030521 Bacteria 4819
108 Ga0307513_10124655 3300031456 Bacteria 2535
109 Ga0307509_10180580 3300031507 Bacteria 1976
110 Ga0265314_10059049 3300031711 Bacteria 2626
111 Ga0307516_10005693 3300031730 Bacteria 14771
112 Ga0307507_10012192 3300033179 Bacteria 10667
113 Ga0307510_10135007 3300033180 Bacteria 2128
114 Ga0307510_10172462 3300033180 Bacteria 1740
115 Ga0373935_0027075 3300035692 Bacteria 3544
116 Ga0373947_0162550 3300035725 Bacteria 1445
117 Ga0495594_0083704 3300046499 Bacteria 1783
118 Ga0495606_0001928 3300046507 Bacteria 25740
119 Ga0495631_0105107 3300046518 Bacteria 1215
120 Ga0495632_0156168 3300046519 Bacteria 1053
121 Ga0495643_0129060 3300046522 Bacteria 1271
122 Ga0495648_0004938 3300046524 Bacteria 11210
123 Ga0495648_0013676 3300046524 Bacteria 5985
124 Ga0495656_0071983 3300046615 Bacteria 1538
125 Ga0495668_0086299 3300046616 Bacteria 1721
126 Ga0495634_0154194 3300046642 Bacteria 1451
127 Ga0495611_0072188 3300046648 Bacteria 1579
128 Ga0495611_0073452 3300046648 Bacteria 1566
129 Ga0495625_0251598 3300046660 Bacteria 1147
130 Ga0495659_0033490 3300046664 Bacteria 1804
131 Ga0495588_0008065 3300046674 Bacteria 4815
132 Ga0495671_0110920 3300046692 Bacteria 1340
133 Ga0495649_0082572 3300046694 Bacteria 1717
134 Ga0495636_0033837 3300047318 Bacteria 2102
135 Ga0495636_0090362 3300047318 Bacteria 1329
136 Ga0495672_0015323 3300047320 Bacteria 5210
137 Ga0495676_0029201 3300047321 Bacteria 4697
138 Ga0495673_0060343 3300047469 Bacteria 1627
139 Ga0496103_0154541 3300048906 Bacteria 1470
140 Ga0496108_0185053 3300048911 Bacteria 1804
141 Ga0496111_0035735 3300048914 Bacteria 3553
142 Ga0496117_0059106 3300048920 Bacteria 2651
143 Ga0496118_0227834 3300048921 Bacteria 1078
144 Ga0496121_0000578 3300048924 Bacteria 68826
145 Ga0496121_0149307 3300048924 Bacteria 1722
146 Ga0496126_0000602 3300048929 Bacteria 67975
147 nmdc:mga0yw44_41377_c1 3300050492 Bacteria 2201
148 nmdc:mga0k408_20553_c1 3300050493 Bacteria 3700
149 nmdc:mga04h51_7257_c1 3300050495 Bacteria 2916
150 nmdc:mga07m45_2395_c1 3300050496 Bacteria 8792
151 nmdc:mga0n895_483352_c1 3300050512 Bacteria 1249
152 nmdc:mga0rr50_196490_c1 3300050513 Bacteria 1656
153 nmdc:mga0sz30_106223_c1 3300050516 Bacteria 1229
154 nmdc:mga0sz30_84929_c1 3300050516 Bacteria 1373
155 Ga0500566_0018447 3300053094 Bacteria 4097
156 Ga0500555_002647 3300053103 Bacteria 5154
157 Ga0500556_0000005 3300053104 Bacteria 581135
158 Ga0500642_0041135 3300053130 Bacteria 1998
159 Ga0500642_0041142 3300053130 Bacteria 1998
160 Ga0500568_0006097 3300053139 Bacteria 6111
161 Ga0500577_0021633 3300053142 Bacteria 2122
162 Ga0500639_044664 3300053163 Bacteria 2320
163 Ga0500639_089489 3300053163 Bacteria 1536
164 Ga0500552_007800 3300053733 Bacteria 1247
165 2824662246 2824661429 Bacteria 9877870
166 2874632558 2874628541 Bacteria 8630250
167 2879107400 2879099564 Bacteria 10442239
168 2885416162 2885409591 Bacteria 9235467
169 2903757275 2903748898 Bacteria 9972761
170 2932797111 2932794094 Bacteria 7915132
171 2932807459 2932801729 Bacteria 7987968
172 2932816193 2932809354 Bacteria 9135765
173 2932819595 2932818245 Bacteria 9955613
174 2932836222 2932828146 Bacteria 9745859
175 2935616967 2935616580 Bacteria 9032984
176 2935636329 2935630451 Bacteria 8169952
177 2935675280 2935675223 Bacteria 9928132
178 2935687622 2935684952 Bacteria 9590419
179 2935711718 2935703347 Bacteria 10242284
180 2935719082 2935713505 Bacteria 9608509
181 2935728734 2935722832 Bacteria 9608746
182 2935736670 2935732158 Bacteria 9706831
183 2935746329 2935741537 Bacteria 9707219
184 2935753588 2935750917 Bacteria 9590372
185 2935764766 2935760218 Bacteria 9817913
186 2935810136 2935801545 Bacteria 9301974
187 2935813741 2935810662 Bacteria 9401221
188 2935855591 2935855204 Bacteria 9035059
189 2935867164 2935864058 Bacteria 9784707
190 2935870060 2935864058 Bacteria 9784707
191 2935876016 2935873716 Bacteria 9632195
192 2936003957 2936002035 Bacteria 9362176
193 2936042913 2936037263 Bacteria 9446081
194 2940559501 2940556831 Bacteria 9590747
195 2941512960 2941507105 Bacteria 8166816
196 2941520738 2941515067 Bacteria 8166720
197 2941528753 2941523033 Bacteria 8169134
198 3005712808 3005710791 Bacteria 7622528
199 8006986709 8006984368 Bacteria 9651211
200 8006993961 8006984368 Bacteria 9651211
201 8016521607 8016511872 Bacteria 9921665
202 8016631167 8016630954 Bacteria 9217207
203 8017064033 8017057580 Bacteria 10023680
204 8019559349 8019555841 Bacteria 9642137
205 8019565949 8019565922 Bacteria 9639779
206 8019583355 8019576017 Bacteria 10049540
207 8019591166 8019586578 Bacteria 10212056
208 8019600171 8019597564 Bacteria 10041141
209 8019618370 8019608314 Bacteria 10042931
210 Ga0068869_100123010
211 JGI24750J21931_1005684
212 Ga0068869_100000485
213 Ga0070692_10074001
214 Ga0070668_100126009
215 Ga0070668_100216011
216 Ga0070669_100031084
217 Ga0070667_100002926
218 Ga0070709_10000143
219 Ga0070709_10000745
220 Ga0070714_100001062
221 Ga0070714_100025084
222 Ga0070714_100039761
223 Ga0070714_100125514
224 Ga0070713_100004537
225 Ga0070713_100006491
226 Ga0070713_100101774
227 Ga0070713_100187362
228 Ga0070710_10000126
229 Ga0070710_10000322
230 Ga0070710_10000608
231 Ga0070711_100001017
232 Ga0070711_100004554
233 Ga0070711_100016374
234 Ga0070705_100194709
235 Ga0070694_100021046
236 Ga0070662_100026858
237 Ga0070698_100011573
238 Ga0070698_100067102
239 Ga0070699_100125688
240 Ga0068861_100152344
241 Ga0068861_100211053
242 Ga0068858_100125989
243 Ga0068860_100000071
244 Ga0068860_100012301
245 Ga0068860_100047840
246 Ga0068862_100186021
247 Ga0081540_1023735
248 Ga0070717_10000743
249 Ga0070717_10096820
250 Ga0070717_10176364
251 Ga0075368_10016656
252 Ga0075363_100045232
253 Ga0070715_10003801
254 Ga0070716_100001137
255 Ga0070716_100004201
256 Ga0070712_100007306
257 Ga0070712_100007543
258 Ga0070712_100044449
259 Ga0075367_10025355
260 Ga0075369_10059772
261 Ga0075366_10048400
262 Ga0075370_10004570
263 Ga0075434_100185047
264 Ga0075435_100211753
265 Ga0099794_10076557
266 Ga0105250_10008683
267 Ga0105243_10260727
268 Ga0105243_10391223
269 Ga0105249_10034569
270 Ga0105239_10004627
271 Ga0105239_10340903
272 Ga0163162_10125339
273 Ga0163163_10249128
274 Ga0157379_10132140
275 Ga0163161_10203837
276 Ga0209256_1036137
277 Ga0207696_1013086
278 Ga0207692_10000353
279 Ga0207692_10000427
280 Ga0207692_10007503
281 Ga0207692_10052805
282 Ga0207685_10122211
283 Ga0207699_10000213
284 Ga0207699_10000802
285 Ga0207693_10007423
286 Ga0207693_10015259
287 Ga0207693_10052773
288 Ga0207693_10105604
289 Ga0207663_10000618
290 Ga0207663_10000933
291 Ga0207681_10016754
292 Ga0207700_10054465
293 Ga0207664_10007216
294 Ga0207664_10015539
295 Ga0207664_10110308
296 Ga0207664_10118393
297 Ga0207706_10015582
298 Ga0207665_10000154
299 Ga0207665_10001647
300 Ga0207689_10000572
301 Ga0207689_10047532
302 Ga0207712_10005412
303 Ga0207712_10027546
304 Ga0207668_10001282
305 Ga0207668_10089097
306 Ga0207668_10194233
307 Ga0207641_10014342
308 Ga0207675_100007783
309 Ga0207675_100029894
310 Ga0207675_100127979
311 Ga0268265_10001129
312 Ga0268264_10000073
313 Ga0268264_10129096
314 Ga0268264_10266984
315 Ga0307515_10163222
316 Ga0307511_10030723
317 Ga0307513_10124655
318 Ga0307509_10180580
319 Ga0265314_10059049
320 Ga0307516_10005693
321 Ga0307507_10012192
322 Ga0307510_10135007
323 Ga0307510_10172462
324 Ga0373935_0027075
325 Ga0373947_0162550
326 Ga0495594_0083704
327 Ga0495606_0001928
328 Ga0495631_0105107
329 Ga0495632_0156168
330 Ga0495643_0129060
331 Ga0495648_0004938
332 Ga0495648_0013676
333 Ga0495656_0071983
334 Ga0495668_0086299
335 Ga0495634_0154194
336 Ga0495611_0072188
337 Ga0495611_0073452
338 Ga0495625_0251598
339 Ga0495659_0033490
340 Ga0495588_0008065
341 Ga0495671_0110920
342 Ga0495649_0082572
343 Ga0495636_0033837
344 Ga0495636_0090362
345 Ga0495672_0015323
346 Ga0495676_0029201
347 Ga0495673_0060343
348 Ga0496103_0154541
349 Ga0496108_0185053
350 Ga0496111_0035735
351 Ga0496117_0059106
352 Ga0496118_0227834
353 Ga0496121_0000578
354 Ga0496121_0149307
355 Ga0496126_0000602
356 nmdc:mga0yw44_41377_c1
357 nmdc:mga0k408_20553_c1
358 nmdc:mga04h51_7257_c1
359 nmdc:mga07m45_2395_c1
360 nmdc:mga0n895_483352_c1
361 nmdc:mga0rr50_196490_c1
362 nmdc:mga0sz30_106223_c1
363 nmdc:mga0sz30_84929_c1
364 Ga0500566_0018447
365 Ga0500555_002647
366 Ga0500556_0000005
367 Ga0500642_0041135
368 Ga0500642_0041142
369 Ga0500568_0006097
370 Ga0500577_0021633
371 Ga0500639_044664
372 Ga0500639_089489
373 Ga0500552_007800
374 2824662246
375 2874632558
376 2879107400
377 2885416162
378 2903757275
379 2932797111
380 2932807459
381 2932816193
382 2932819595
383 2932836222
384 2935616967
385 2935636329
386 2935675280
387 2935687622
388 2935711718
389 2935719082
390 2935728734
391 2935736670
392 2935746329
393 2935753588
394 2935764766
395 2935810136
396 2935813741
397 2935855591
398 2935867164
399 2935870060
400 2935876016
401 2936003957
402 2936042913
403 2940559501
404 2941512960
405 2941520738
406 2941528753
407 3005712808
408 8006986709
409 8006993961
410 8016521607
411 8016631167
412 8017064033
413 8019559349
414 8019565949
415 8019583355
416 8019591166
417 8019600171
418 8019618370

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

71

327

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fdo-assembly1.cif.gz_C sars-cov-2 fusion peptide epitope scaffold fp15 bound to dh1058 0.6968 139 247
8fdo-assembly1.cif.gz_C sars-cov-2 fusion peptide epitope scaffold fp15 bound to dh1058 0.6634 139 247
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.6164 4 257
6gow-assembly1.cif.gz_E crystal structure of the flagellin-flis complex from bacillus subtilis crystallized in spacegroup p22121 0.5812 125 253
7uuw-assembly1.cif.gz_G cryogenic electron microscopy 3d map of f-actin bound by the actin binding domain of alpha-catenin ortholog, hmp1 0.5801 139 255
ID Description Score Start End Superfamily
af_Q57727_161_283_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.9172 134 256 1.20.120.1780
af_P0AEA5_183_296_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9095 155 254 1.20.1070.10
af_Q57727_161_283_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.8895 134 256 1.20.120.1780
af_F1LVF4_308_442_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8731 134 254 1.20.120.550
af_P9WFR7_179_308_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8639 134 256 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A4V1V452-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.9569 117 258 GO:0005886
GO:0006783
GO:0008495
AF-A0A4S0RQE1-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.9531 129 265 GO:0005886
GO:0006783
GO:0008495
AF-A0A532D535-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.9511 120 264 GO:0005886
GO:0006783
GO:0008495
AF-A0A7V8HIX6-F1-model_v4 deleted 0.9352 133 255
AF-A0A4S0RQE1-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.927 129 265 GO:0005886
GO:0006783
GO:0008495

Map