F318061

General Info

Members Datasets Scaffolds Average Seq Length
208 135 206 194

Family's Representative Sequence

Representative Sequence 3300035398|Ga0316574_0130769|Ga0316574_0130769_411_1079
Length 222
Sequence VGAASAAISRIAGSRLKPLPPELENIVMNPLSRENLFSLEKYAEKRPEFRAQVIEHKKHRRVDIGPNLSLYFEDRLTIQYQVQEMLRIERIFEADAIQEELEAYNPLIPNGSNLKCTAMFEFTDVAERRRRLAELASVENHVWLQVDDLEKVYAIANEDLQRSTDEKTSAVHFMRFELNEKMKLALAEGAPLSFGVEHDLYRYAVRLNEPTRQALLGDLTLN

Samples

Sample ID Description Type Environment
1 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
2 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
52 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
53 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
54 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
81 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
82 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
83 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
86 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
95 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
96 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
103 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
129 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
130 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
131 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
132 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
133 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 0.48
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.77
Nodule 0
Rhizoplane 0.48
Rhizosphere 85.1
Stem 0
Stem Tuber 0
Unclassified 8.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001024 3300002705 Bacteria 13049
2 JGI25157J39369_1000969 3300002741 Bacteria 13423
3 rootH1_10170281 3300003323 Bacteria 3619
4 Ga0055527_1004879 3300003760 Bacteria 1798
5 Ga0070676_10013649 3300005328 Bacteria 4454
6 Ga0070676_10169193 3300005328 Bacteria 1412
7 Ga0070690_100017321 3300005330 Bacteria 4331
8 Ga0070670_100015264 3300005331 Bacteria 6592
9 Ga0070670_100083548 3300005331 Bacteria 2744
10 Ga0070670_101053233 3300005331 Unclassified 741
11 Ga0068869_100041452 3300005334 Bacteria 3297
12 Ga0070680_100021465 3300005336 Bacteria 5132
13 Ga0070680_100138978 3300005336 Bacteria 2036
14 Ga0068868_100197656 3300005338 Bacteria 1675
15 Ga0070687_100212602 3300005343 Bacteria 1179
16 Ga0070692_10142265 3300005345 Bacteria 1359
17 Ga0070669_100006683 3300005353 Bacteria 8304
18 Ga0070671_100845813 3300005355 Bacteria 798
19 Ga0070674_100133005 3300005356 Bacteria 1857
20 Ga0070673_100165693 3300005364 Bacteria 1883
21 Ga0070673_101552930 3300005364 Bacteria 625
22 Ga0070714_100538915 3300005435 Bacteria 1116
23 Ga0070681_10000098 3300005458 Bacteria 64926
24 Ga0070681_10001157 3300005458 Bacteria 22777
25 Ga0070679_100001203 3300005530 Bacteria 22777
26 Ga0070684_100037872 3300005535 Bacteria 4140
27 Ga0070672_100077508 3300005543 Bacteria 2658
28 Ga0070686_100015578 3300005544 Bacteria 4407
29 Ga0070686_100183167 3300005544 Bacteria 1490
30 Ga0070695_100009305 3300005545 Bacteria 5842
31 Ga0070696_100240896 3300005546 Bacteria 1364
32 Ga0070665_100075201 3300005548 Bacteria 3385
33 Ga0068855_101264728 3300005563 Bacteria 765
34 Ga0068856_100023827 3300005614 Bacteria 5954
35 Ga0070702_100031822 3300005615 Bacteria 2890
36 Ga0070702_100744999 3300005615 Bacteria 752
37 Ga0068852_101519634 3300005616 Bacteria 692
38 Ga0068861_100174075 3300005719 Bacteria 1786
39 Ga0068870_10052502 3300005840 Bacteria 2162
40 Ga0068858_100306963 3300005842 Bacteria 1515
41 Ga0068862_100846625 3300005844 Unclassified 896
42 Ga0075363_100007791 3300006048 Bacteria 4948
43 Ga0075366_10022369 3300006195 Bacteria 3677
44 Ga0075366_10065468 3300006195 Bacteria 2162
45 Ga0097621_100001156 3300006237 Bacteria 18340
46 Ga0068871_100001427 3300006358 Bacteria 16004
47 Ga0075430_100029744 3300006846 Bacteria 4637
48 Ga0068865_100416327 3300006881 Bacteria 1104
49 Ga0105240_10417802 3300009093 Bacteria 1507
50 Ga0111539_10816039 3300009094 Bacteria 1085
51 Ga0105242_10182506 3300009176 Bacteria 1852
52 Ga0105248_10329618 3300009177 Bacteria 1719
53 Ga0105248_11913313 3300009177 Bacteria 673
54 Ga0105239_11545985 3300010375 Bacteria 767
55 Ga0157374_10488736 3300013296 Bacteria 1234
56 Ga0163162_10000007 3300013306 Bacteria 368084
57 Ga0157379_10119613 3300014968 Bacteria 2369
58 Ga0157376_10050493 3300014969 Bacteria 3451
59 Ga0209646_1001002 3300025246 Bacteria 8669
60 Ga0209026_1000768 3300025250 Bacteria 17976
61 Ga0209759_1000687 3300025256 Bacteria 30489
62 Ga0207645_10008579 3300025907 Bacteria 7120
63 Ga0207643_10143094 3300025908 Bacteria 1429
64 Ga0207707_10000460 3300025912 Bacteria 42178
65 Ga0207707_10000867 3300025912 Bacteria 29561
66 Ga0207660_10003500 3300025917 Bacteria 10227
67 Ga0207662_10030871 3300025918 Bacteria 3113
68 Ga0207652_10001602 3300025921 Bacteria 19926
69 Ga0207681_10358651 3300025923 Bacteria 1169
70 Ga0207694_10324316 3300025924 Bacteria 1271
71 Ga0207650_10008389 3300025925 Bacteria 7052
72 Ga0207650_10620182 3300025925 Unclassified 910
73 Ga0207659_10677784 3300025926 Bacteria 882
74 Ga0207664_10790504 3300025929 Unclassified 854
75 Ga0207690_10066984 3300025932 Bacteria 2462
76 Ga0207691_10015284 3300025940 Bacteria 7302
77 Ga0207711_10280634 3300025941 Bacteria 1534
78 Ga0207689_10049837 3300025942 Bacteria 3454
79 Ga0207661_10053356 3300025944 Bacteria 3235
80 Ga0207677_10037912 3300026023 Bacteria 3154
81 Ga0207703_10215720 3300026035 Bacteria 1713
82 Ga0207698_10611122 3300026142 Bacteria 1076
83 Ga0210000_1007826 3300027462 Bacteria 1564
84 Ga0210000_1030975 3300027462 Bacteria 837
85 Ga0209999_1001699 3300027543 Bacteria 3808
86 Ga0209971_1035721 3300027682 Bacteria 1195
87 Ga0209813_10000745 3300027866 Bacteria 7423
88 Ga0265332_10134024 3300031238 Bacteria 1039
89 Ga0265339_10262556 3300031249 Bacteria 832
90 Ga0265316_10713773 3300031344 Bacteria 706
91 Ga0307508_10060556 3300031616 Bacteria 3347
92 Ga0316576_10001256 3300031727 Bacteria 13435
93 Ga0316576_10011524 3300031727 Bacteria 5798
94 Ga0316576_10085555 3300031727 Bacteria 2344
95 Ga0316576_10096766 3300031727 Bacteria 2203
96 Ga0316576_10133951 3300031727 Bacteria 1865
97 Ga0316576_10322296 3300031727 Bacteria 1152
98 Ga0316576_10324470 3300031727 Bacteria 1148
99 Ga0316576_10565240 3300031727 Bacteria 832
100 Ga0316576_10583986 3300031727 Bacteria 816
101 Ga0316576_10876860 3300031727 Bacteria 643
102 Ga0316578_10009603 3300031728 Bacteria 4978
103 Ga0316578_10444423 3300031728 Bacteria 766
104 Ga0316578_10451887 3300031728 Bacteria 759
105 Ga0316577_10104426 3300031733 Bacteria 1589
106 Ga0316577_10289989 3300031733 Bacteria 927
107 Ga0316577_10291409 3300031733 Bacteria 924
108 Ga0307411_10014445 3300032005 Bacteria 4393
109 Ga0316580_10040190 3300032139 Bacteria 1445
110 Ga0316596_1005063 3300033541 Bacteria 2993
111 Ga0373953_0026532 3300035117 Bacteria 2220
112 Ga0373961_0089499 3300035241 Bacteria 981
113 Ga0316574_0015861 3300035398 Bacteria 4378
114 Ga0316574_0076123 3300035398 Bacteria 2125
115 Ga0316574_0102724 3300035398 Bacteria 1830
116 Ga0316574_0121287 3300035398 Bacteria 1679
117 Ga0316574_0130769 3300035398 Bacteria 1615
118 Ga0316574_0185126 3300035398 Bacteria 1339
119 Ga0316574_0207771 3300035398 Bacteria 1257
120 Ga0316574_0229993 3300035398 Bacteria 1187
121 Ga0316574_0341542 3300035398 Bacteria 948
122 Ga0373933_0680965 3300035724 Bacteria 676
123 Ga0373937_0039857 3300036401 Bacteria 4281
124 Ga0373937_0045095 3300036401 Bacteria 4028
125 Ga0373937_0473063 3300036401 Bacteria 1190
126 Ga0373937_1218848 3300036401 Bacteria 701
127 Ga0316582_0016076 3300036647 Bacteria 4296
128 Ga0316582_0679204 3300036647 Bacteria 708
129 Ga0316584_0023174 3300036712 Bacteria 4536
130 Ga0316584_0052110 3300036712 Bacteria 3061
131 Ga0316584_0085453 3300036712 Bacteria 2362
132 Ga0316584_0184177 3300036712 Bacteria 1545
133 Ga0395905_0000004 3300037471 Bacteria 674991
134 Ga0395905_0202789 3300037471 Bacteria 1859
135 Ga0400483_025148 3300039062 Bacteria 1519
136 Ga0400483_046831 3300039062 Bacteria 362835
137 Ga0400483_219719 3300039062 Bacteria 1231
138 Ga0400487_10280 3300039110 Bacteria 138613
139 Ga0400487_10768 3300039110 Bacteria 2768
140 Ga0436365_0980350 3300039437 Bacteria 8472
141 Ga0439432_143557 3300042006 Bacteria 702
142 Ga0451577_0212283 3300042876 Bacteria 1748
143 Ga0453684_0011025 3300044712 Bacteria 15269
144 Ga0451576_0000140 3300045051 Bacteria 183279
145 Ga0495658_0423846 3300046683 Bacteria 849
146 Ga0495672_0005139 3300047320 Bacteria 10444
147 Ga0496106_0000182 3300048909 Bacteria 45120
148 Ga0496121_0008072 3300048924 Bacteria 12537
149 Ga0496124_0073680 3300048927 Bacteria 2825
150 Ga0496124_0292901 3300048927 Bacteria 1180
151 Ga0501032_0000288 3300049569 Bacteria 42376
152 Ga0501032_0029161 3300049569 Bacteria 3789
153 Ga0501033_0002955 3300049570 Bacteria 14215
154 Ga0501033_0004498 3300049570 Bacteria 11157
155 Ga0501033_0004675 3300049570 Bacteria 10955
156 Ga0501034_0000477 3300049571 Bacteria 65874
157 Ga0501034_0005217 3300049571 Bacteria 14255
158 Ga0501034_0106714 3300049571 Bacteria 2793
159 Ga0501036_0024758 3300049572 Bacteria 5061
160 Ga0501036_0053196 3300049572 Bacteria 3429
161 Ga0501036_0394706 3300049572 Bacteria 1154
162 Ga0501037_0005331 3300049573 Bacteria 9353
163 Ga0501037_0170713 3300049573 Bacteria 1546
164 Ga0501037_0335370 3300049573 Bacteria 1045
165 Ga0501038_0032761 3300049574 Bacteria 4581
166 Ga0501038_0095870 3300049574 Bacteria 2477
167 Ga0501039_0009369 3300049575 Bacteria 7463
168 Ga0501039_0027390 3300049575 Bacteria 4382
169 Ga0501039_0295576 3300049575 Bacteria 1273
170 Ga0501039_0770750 3300049575 Bacteria 751
171 Ga0501040_0012345 3300049576 Bacteria 5596
172 Ga0501040_0408235 3300049576 Bacteria 976
173 Ga0501041_0874707 3300049577 Bacteria 577
174 Ga0501042_0044370 3300049578 Bacteria 3167
175 Ga0501042_0265181 3300049578 Bacteria 1240
176 Ga0501043_0135557 3300049579 Bacteria 1928
177 Ga0501043_0839957 3300049579 Bacteria 662
178 Ga0501046_0054702 3300049580 Bacteria 3138
179 Ga0501046_0151774 3300049580 Bacteria 1748
180 Ga0501046_0176835 3300049580 Bacteria 1598
181 Ga0501047_0029045 3300049581 Bacteria 5333
182 Ga0501048_0010861 3300049582 Bacteria 6789
183 Ga0501048_0669895 3300049582 Bacteria 745
184 Ga0501068_0004449 3300049584 Bacteria 7628
185 Ga0501071_0069595 3300049587 Bacteria 2563
186 Ga0501072_0023770 3300049588 Bacteria 4760
187 Ga0501080_0057014 3300049742 Bacteria 3638
188 Ga0501080_0176644 3300049742 Bacteria 1967
189 Ga0501035_0000827 3300049822 Bacteria 33027
190 Ga0501035_0133634 3300049822 Bacteria 2161
191 Ga0501044_0014554 3300049823 Bacteria 8487
192 Ga0501044_0027532 3300049823 Bacteria 6006
193 Ga0501044_0126661 3300049823 Bacteria 2551
194 Ga0501044_0512744 3300049823 Unclassified 1099
195 Ga0501045_0000189 3300049824 Bacteria 34544
196 Ga0501045_0411456 3300049824 Unclassified 1006
197 nmdc:mga03n38_32062_c1 3300050490 Bacteria 2223
198 nmdc:mga00v17_611671_c1 3300050491 Bacteria 702
199 nmdc:mga00v17_8034_c1 3300050491 Bacteria 5663
200 nmdc:mga0yw44_35007_c1 3300050492 Bacteria 2948
201 nmdc:mga0k408_14565_c1 3300050493 Bacteria 4336
202 nmdc:mga06z11_30189_c1 3300050494 Bacteria 2621
203 nmdc:mga04h51_691_c1 3300050495 Bacteria 7860
204 nmdc:mga08y16_1053813_c1 3300050511 Unclassified 790
205 Ga0495619_0374648 3300053085 Bacteria 984
206 Ga0495619_0501207 3300053085 Bacteria 835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049577 Ga0501041_0874707 Ga0501041_0874707_74_559 160
2 3300042006 Ga0439432_143557 Ga0439432_143557_54_575 167
3 3300049573 Ga0501037_0335370 Ga0501037_0335370_47_553 167
4 3300049575 Ga0501039_0770750 Ga0501039_0770750_25_546 167
5 3300049823 Ga0501044_0512744 Ga0501044_0512744_252_773 167
6 3300036401 Ga0373937_0473063 Ga0373937_0473063_35_547 168
7 3300036401 Ga0373937_1218848 Ga0373937_1218848_101_610 168
8 3300025923 Ga0207681_10358651 Ga0207681_103586512 169
9 iso_pu_bacteria 2791355137 2792837282 188
10 iso_pu_bacteria 2904615490 2904615729 188
11 3300005544 Ga0070686_100183167 Ga0070686_1001831672 190
12 3300005615 Ga0070702_100031822 Ga0070702_1000318223 190
13 3300005330 Ga0070690_100017321 Ga0070690_1000173213 191
14 3300005336 Ga0070680_100138978 Ga0070680_1001389784 191
15 3300005343 Ga0070687_100212602 Ga0070687_1002126022 191
16 3300005345 Ga0070692_10142265 Ga0070692_101422652 191
17 3300005435 Ga0070714_100538915 Ga0070714_1005389152 191
18 3300005535 Ga0070684_100037872 Ga0070684_1000378723 191
19 3300005544 Ga0070686_100015578 Ga0070686_1000155785 191
20 3300005615 Ga0070702_100744999 Ga0070702_1007449992 191
21 3300005616 Ga0068852_101519634 Ga0068852_1015196341 191
22 3300005842 Ga0068858_100306963 Ga0068858_1003069632 191
23 3300006237 Ga0097621_100001156 Ga0097621_10000115612 191
24 3300006358 Ga0068871_100001427 Ga0068871_1000014275 191
25 3300009177 Ga0105248_10329618 Ga0105248_103296182 191
26 3300013296 Ga0157374_10488736 Ga0157374_104887362 191
27 3300014968 Ga0157379_10119613 Ga0157379_101196132 191
28 3300014969 Ga0157376_10050493 Ga0157376_100504933 191
29 3300025918 Ga0207662_10030871 Ga0207662_100308714 191
30 3300025929 Ga0207664_10790504 Ga0207664_107905042 191
31 3300025941 Ga0207711_10280634 Ga0207711_102806343 191
32 3300025944 Ga0207661_10053356 Ga0207661_100533564 191
33 3300026035 Ga0207703_10215720 Ga0207703_102157202 191
34 3300026142 Ga0207698_10611122 Ga0207698_106111222 191
35 3300027462 Ga0210000_1007826 Ga0210000_10078262 191
36 3300027543 Ga0209999_1001699 Ga0209999_10016994 191
37 3300027682 Ga0209971_1035721 Ga0209971_10357212 191
38 3300031249 Ga0265339_10262556 Ga0265339_102625561 191
39 3300031344 Ga0265316_10713773 Ga0265316_107137731 191
40 3300035241 Ga0373961_0089499 Ga0373961_0089499_116_691 191
41 3300049569 Ga0501032_0000288 Ga0501032_0000288_35791_36384 191
42 3300049569 Ga0501032_0029161 Ga0501032_0029161_1249_1842 191
43 3300049570 Ga0501033_0002955 Ga0501033_0002955_120_698 191
44 3300049570 Ga0501033_0004498 Ga0501033_0004498_3005_3598 191
45 3300049570 Ga0501033_0004675 Ga0501033_0004675_3654_4247 191
46 3300049571 Ga0501034_0005217 Ga0501034_0005217_6644_7237 191
47 3300049572 Ga0501036_0024758 Ga0501036_0024758_1119_1712 191
48 3300049572 Ga0501036_0053196 Ga0501036_0053196_1220_1813 191
49 3300049573 Ga0501037_0005331 Ga0501037_0005331_5086_5679 191
50 3300049574 Ga0501038_0032761 Ga0501038_0032761_2543_3136 191
51 3300049574 Ga0501038_0095870 Ga0501038_0095870_332_925 191
52 3300049575 Ga0501039_0009369 Ga0501039_0009369_1785_2378 191
53 3300049575 Ga0501039_0027390 Ga0501039_0027390_2364_2957 191
54 3300049576 Ga0501040_0012345 Ga0501040_0012345_152_745 191
55 3300049578 Ga0501042_0044370 Ga0501042_0044370_2423_3016 191
56 3300049579 Ga0501043_0135557 Ga0501043_0135557_284_877 191
57 3300049579 Ga0501043_0839957 Ga0501043_0839957_63_641 191
58 3300049580 Ga0501046_0054702 Ga0501046_0054702_1738_2331 191
59 3300049580 Ga0501046_0176835 Ga0501046_0176835_90_668 191
60 3300049581 Ga0501047_0029045 Ga0501047_0029045_1169_1762 191
61 3300049582 Ga0501048_0010861 Ga0501048_0010861_1913_2506 191
62 3300049584 Ga0501068_0004449 Ga0501068_0004449_2618_3211 191
63 3300049742 Ga0501080_0176644 Ga0501080_0176644_1009_1602 191
64 3300049822 Ga0501035_0000827 Ga0501035_0000827_1555_2148 191
65 3300049822 Ga0501035_0133634 Ga0501035_0133634_1417_2010 191
66 3300049823 Ga0501044_0014554 Ga0501044_0014554_1251_1829 191
67 3300049823 Ga0501044_0027532 Ga0501044_0027532_1738_2331 191
68 3300049824 Ga0501045_0000189 Ga0501045_0000189_21765_22358 191
69 3300049824 Ga0501045_0411456 Ga0501045_0411456_114_707 191
70 3300003323 rootH1_10170281 rootH1_101702812 192
71 3300009177 Ga0105248_11913313 Ga0105248_119133131 192
72 3300037471 Ga0395905_0000004 Ga0395905_0000004_195460_196041 192
73 3300037471 Ga0395905_0202789 Ga0395905_0202789_77_658 192
74 3300039062 Ga0400483_025148 Ga0400483_025148_439_1020 192
75 3300039062 Ga0400483_219719 Ga0400483_219719_250_831 192
76 3300047320 Ga0495672_0005139 Ga0495672_0005139_5277_5858 192
77 3300048909 Ga0496106_0000182 Ga0496106_0000182_34488_35069 192
78 3300048924 Ga0496121_0008072 Ga0496121_0008072_10044_10625 192
79 3300048927 Ga0496124_0073680 Ga0496124_0073680_1544_2125 192
80 3300048927 Ga0496124_0292901 Ga0496124_0292901_45_626 192
81 3300002705 JGI25156J39149_1001024 JGI25156J39149_10010244 193
82 3300002741 JGI25157J39369_1000969 JGI25157J39369_10009695 193
83 3300003760 Ga0055527_1004879 Ga0055527_10048792 193
84 3300005328 Ga0070676_10013649 Ga0070676_100136496 193
85 3300005328 Ga0070676_10169193 Ga0070676_101691933 193
86 3300005331 Ga0070670_100015264 Ga0070670_1000152647 193
87 3300005331 Ga0070670_100083548 Ga0070670_1000835483 193
88 3300005331 Ga0070670_101053233 Ga0070670_1010532331 193
89 3300005334 Ga0068869_100041452 Ga0068869_1000414522 193
90 3300005336 Ga0070680_100021465 Ga0070680_1000214655 193
91 3300005338 Ga0068868_100197656 Ga0068868_1001976561 193
92 3300005353 Ga0070669_100006683 Ga0070669_1000066833 193
93 3300005355 Ga0070671_100845813 Ga0070671_1008458131 193
94 3300005356 Ga0070674_100133005 Ga0070674_1001330052 193
95 3300005364 Ga0070673_100165693 Ga0070673_1001656932 193
96 3300005364 Ga0070673_101552930 Ga0070673_1015529301 193
97 3300005458 Ga0070681_10000098 Ga0070681_1000009838 193
98 3300005458 Ga0070681_10001157 Ga0070681_1000115724 193
99 3300005530 Ga0070679_100001203 Ga0070679_10000120324 193
100 3300005543 Ga0070672_100077508 Ga0070672_1000775082 193
101 3300005545 Ga0070695_100009305 Ga0070695_1000093055 193
102 3300005546 Ga0070696_100240896 Ga0070696_1002408963 193
103 3300005548 Ga0070665_100075201 Ga0070665_1000752012 193
104 3300005563 Ga0068855_101264728 Ga0068855_1012647281 193
105 3300005614 Ga0068856_100023827 Ga0068856_1000238277 193
106 3300005719 Ga0068861_100174075 Ga0068861_1001740752 193
107 3300005840 Ga0068870_10052502 Ga0068870_100525023 193
108 3300005844 Ga0068862_100846625 Ga0068862_1008466252 193
109 3300006048 Ga0075363_100007791 Ga0075363_1000077912 193
110 3300006195 Ga0075366_10022369 Ga0075366_100223692 193
111 3300006195 Ga0075366_10065468 Ga0075366_100654682 193
112 3300006846 Ga0075430_100029744 Ga0075430_1000297443 193
113 3300006881 Ga0068865_100416327 Ga0068865_1004163271 193
114 3300009093 Ga0105240_10417802 Ga0105240_104178022 193
115 3300009094 Ga0111539_10816039 Ga0111539_108160391 193
116 3300009176 Ga0105242_10182506 Ga0105242_101825062 193
117 3300010375 Ga0105239_11545985 Ga0105239_115459852 193
118 3300013306 Ga0163162_10000007 Ga0163162_10000007203 193
119 3300025246 Ga0209646_1001002 Ga0209646_10010026 193
120 3300025250 Ga0209026_1000768 Ga0209026_10007688 193
121 3300025256 Ga0209759_1000687 Ga0209759_100068715 193
122 3300025907 Ga0207645_10008579 Ga0207645_100085793 193
123 3300025908 Ga0207643_10143094 Ga0207643_101430942 193
124 3300025912 Ga0207707_10000460 Ga0207707_1000046014 193
125 3300025912 Ga0207707_10000867 Ga0207707_1000086731 193
126 3300025917 Ga0207660_10003500 Ga0207660_100035004 193
127 3300025921 Ga0207652_10001602 Ga0207652_100016025 193
128 3300025924 Ga0207694_10324316 Ga0207694_103243162 193
129 3300025925 Ga0207650_10008389 Ga0207650_100083897 193
130 3300025925 Ga0207650_10620182 Ga0207650_106201821 193
131 3300025926 Ga0207659_10677784 Ga0207659_106777841 193
132 3300025932 Ga0207690_10066984 Ga0207690_100669842 193
133 3300025940 Ga0207691_10015284 Ga0207691_100152847 193
134 3300025942 Ga0207689_10049837 Ga0207689_100498372 193
135 3300026023 Ga0207677_10037912 Ga0207677_100379124 193
136 3300027462 Ga0210000_1030975 Ga0210000_10309751 193
137 3300027866 Ga0209813_10000745 Ga0209813_100007454 193
138 3300031238 Ga0265332_10134024 Ga0265332_101340242 193
139 3300031616 Ga0307508_10060556 Ga0307508_100605562 193
140 3300031727 Ga0316576_10001256 Ga0316576_100012569 193
141 3300031727 Ga0316576_10011524 Ga0316576_100115243 193
142 3300031727 Ga0316576_10085555 Ga0316576_100855551 193
143 3300031727 Ga0316576_10096766 Ga0316576_100967662 193
144 3300031727 Ga0316576_10133951 Ga0316576_101339512 193
145 3300031727 Ga0316576_10322296 Ga0316576_103222961 193
146 3300031727 Ga0316576_10324470 Ga0316576_103244702 193
147 3300031727 Ga0316576_10565240 Ga0316576_105652402 193
148 3300031727 Ga0316576_10583986 Ga0316576_105839861 193
149 3300031727 Ga0316576_10876860 Ga0316576_108768601 193
150 3300031728 Ga0316578_10009603 Ga0316578_100096033 193
151 3300031728 Ga0316578_10444423 Ga0316578_104444231 193
152 3300031728 Ga0316578_10451887 Ga0316578_104518872 193
153 3300031733 Ga0316577_10104426 Ga0316577_101044262 193
154 3300031733 Ga0316577_10289989 Ga0316577_102899892 193
155 3300031733 Ga0316577_10291409 Ga0316577_102914091 193
156 3300032005 Ga0307411_10014445 Ga0307411_100144452 193
157 3300032139 Ga0316580_10040190 Ga0316580_100401902 193
158 3300033541 Ga0316596_1005063 Ga0316596_10050632 193
159 3300035117 Ga0373953_0026532 Ga0373953_0026532_1615_2202 193
160 3300035398 Ga0316574_0015861 Ga0316574_0015861_3322_3921 193
161 3300035398 Ga0316574_0076123 Ga0316574_0076123_1035_1631 193
162 3300035398 Ga0316574_0102724 Ga0316574_0102724_1101_1700 193
163 3300035398 Ga0316574_0121287 Ga0316574_0121287_932_1531 193
164 3300035398 Ga0316574_0130769 Ga0316574_0130769_411_1079 193
165 3300035398 Ga0316574_0185126 Ga0316574_0185126_226_813 193
166 3300035398 Ga0316574_0207771 Ga0316574_0207771_522_1124 193
167 3300035398 Ga0316574_0229993 Ga0316574_0229993_42_632 193
168 3300035398 Ga0316574_0341542 Ga0316574_0341542_325_912 193
169 3300035724 Ga0373933_0680965 Ga0373933_0680965_57_641 193
170 3300036401 Ga0373937_0039857 Ga0373937_0039857_1162_1749 193
171 3300036401 Ga0373937_0045095 Ga0373937_0045095_109_693 193
172 3300036647 Ga0316582_0016076 Ga0316582_0016076_2977_3573 193
173 3300036647 Ga0316582_0679204 Ga0316582_0679204_46_645 193
174 3300036712 Ga0316584_0023174 Ga0316584_0023174_1646_2245 193
175 3300036712 Ga0316584_0052110 Ga0316584_0052110_642_1226 193
176 3300036712 Ga0316584_0085453 Ga0316584_0085453_632_1228 193
177 3300036712 Ga0316584_0184177 Ga0316584_0184177_403_1002 193
178 3300039062 Ga0400483_046831 Ga0400483_046831_318233_318817 193
179 3300039110 Ga0400487_10280 Ga0400487_10280_17691_18275 193
180 3300039110 Ga0400487_10768 Ga0400487_10768_1756_2352 193
181 3300039437 Ga0436365_0980350 Ga0436365_0980350_5522_6106 193
182 3300042876 Ga0451577_0212283 Ga0451577_0212283_297_890 193
183 3300044712 Ga0453684_0011025 Ga0453684_0011025_11625_12206 193
184 3300045051 Ga0451576_0000140 Ga0451576_0000140_67373_67966 193
185 3300046683 Ga0495658_0423846 Ga0495658_0423846_226_813 193
186 3300049571 Ga0501034_0000477 Ga0501034_0000477_25238_25825 193
187 3300049571 Ga0501034_0106714 Ga0501034_0106714_607_1206 193
188 3300049572 Ga0501036_0394706 Ga0501036_0394706_110_691 193
189 3300049573 Ga0501037_0170713 Ga0501037_0170713_651_1250 193
190 3300049575 Ga0501039_0295576 Ga0501039_0295576_520_1104 193
191 3300049576 Ga0501040_0408235 Ga0501040_0408235_231_812 193
192 3300049578 Ga0501042_0265181 Ga0501042_0265181_32_613 193
193 3300049580 Ga0501046_0151774 Ga0501046_0151774_1100_1681 193
194 3300049582 Ga0501048_0669895 Ga0501048_0669895_105_686 193
195 3300049587 Ga0501071_0069595 Ga0501071_0069595_720_1301 193
196 3300049588 Ga0501072_0023770 Ga0501072_0023770_522_1109 193
197 3300049742 Ga0501080_0057014 Ga0501080_0057014_2842_3429 193
198 3300049823 Ga0501044_0126661 Ga0501044_0126661_263_862 193
199 3300050490 nmdc:mga03n38_32062_c1 nmdc:mga03n38_32062_c1_407_991 193
200 3300050491 nmdc:mga00v17_611671_c1 nmdc:mga00v17_611671_c1_62_643 193
201 3300050491 nmdc:mga00v17_8034_c1 nmdc:mga00v17_8034_c1_28_612 193
202 3300050492 nmdc:mga0yw44_35007_c1 nmdc:mga0yw44_35007_c1_1804_2388 193
203 3300050493 nmdc:mga0k408_14565_c1 nmdc:mga0k408_14565_c1_687_1268 193
204 3300050494 nmdc:mga06z11_30189_c1 nmdc:mga06z11_30189_c1_390_974 193
205 3300050495 nmdc:mga04h51_691_c1 nmdc:mga04h51_691_c1_4236_4820 193
206 3300050511 nmdc:mga08y16_1053813_c1 nmdc:mga08y16_1053813_c1_89_673 193
207 3300053085 Ga0495619_0374648 Ga0495619_0374648_58_642 193
208 3300053085 Ga0495619_0501207 Ga0495619_0501207_29_613 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12007

DUF3501

Protein of unknown function (DUF3501)

30

219

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fjv-assembly1.cif.gz_B crystal structure of novel protein of unknown function (yp_111841.1) from burkholderia pseudomallei k96243 at 1.90 a resolution 0.9638 4 193
3fjv-assembly1.cif.gz_A crystal structure of novel protein of unknown function (yp_111841.1) from burkholderia pseudomallei k96243 at 1.90 a resolution 0.9594 2 193
3fjv-assembly1.cif.gz_B crystal structure of novel protein of unknown function (yp_111841.1) from burkholderia pseudomallei k96243 at 1.90 a resolution 0.9585 4 193
1hk3-assembly1.cif.gz_A human serum albumin mutant r218p complexed with thyroxine (3,3',5,5'-tetraiodo-l-thyronine) 0.6382 48 80
3r18-assembly1.cif.gz_A-2 chicken sulfite oxidase double mutant with altered activity and substrate affinity 0.5495 86 173
ID Description Score Start End Superfamily
4c7oD01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);SRP54, nucleotide-binding domain 0.9032 51 77 1.20.120.140
af_Q54EH0_362_1038_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5827 84 180 2.60.40.10
af_Q54PQ2_379_486_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5769 82 179 2.60.40.10
af_Q54EL6_361_844_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5676 83 180 2.60.40.10
af_Q1ZXI8_465_564_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.5614 83 151 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A2E2YS89-F1-model_v4 DUF3501 domain-containing protein 1.003 1 87
AF-X1UWD2-F1-model_v4 DUF3501 domain-containing protein 1 1 114
AF-T1DCE4-F1-model_v4 DUF3501 family protein 1 1 111
AF-A0A661FQD5-F1-model_v4 DUF3501 family protein 0.9993 2 105
AF-A0A3D0GK13-F1-model_v4 DUF3501 domain-containing protein 0.9988 2 100

Feature Viewer

pLDDT pTM Quality
92.63 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map