F318083

General Info

Members Datasets Scaffolds Average Seq Length
208 110 416 229

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0002751|Ga0373925_0002751_2100_2894
Length 264
Sequence MRSGRAVSVPEIIVNQLSAIGHLRVRASWPSLRYSHLMPRFNRPFDPSAMKLIIFDLDGTLVDSRLDLIASVNAMLREFRRAELPGDVVASYVGDGAPMLVRRALGDPEDEGFFKHALEFFLTYYRAHKLDHTTVYEGIPEALKQIESDGSERKMAVLSNKPVNPSRAIVDALGLGKFFVRVYGGNSFETKKPDPLGVRTLLRETGTAPERAMIIGDSSIDVLTGRNAGIATCGVTYGFAPHTLCEVPPDVVVETPQELGELFV

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
43 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
44 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
67 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
69 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
88 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
93 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
96 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
103 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
104 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
105 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
108 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 1.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.92
Rhizosphere 98.08
Stem 0
Stem Tuber 0
Unclassified 18.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0002751 3300037068 Bacteria 13916
2 Ga0065715_10014222 3300005293 Bacteria 2291
3 Ga0070658_10042266 3300005327 Bacteria 3681
4 Ga0070680_100488867 3300005336 Unclassified 1052
5 Ga0070682_100341737 3300005337 Bacteria 1113
6 Ga0070709_10065573 3300005434 Bacteria 2326
7 Ga0070709_10370965 3300005434 Bacteria 1062
8 Ga0070714_100024485 3300005435 Bacteria 4972
9 Ga0070714_100067203 3300005435 Bacteria 3090
10 Ga0070714_100075180 3300005435 Bacteria 2931
11 Ga0070714_100172963 3300005435 Bacteria 1961
12 Ga0070714_100607548 3300005435 Bacteria 1050
13 Ga0070714_101059863 3300005435 Bacteria 790
14 Ga0070713_100025663 3300005436 Bacteria 4612
15 Ga0070713_100026764 3300005436 Bacteria 4533
16 Ga0070713_100118270 3300005436 Bacteria 2320
17 Ga0070713_100206958 3300005436 Bacteria 1774
18 Ga0070713_100220395 3300005436 Bacteria 1721
19 Ga0070713_100516217 3300005436 Unclassified 1129
20 Ga0070710_10041148 3300005437 Unclassified 2549
21 Ga0070710_10126959 3300005437 Bacteria 1550
22 Ga0070711_100000654 3300005439 Bacteria 18086
23 Ga0070711_100213196 3300005439 Bacteria 1497
24 Ga0070708_100002466 3300005445 Bacteria 14292
25 Ga0070708_100043246 3300005445 Bacteria 3958
26 Ga0070708_100125604 3300005445 Bacteria 2371
27 Ga0070708_100348009 3300005445 Bacteria 1396
28 Ga0070706_100001446 3300005467 Bacteria 24984
29 Ga0070706_100048515 3300005467 Bacteria 3919
30 Ga0070706_100121367 3300005467 Bacteria 2436
31 Ga0070706_100328040 3300005467 Bacteria 1427
32 Ga0070707_100042456 3300005468 Bacteria 4354
33 Ga0070707_100149161 3300005468 Bacteria 2277
34 Ga0070707_100550056 3300005468 Unclassified 1116
35 Ga0070698_100161663 3300005471 Bacteria 2183
36 Ga0070679_100047198 3300005530 Bacteria 4293
37 Ga0070697_100001537 3300005536 Bacteria 17579
38 Ga0070697_100601440 3300005536 Bacteria 966
39 Ga0068857_100021277 3300005577 Bacteria 5709
40 Ga0068854_100035494 3300005578 Unclassified 3489
41 Ga0068854_100151500 3300005578 Bacteria 1789
42 Ga0068856_100017713 3300005614 Bacteria 6908
43 Ga0068856_100114876 3300005614 Unclassified 2691
44 Ga0070717_10004986 3300006028 Bacteria 9658
45 Ga0070717_10010480 3300006028 Bacteria 7002
46 Ga0070717_10024674 3300006028 Unclassified 4777
47 Ga0070717_10027963 3300006028 Bacteria 4510
48 Ga0070717_10032626 3300006028 Bacteria 4198
49 Ga0070717_10866519 3300006028 Bacteria 822
50 Ga0070715_10001953 3300006163 Bacteria 6209
51 Ga0070715_10054242 3300006163 Bacteria 1735
52 Ga0070716_100099767 3300006173 Bacteria 1777
53 Ga0070712_100000276 3300006175 Bacteria 28822
54 Ga0070712_100028682 3300006175 Bacteria 3725
55 Ga0070712_100084501 3300006175 Unclassified 2308
56 Ga0070712_100229725 3300006175 Bacteria 1473
57 Ga0070712_100426107 3300006175 Bacteria 1100
58 Ga0070712_100615846 3300006175 Bacteria 920
59 Ga0097621_100068141 3300006237 Bacteria 2934
60 Ga0068871_100009814 3300006358 Bacteria 6949
61 Ga0075433_10058876 3300006852 Bacteria 3361
62 Ga0075434_100000057 3300006871 Bacteria 55865
63 Ga0075434_100005298 3300006871 Bacteria 11733
64 Ga0075436_100084203 3300006914 Unclassified 2207
65 Ga0075436_100185412 3300006914 Bacteria 1471
66 Ga0075435_100000016 3300007076 Bacteria 99722
67 Ga0075435_100015714 3300007076 Bacteria 5695
68 Ga0075435_100043119 3300007076 Bacteria 3611
69 Ga0105240_10028204 3300009093 Bacteria 7336
70 Ga0105240_10131452 3300009093 Bacteria 3002
71 Ga0105240_10280277 3300009093 Bacteria 1915
72 Ga0114129_10370519 3300009147 Unclassified 1893
73 Ga0105241_10002840 3300009174 Bacteria 12944
74 Ga0105237_10006040 3300009545 Bacteria 13552
75 Ga0105239_10067230 3300010375 Bacteria 3937
76 Ga0105239_10323623 3300010375 Unclassified 1739
77 Ga0157373_10014265 3300013100 Bacteria 5829
78 Ga0157370_10075073 3300013104 Bacteria 3188
79 Ga0157369_10147208 3300013105 Bacteria 2490
80 Ga0157374_10104323 3300013296 Unclassified 2722
81 Ga0157372_10006999 3300013307 Bacteria 12014
82 Ga0157372_10012564 3300013307 Bacteria 9018
83 Ga0157372_10027533 3300013307 Bacteria 6193
84 Ga0157372_10374277 3300013307 Bacteria 1660
85 Ga0157372_10980214 3300013307 Bacteria 979
86 Ga0163163_10080269 3300014325 Bacteria 3262
87 Ga0157376_10054009 3300014969 Unclassified 3347
88 Ga0157376_10156164 3300014969 Bacteria 2063
89 Ga0182006_1008428 3300015261 Bacteria 4669
90 Ga0182007_10012145 3300015262 Bacteria 3325
91 Ga0228598_1000005 3300024227 Bacteria 30376
92 Ga0207692_10255232 3300025898 Bacteria 1052
93 Ga0207692_10347402 3300025898 Bacteria 914
94 Ga0207685_10006933 3300025905 Unclassified 3123
95 Ga0207699_10042122 3300025906 Bacteria 2642
96 Ga0207699_10275500 3300025906 Bacteria 1167
97 Ga0207684_10014840 3300025910 Bacteria 6704
98 Ga0207684_10047457 3300025910 Bacteria 3642
99 Ga0207684_10110348 3300025910 Bacteria 2355
100 Ga0207654_10142132 3300025911 Bacteria 1532
101 Ga0207707_10258763 3300025912 Bacteria 1510
102 Ga0207695_10006987 3300025913 Bacteria 14489
103 Ga0207695_10305007 3300025913 Bacteria 1483
104 Ga0207693_10000098 3300025915 Bacteria 77389
105 Ga0207693_10004748 3300025915 Bacteria 11428
106 Ga0207693_10024901 3300025915 Bacteria 4746
107 Ga0207693_10498018 3300025915 Bacteria 951
108 Ga0207663_10000482 3300025916 Bacteria 17342
109 Ga0207663_10196905 3300025916 Bacteria 1451
110 Ga0207660_10374065 3300025917 Unclassified 1144
111 Ga0207646_10047949 3300025922 Unclassified 3830
112 Ga0207646_10078597 3300025922 Bacteria 2949
113 Ga0207646_10162257 3300025922 Bacteria 2017
114 Ga0207646_10174373 3300025922 Bacteria 1942
115 Ga0207694_10052033 3300025924 Unclassified 3175
116 Ga0207700_10027654 3300025928 Bacteria 3976
117 Ga0207700_10058981 3300025928 Bacteria 2901
118 Ga0207700_10201846 3300025928 Bacteria 1676
119 Ga0207700_10504066 3300025928 Unclassified 1071
120 Ga0207664_10057154 3300025929 Bacteria 3101
121 Ga0207664_10072526 3300025929 Bacteria 2776
122 Ga0207664_10087732 3300025929 Bacteria 2544
123 Ga0207664_10177947 3300025929 Bacteria 1825
124 Ga0207664_10335804 3300025929 Bacteria 1335
125 Ga0207664_10435500 3300025929 Bacteria 1169
126 Ga0207665_10006544 3300025939 Bacteria 7725
127 Ga0207665_10134270 3300025939 Bacteria 1759
128 Ga0207665_10168245 3300025939 Bacteria 1581
129 Ga0207702_10333648 3300026078 Bacteria 1447
130 Ga0207674_10050358 3300026116 Bacteria 4255
131 Ga0265354_1007483 3300028016 Bacteria 1069
132 Ga0265338_10242841 3300028800 Bacteria 1333
133 Ga0265762_1028773 3300030760 Bacteria 1048
134 Ga0265760_10000637 3300031090 Bacteria 9936
135 Ga0265760_10016616 3300031090 Unclassified 2112
136 Ga0307408_100198822 3300031548 Bacteria 1621
137 Ga0373923_0120107 3300035111 Bacteria 1174
138 Ga0373936_0022468 3300035113 Bacteria 2456
139 Ga0373936_0031870 3300035113 Unclassified 2083
140 Ga0373953_0013645 3300035117 Bacteria 2905
141 Ga0373954_0014578 3300035118 Bacteria 3505
142 Ga0373957_0021057 3300035120 Unclassified 2310
143 Ga0373955_0013964 3300035172 Bacteria 3898
144 Ga0373935_0149643 3300035692 Bacteria 1583
145 Ga0373935_0196344 3300035692 Bacteria 1392
146 Ga0373927_0034990 3300035695 Bacteria 3266
147 Ga0373933_0013231 3300035724 Bacteria 4571
148 Ga0373947_0055632 3300035725 Bacteria 2390
149 Ga0373947_0435524 3300035725 Bacteria 887
150 Ga0373937_0052338 3300036401 Bacteria 3743
151 Ga0373937_0135217 3300036401 Unclassified 2305
152 Ga0373925_0008581 3300037068 Bacteria 7446
153 Ga0373925_0069242 3300037068 Bacteria 2665
154 Ga0373925_0303013 3300037068 Unclassified 1290
155 Ga0395905_0025791 3300037471 Bacteria 5541
156 Ga0395905_0111785 3300037471 Bacteria 2565
157 Ga0395905_0161431 3300037471 Bacteria 2106
158 Ga0395901_0788342 3300038443 Bacteria 940
159 Ga0436362_0390348 3300039453 Unclassified 867
160 Ga0466963_0026424 3300044694 Unclassified 3713
161 Ga0466959_0138013 3300045049 Bacteria 1725
162 Ga0466967_0043870 3300045976 Unclassified 3874
163 Ga0466967_0140102 3300045976 Bacteria 2252
164 Ga0466967_0152850 3300045976 Unclassified 2159
165 Ga0495580_0000223 3300046472 Bacteria 44018
166 Ga0495580_0003168 3300046472 Bacteria 14105
167 Ga0495580_0006171 3300046472 Bacteria 9796
168 Ga0495580_0006379 3300046472 Bacteria 9622
169 Ga0495580_0013154 3300046472 Bacteria 6335
170 Ga0495580_0033795 3300046472 Bacteria 3683
171 Ga0495580_0062568 3300046472 Bacteria 2611
172 Ga0495580_0466726 3300046472 Unclassified 846
173 Ga0495582_0000296 3300046473 Bacteria 27495
174 Ga0495582_0181329 3300046473 Unclassified 1200
175 Ga0495664_0012939 3300046477 Bacteria 4730
176 Ga0495594_0028025 3300046499 Bacteria 3038
177 Ga0495666_0081393 3300046526 Bacteria 1532
178 Ga0495665_0040763 3300046531 Bacteria 2472
179 Ga0495665_0198951 3300046531 Unclassified 1039
180 Ga0495645_0186276 3300046543 Bacteria 1418
181 Ga0495667_0228965 3300046559 Unclassified 1185
182 Ga0495668_0152602 3300046616 Bacteria 1265
183 Ga0495669_0093142 3300046684 Unclassified 1393
184 Ga0495600_0131371 3300046809 Unclassified 1628
185 Ga0495581_0089704 3300047315 Bacteria 1783
186 Ga0495581_0415111 3300047315 Bacteria 785
187 Ga0495604_0078365 3300047317 Unclassified 2480
188 Ga0495674_0102743 3300047319 Bacteria 2431
189 Ga0495680_0341187 3300047322 Unclassified 1045
190 Ga0495675_0037991 3300047444 Bacteria 3066
191 Ga0495602_0045702 3300048088 Bacteria 3961
192 Ga0495602_0151637 3300048088 Bacteria 1821
193 Ga0495602_0167804 3300048088 Bacteria 1707
194 Ga0496107_0166865 3300048910 Bacteria 1633
195 Ga0496112_0009894 3300048915 Bacteria 8621
196 Ga0496112_0066862 3300048915 Bacteria 3547
197 Ga0496112_0096783 3300048915 Bacteria 2922
198 Ga0501298_005177 3300049521 Bacteria 2080
199 Ga0501300_014801 3300049523 Unclassified 1139
200 Ga0501278_005085 3300049774 Unclassified 961
201 nmdc:mga05p37_548889_c1 3300050507 Unclassified 1316
202 nmdc:mga0n895_363_c1 3300050512 Bacteria 30523
203 nmdc:mga0n895_4981_c2 3300050512 Bacteria 8284
204 nmdc:mga0rr50_37616_c1 3300050513 Bacteria 3495
205 nmdc:mga0rr50_523_c1 3300050513 Bacteria 20465
206 nmdc:mga08x19_14330_c1 3300050514 Bacteria 4809
207 nmdc:mga08x19_75072_c1 3300050514 Unclassified 2210
208 nmdc:mga0a205_1317_c2 3300050515 Bacteria 3419
209 Ga0373925_0002751
210 Ga0065715_10014222
211 Ga0070658_10042266
212 Ga0070680_100488867
213 Ga0070682_100341737
214 Ga0070709_10065573
215 Ga0070709_10370965
216 Ga0070714_100024485
217 Ga0070714_100067203
218 Ga0070714_100075180
219 Ga0070714_100172963
220 Ga0070714_100607548
221 Ga0070714_101059863
222 Ga0070713_100025663
223 Ga0070713_100026764
224 Ga0070713_100118270
225 Ga0070713_100206958
226 Ga0070713_100220395
227 Ga0070713_100516217
228 Ga0070710_10041148
229 Ga0070710_10126959
230 Ga0070711_100000654
231 Ga0070711_100213196
232 Ga0070708_100002466
233 Ga0070708_100043246
234 Ga0070708_100125604
235 Ga0070708_100348009
236 Ga0070706_100001446
237 Ga0070706_100048515
238 Ga0070706_100121367
239 Ga0070706_100328040
240 Ga0070707_100042456
241 Ga0070707_100149161
242 Ga0070707_100550056
243 Ga0070698_100161663
244 Ga0070679_100047198
245 Ga0070697_100001537
246 Ga0070697_100601440
247 Ga0068857_100021277
248 Ga0068854_100035494
249 Ga0068854_100151500
250 Ga0068856_100017713
251 Ga0068856_100114876
252 Ga0070717_10004986
253 Ga0070717_10010480
254 Ga0070717_10024674
255 Ga0070717_10027963
256 Ga0070717_10032626
257 Ga0070717_10866519
258 Ga0070715_10001953
259 Ga0070715_10054242
260 Ga0070716_100099767
261 Ga0070712_100000276
262 Ga0070712_100028682
263 Ga0070712_100084501
264 Ga0070712_100229725
265 Ga0070712_100426107
266 Ga0070712_100615846
267 Ga0097621_100068141
268 Ga0068871_100009814
269 Ga0075433_10058876
270 Ga0075434_100000057
271 Ga0075434_100005298
272 Ga0075436_100084203
273 Ga0075436_100185412
274 Ga0075435_100000016
275 Ga0075435_100015714
276 Ga0075435_100043119
277 Ga0105240_10028204
278 Ga0105240_10131452
279 Ga0105240_10280277
280 Ga0114129_10370519
281 Ga0105241_10002840
282 Ga0105237_10006040
283 Ga0105239_10067230
284 Ga0105239_10323623
285 Ga0157373_10014265
286 Ga0157370_10075073
287 Ga0157369_10147208
288 Ga0157374_10104323
289 Ga0157372_10006999
290 Ga0157372_10012564
291 Ga0157372_10027533
292 Ga0157372_10374277
293 Ga0157372_10980214
294 Ga0163163_10080269
295 Ga0157376_10054009
296 Ga0157376_10156164
297 Ga0182006_1008428
298 Ga0182007_10012145
299 Ga0228598_1000005
300 Ga0207692_10255232
301 Ga0207692_10347402
302 Ga0207685_10006933
303 Ga0207699_10042122
304 Ga0207699_10275500
305 Ga0207684_10014840
306 Ga0207684_10047457
307 Ga0207684_10110348
308 Ga0207654_10142132
309 Ga0207707_10258763
310 Ga0207695_10006987
311 Ga0207695_10305007
312 Ga0207693_10000098
313 Ga0207693_10004748
314 Ga0207693_10024901
315 Ga0207693_10498018
316 Ga0207663_10000482
317 Ga0207663_10196905
318 Ga0207660_10374065
319 Ga0207646_10047949
320 Ga0207646_10078597
321 Ga0207646_10162257
322 Ga0207646_10174373
323 Ga0207694_10052033
324 Ga0207700_10027654
325 Ga0207700_10058981
326 Ga0207700_10201846
327 Ga0207700_10504066
328 Ga0207664_10057154
329 Ga0207664_10072526
330 Ga0207664_10087732
331 Ga0207664_10177947
332 Ga0207664_10335804
333 Ga0207664_10435500
334 Ga0207665_10006544
335 Ga0207665_10134270
336 Ga0207665_10168245
337 Ga0207702_10333648
338 Ga0207674_10050358
339 Ga0265354_1007483
340 Ga0265338_10242841
341 Ga0265762_1028773
342 Ga0265760_10000637
343 Ga0265760_10016616
344 Ga0307408_100198822
345 Ga0373923_0120107
346 Ga0373936_0022468
347 Ga0373936_0031870
348 Ga0373953_0013645
349 Ga0373954_0014578
350 Ga0373957_0021057
351 Ga0373955_0013964
352 Ga0373935_0149643
353 Ga0373935_0196344
354 Ga0373927_0034990
355 Ga0373933_0013231
356 Ga0373947_0055632
357 Ga0373947_0435524
358 Ga0373937_0052338
359 Ga0373937_0135217
360 Ga0373925_0008581
361 Ga0373925_0069242
362 Ga0373925_0303013
363 Ga0395905_0025791
364 Ga0395905_0111785
365 Ga0395905_0161431
366 Ga0395901_0788342
367 Ga0436362_0390348
368 Ga0466963_0026424
369 Ga0466959_0138013
370 Ga0466967_0043870
371 Ga0466967_0140102
372 Ga0466967_0152850
373 Ga0495580_0000223
374 Ga0495580_0003168
375 Ga0495580_0006171
376 Ga0495580_0006379
377 Ga0495580_0013154
378 Ga0495580_0033795
379 Ga0495580_0062568
380 Ga0495580_0466726
381 Ga0495582_0000296
382 Ga0495582_0181329
383 Ga0495664_0012939
384 Ga0495594_0028025
385 Ga0495666_0081393
386 Ga0495665_0040763
387 Ga0495665_0198951
388 Ga0495645_0186276
389 Ga0495667_0228965
390 Ga0495668_0152602
391 Ga0495669_0093142
392 Ga0495600_0131371
393 Ga0495581_0089704
394 Ga0495581_0415111
395 Ga0495604_0078365
396 Ga0495674_0102743
397 Ga0495680_0341187
398 Ga0495675_0037991
399 Ga0495602_0045702
400 Ga0495602_0151637
401 Ga0495602_0167804
402 Ga0496107_0166865
403 Ga0496112_0009894
404 Ga0496112_0066862
405 Ga0496112_0096783
406 Ga0501298_005177
407 Ga0501300_014801
408 Ga0501278_005085
409 nmdc:mga05p37_548889_c1
410 nmdc:mga0n895_363_c1
411 nmdc:mga0n895_4981_c2
412 nmdc:mga0rr50_37616_c1
413 nmdc:mga0rr50_523_c1
414 nmdc:mga08x19_14330_c1
415 nmdc:mga08x19_75072_c1
416 nmdc:mga0a205_1317_c2

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

53

235

0.96

PF13242

Hydrolase_like

HAD-hyrolase-like

189

259

0.92

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

50

229

0.84

PF12710

HAD

haloacid dehalogenase-like hydrolase

53

226

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sd7-assembly1.cif.gz_A 1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile 0.8917 13 229
3sd7-assembly1.cif.gz_A 1.7 angstrom resolution crystal structure of putative phosphatase from clostridium difficile 0.8761 13 229
2yy6-assembly2.cif.gz_B crystal structure of the phosphoglycolate phosphatase from aquifex aeolicus vf5 0.8687 13 229
2ah5-assembly1.cif.gz_A hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae 0.8676 12 229
3ib6-assembly1.cif.gz_C crystal structure of an uncharacterized protein from listeria monocytogenes serotype 4b 0.8635 96 201
ID Description Score Start End Superfamily
2yy6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9595 15 226 3.40.50.1000
2fi1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9296 99 197 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9293 99 215 3.40.50.1000
2yy6B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9269 15 226 3.40.50.1000
af_Q8CHP8_227_314_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9157 157 200 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A1Q7F4H3-F1-model_v4 HAD family hydrolase 0.9778 99 229 GO:0005829
GO:0006281
GO:0008967
AF-A0A1Q7F4H3-F1-model_v4 HAD family hydrolase 0.9631 99 229 GO:0005829
GO:0006281
GO:0008967
AF-A0A7X7XF71-F1-model_v4 HAD-IA family hydrolase 0.9328 12 228 GO:0005829
GO:0006281
GO:0008967
AF-A0A4R6VGK1-F1-model_v4 phosphoglycolate phosphatase (EC 3.1.3.18) 0.9295 12 221 GO:0005829
GO:0006281
GO:0008967
AF-A0A1F5JWF5-F1-model_v4 Phosphoglycolate phosphatase 0.9245 13 229 GO:0005829
GO:0006281
GO:0008967

Map