F317999

General Info

Members Datasets Scaffolds Average Seq Length
208 138 416 342

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10001416|Ga0265327_1000141622
Length 338
Sequence MNTNTQLTDWRELALQFERQINQTVIGLQPPVRNIVLAVFARGHVLLEGNVGVGKTTLLRAVAQGLGGDYQRIEGTIDLMPADLIYYTYLNDQGRPCVDPGPLLKHGDTLATFFFNEINRARPQVHALLLRAMAERSINAFNRDYALPHIQVFADRNRVEKEETFELPAAAKDRFMMEIHIDMPDADTVLDELMFNPRFHDTDRLIGDITGSGVYYRLNELAQTVQQQIQTSPKLHAYALSLWKATHRPQQYGVQLTDVEMPHLLMAGASPRAMSYLIRAAKTRAWLENRDHVLPEDLQAVFPVCMTHRLFLNPMYAYRKEQLLPELITGILNQVAAP

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
23 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
70 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
77 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
78 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
79 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
80 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
81 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
82 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
83 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
84 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
98 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
99 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
107 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
108 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
112 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
113 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
114 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
115 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
116 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
117 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
118 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
119 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
120 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
121 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
122 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
123 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
124 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
125 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
126 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
127 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
128 2902330777 Methylobacterium sp. 2A Isolate Unclassified
129 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
130 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
131 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
132 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
133 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
134 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
135 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
136 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
137 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
138 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.38
Metatranscriptomes 0
Isolates 9.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.81
Nodule 0.48
Rhizoplane 1.92
Rhizosphere 83.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10001416 3300031251 Bacteria 30536
2 Ga0070658_10237336 3300005327 Bacteria 1545
3 Ga0070670_100085775 3300005331 Bacteria 2706
4 Ga0070668_100026681 3300005347 Bacteria 4384
5 Ga0070668_100286717 3300005347 Bacteria 1377
6 Ga0070673_100065117 3300005364 Bacteria 2906
7 Ga0070667_100035273 3300005367 Bacteria 4189
8 Ga0070667_100110179 3300005367 Bacteria 2386
9 Ga0070667_100248618 3300005367 Bacteria 1589
10 Ga0070667_100263189 3300005367 Bacteria 1545
11 Ga0070710_10187470 3300005437 Bacteria 1299
12 Ga0070711_100017765 3300005439 Bacteria 4532
13 Ga0070663_100010910 3300005455 Bacteria 5677
14 Ga0068867_100055664 3300005459 Bacteria 2925
15 Ga0068867_100069729 3300005459 Bacteria 2626
16 Ga0068853_100075344 3300005539 Bacteria 2945
17 Ga0068853_100093567 3300005539 Bacteria 2646
18 Ga0070665_100000095 3300005548 Bacteria 170459
19 Ga0070665_100040343 3300005548 Bacteria 4692
20 Ga0070665_100173875 3300005548 Bacteria 2154
21 Ga0068855_100095641 3300005563 Bacteria 3423
22 Ga0070664_100313438 3300005564 Bacteria 1420
23 Ga0068856_100205985 3300005614 Bacteria 1981
24 Ga0068856_100540354 3300005614 Bacteria 1187
25 Ga0068852_100193750 3300005616 Bacteria 1919
26 Ga0068859_100008478 3300005617 Bacteria 10400
27 Ga0068861_100067347 3300005719 Bacteria 2763
28 Ga0068863_100064589 3300005841 Bacteria 3461
29 Ga0068863_100104585 3300005841 Bacteria 2693
30 Ga0068860_100016174 3300005843 Bacteria 7279
31 Ga0068860_100028593 3300005843 Bacteria 5367
32 Ga0068860_100124963 3300005843 Bacteria 2466
33 Ga0068862_100001213 3300005844 Bacteria 24320
34 Ga0068862_100057073 3300005844 Bacteria 3347
35 Ga0081540_1006271 3300005983 Bacteria 8703
36 Ga0075364_10118917 3300006051 Bacteria 1768
37 Ga0070712_100042526 3300006175 Bacteria 3125
38 Ga0075366_10081913 3300006195 Bacteria 1928
39 Ga0097621_100042872 3300006237 Bacteria 3646
40 Ga0068871_100030585 3300006358 Bacteria 4241
41 Ga0068871_100045763 3300006358 Bacteria 3523
42 Ga0068871_100093349 3300006358 Bacteria 2511
43 Ga0068865_100002160 3300006881 Bacteria 11583
44 Ga0068865_100007784 3300006881 Bacteria 6606
45 Ga0068865_100106036 3300006881 Bacteria 2065
46 Ga0097620_100008478 3300006931 Bacteria 10400
47 Ga0097620_100281247 3300006931 Bacteria 1756
48 Ga0105240_10012346 3300009093 Bacteria 11795
49 Ga0105247_10084539 3300009101 Bacteria 2005
50 Ga0105242_10001298 3300009176 Bacteria 19754
51 Ga0105248_10108198 3300009177 Bacteria 3135
52 Ga0105237_10039830 3300009545 Bacteria 4741
53 Ga0105237_10091096 3300009545 Bacteria 3039
54 Ga0105238_10017409 3300009551 Bacteria 7302
55 Ga0105238_10160496 3300009551 Bacteria 2224
56 Ga0105239_10052001 3300010375 Bacteria 4491
57 Ga0157369_10000027 3300013105 Bacteria 213988
58 Ga0157369_10375953 3300013105 Bacteria 1475
59 Ga0163162_10002734 3300013306 Bacteria 16743
60 Ga0163162_10003864 3300013306 Bacteria 14373
61 Ga0163162_10162739 3300013306 Bacteria 2354
62 Ga0157372_10033516 3300013307 Bacteria 5642
63 Ga0157372_10345746 3300013307 Bacteria 1733
64 Ga0157375_10000102 3300013308 Bacteria 86408
65 Ga0157375_10012961 3300013308 Bacteria 7405
66 Ga0163163_10105923 3300014325 Bacteria 2837
67 Ga0157379_10101693 3300014968 Bacteria 2579
68 Ga0157376_10002211 3300014969 Bacteria 13118
69 Ga0157376_10393397 3300014969 Bacteria 1338
70 Ga0207656_10027895 3300025321 Bacteria 2313
71 Ga0207680_10026439 3300025903 Bacteria 3218
72 Ga0207695_10006463 3300025913 Bacteria 15214
73 Ga0207671_10003811 3300025914 Bacteria 14763
74 Ga0207694_10000563 3300025924 Bacteria 33592
75 Ga0207706_10094493 3300025933 Bacteria 2630
76 Ga0207686_10004251 3300025934 Bacteria 7676
77 Ga0207709_10015519 3300025935 Bacteria 4224
78 Ga0207704_10004987 3300025938 Bacteria 6105
79 Ga0207704_10091984 3300025938 Bacteria 1995
80 Ga0207691_10171292 3300025940 Bacteria 1901
81 Ga0207691_10262203 3300025940 Bacteria 1490
82 Ga0207711_10226265 3300025941 Bacteria 1712
83 Ga0207689_10031601 3300025942 Bacteria 4406
84 Ga0207651_10037339 3300025960 Bacteria 3182
85 Ga0207668_10069108 3300025972 Bacteria 2514
86 Ga0207668_10105359 3300025972 Bacteria 2104
87 Ga0207658_10013559 3300025986 Bacteria 5572
88 Ga0207658_10132577 3300025986 Bacteria 2004
89 Ga0207677_10209999 3300026023 Bacteria 1554
90 Ga0207639_10072156 3300026041 Bacteria 2703
91 Ga0207639_10211117 3300026041 Bacteria 1671
92 Ga0207641_10103735 3300026088 Bacteria 2509
93 Ga0207641_10269057 3300026088 Bacteria 1598
94 Ga0207648_10012333 3300026089 Bacteria 8001
95 Ga0207648_10076659 3300026089 Bacteria 2914
96 Ga0207675_100030977 3300026118 Bacteria 4982
97 Ga0207683_10233790 3300026121 Bacteria 1676
98 Ga0207698_10221970 3300026142 Bacteria 1708
99 Ga0268266_10000001 3300028379 Bacteria 4040580
100 Ga0268266_10050182 3300028379 Bacteria 3580
101 Ga0268266_10068855 3300028379 Bacteria 3065
102 Ga0268265_10002742 3300028380 Bacteria 13000
103 Ga0268265_10093493 3300028380 Bacteria 2409
104 Ga0268265_10153108 3300028380 Bacteria 1947
105 Ga0268264_10005309 3300028381 Bacteria 10908
106 Ga0268264_10208133 3300028381 Bacteria 1794
107 Ga0307515_10019872 3300028794 Bacteria 12039
108 Ga0265328_10000130 3300031239 Bacteria 35427
109 Ga0265328_10006222 3300031239 Bacteria 5071
110 Ga0265328_10006446 3300031239 Bacteria 4968
111 Ga0265331_10000082 3300031250 Bacteria 133041
112 Ga0373937_0129053 3300036401 Bacteria 2360
113 Ga0400483_130222 3300039062 Bacteria 1844
114 Ga0400483_214643 3300039062 Bacteria 5508
115 Ga0466968_0001374 3300044735 Bacteria 8704
116 Ga0495582_0027328 3300046473 Bacteria 3127
117 Ga0495630_0213200 3300046517 Bacteria 1474
118 Ga0495658_0024316 3300046683 Bacteria 3225
119 Ga0496100_0249821 3300048903 Bacteria 1312
120 Ga0496104_0000022 3300048907 Bacteria 237390
121 Ga0496105_0000012 3300048908 Bacteria 261713
122 Ga0496113_0161941 3300048916 Bacteria 1769
123 Ga0496122_0000853 3300048925 Bacteria 57365
124 Ga0496123_0000748 3300048926 Bacteria 52564
125 Ga0501031_0033537 3300049568 Bacteria 3349
126 Ga0501032_0001550 3300049569 Bacteria 18319
127 Ga0501032_0003829 3300049569 Bacteria 11430
128 Ga0501032_0017057 3300049569 Bacteria 5101
129 Ga0501033_0000246 3300049570 Bacteria 52184
130 Ga0501034_0000046 3300049571 Bacteria 224049
131 Ga0501034_0005876 3300049571 Bacteria 13331
132 Ga0501034_0128712 3300049571 Bacteria 2516
133 Ga0501036_0014942 3300049572 Bacteria 6476
134 Ga0501036_0016313 3300049572 Bacteria 6207
135 Ga0501037_0009422 3300049573 Bacteria 7167
136 Ga0501037_0016702 3300049573 Bacteria 5400
137 Ga0501038_0004160 3300049574 Bacteria 13458
138 Ga0501038_0083351 3300049574 Bacteria 2692
139 Ga0501038_0187778 3300049574 Bacteria 1664
140 Ga0501039_0000311 3300049575 Bacteria 34420
141 Ga0501039_0000880 3300049575 Bacteria 21807
142 Ga0501041_0130433 3300049577 Bacteria 1566
143 Ga0501042_0046422 3300049578 Bacteria 3097
144 Ga0501046_0000416 3300049580 Bacteria 42533
145 Ga0501046_0007787 3300049580 Bacteria 9398
146 Ga0501046_0016300 3300049580 Bacteria 6227
147 Ga0501046_0057754 3300049580 Bacteria 3043
148 Ga0501047_0000241 3300049581 Bacteria 64670
149 Ga0501047_0006407 3300049581 Bacteria 11070
150 Ga0501048_0006955 3300049582 Bacteria 8596
151 Ga0501048_0243777 3300049582 Bacteria 1275
152 Ga0501067_0001168 3300049583 Bacteria 14248
153 Ga0501068_0013968 3300049584 Bacteria 4581
154 Ga0501068_0075312 3300049584 Bacteria 2064
155 Ga0501069_0018230 3300049585 Bacteria 3786
156 Ga0501070_0062079 3300049586 Bacteria 3095
157 Ga0501070_0097468 3300049586 Bacteria 2432
158 Ga0501072_0029938 3300049588 Bacteria 4254
159 Ga0501073_0019360 3300049589 Bacteria 4914
160 Ga0501073_0061712 3300049589 Bacteria 2615
161 Ga0501074_0005111 3300049590 Bacteria 9427
162 Ga0501079_0028400 3300049741 Bacteria 4292
163 Ga0501080_0000052 3300049742 Bacteria 75093
164 Ga0501080_0036563 3300049742 Bacteria 4583
165 Ga0501080_0107742 3300049742 Bacteria 2582
166 Ga0501080_0228714 3300049742 Bacteria 1700
167 Ga0501083_0020257 3300049744 Bacteria 4629
168 Ga0501280_000088 3300049776 Bacteria 24582
169 Ga0501035_0000228 3300049822 Bacteria 66605
170 Ga0501035_0005905 3300049822 Bacteria 11525
171 Ga0501035_0234222 3300049822 Bacteria 1564
172 Ga0501044_0000020 3300049823 Bacteria 213460
173 Ga0501044_0008843 3300049823 Bacteria 11013
174 Ga0501044_0010205 3300049823 Bacteria 10204
175 Ga0501044_0055894 3300049823 Bacteria 4052
176 Ga0501044_0056474 3300049823 Bacteria 4031
177 Ga0501045_0015246 3300049824 Bacteria 5455
178 Ga0501045_0103895 3300049824 Bacteria 2104
179 nmdc:mga00v17_148091_c1 3300050491 Bacteria 1507
180 Ga0500651_0000458 3300053093 Bacteria 21640
181 Ga0500651_0010877 3300053093 Bacteria 5471
182 Ga0500556_0001026 3300053104 Bacteria 14611
183 Ga0500562_020387 3300053108 Bacteria 1721
184 Ga0500559_0104967 3300053136 Bacteria 1305
185 Ga0500568_0000816 3300053139 Bacteria 21892
186 Ga0500616_0007718 3300053153 Bacteria 6793
187 Ga0501082_0000954 3300060353 Bacteria 25550
188 Ga0501082_0030119 3300060353 Bacteria 4677
189 2512036719 2511231221 Bacteria 6846400
190 2523107557 2522572158 Bacteria 6514390
191 2596376733 2595698237 Bacteria 6712432
192 2738747138 2738541281 Bacteria 5112672
193 2739356367 2738543032 Bacteria 5115625
194 2829747126 2829745981 Bacteria 5406054
195 2842698461 2842698319 Bacteria 5190321
196 2861694165 2861691609 Bacteria 5628931
197 2891091032 2891088606 Bacteria 4762464
198 2902334677 2902330777 Bacteria 6395352
199 2902409823 2902405164 Bacteria 6784948
200 2919455061 2919450847 Bacteria 5631160
201 2928128198 2928125067 Bacteria 5937560
202 3003671075 3003665799 Bacteria 7279786
203 643592565 643348564 Bacteria 8839022
204 8001525298 8001522603 Bacteria 4726425
205 8001848348 8001845381 Bacteria 5804942
206 8002063341 8002060224 Bacteria 4026565
207 8045864829 8045864390 Bacteria 5043873
208 8048749219 8048746797 Bacteria 3557226
209 Ga0265327_10001416
210 Ga0070658_10237336
211 Ga0070670_100085775
212 Ga0070668_100026681
213 Ga0070668_100286717
214 Ga0070673_100065117
215 Ga0070667_100035273
216 Ga0070667_100110179
217 Ga0070667_100248618
218 Ga0070667_100263189
219 Ga0070710_10187470
220 Ga0070711_100017765
221 Ga0070663_100010910
222 Ga0068867_100055664
223 Ga0068867_100069729
224 Ga0068853_100075344
225 Ga0068853_100093567
226 Ga0070665_100000095
227 Ga0070665_100040343
228 Ga0070665_100173875
229 Ga0068855_100095641
230 Ga0070664_100313438
231 Ga0068856_100205985
232 Ga0068856_100540354
233 Ga0068852_100193750
234 Ga0068859_100008478
235 Ga0068861_100067347
236 Ga0068863_100064589
237 Ga0068863_100104585
238 Ga0068860_100016174
239 Ga0068860_100028593
240 Ga0068860_100124963
241 Ga0068862_100001213
242 Ga0068862_100057073
243 Ga0081540_1006271
244 Ga0075364_10118917
245 Ga0070712_100042526
246 Ga0075366_10081913
247 Ga0097621_100042872
248 Ga0068871_100030585
249 Ga0068871_100045763
250 Ga0068871_100093349
251 Ga0068865_100002160
252 Ga0068865_100007784
253 Ga0068865_100106036
254 Ga0097620_100008478
255 Ga0097620_100281247
256 Ga0105240_10012346
257 Ga0105247_10084539
258 Ga0105242_10001298
259 Ga0105248_10108198
260 Ga0105237_10039830
261 Ga0105237_10091096
262 Ga0105238_10017409
263 Ga0105238_10160496
264 Ga0105239_10052001
265 Ga0157369_10000027
266 Ga0157369_10375953
267 Ga0163162_10002734
268 Ga0163162_10003864
269 Ga0163162_10162739
270 Ga0157372_10033516
271 Ga0157372_10345746
272 Ga0157375_10000102
273 Ga0157375_10012961
274 Ga0163163_10105923
275 Ga0157379_10101693
276 Ga0157376_10002211
277 Ga0157376_10393397
278 Ga0207656_10027895
279 Ga0207680_10026439
280 Ga0207695_10006463
281 Ga0207671_10003811
282 Ga0207694_10000563
283 Ga0207706_10094493
284 Ga0207686_10004251
285 Ga0207709_10015519
286 Ga0207704_10004987
287 Ga0207704_10091984
288 Ga0207691_10171292
289 Ga0207691_10262203
290 Ga0207711_10226265
291 Ga0207689_10031601
292 Ga0207651_10037339
293 Ga0207668_10069108
294 Ga0207668_10105359
295 Ga0207658_10013559
296 Ga0207658_10132577
297 Ga0207677_10209999
298 Ga0207639_10072156
299 Ga0207639_10211117
300 Ga0207641_10103735
301 Ga0207641_10269057
302 Ga0207648_10012333
303 Ga0207648_10076659
304 Ga0207675_100030977
305 Ga0207683_10233790
306 Ga0207698_10221970
307 Ga0268266_10000001
308 Ga0268266_10050182
309 Ga0268266_10068855
310 Ga0268265_10002742
311 Ga0268265_10093493
312 Ga0268265_10153108
313 Ga0268264_10005309
314 Ga0268264_10208133
315 Ga0307515_10019872
316 Ga0265328_10000130
317 Ga0265328_10006222
318 Ga0265328_10006446
319 Ga0265331_10000082
320 Ga0373937_0129053
321 Ga0400483_130222
322 Ga0400483_214643
323 Ga0466968_0001374
324 Ga0495582_0027328
325 Ga0495630_0213200
326 Ga0495658_0024316
327 Ga0496100_0249821
328 Ga0496104_0000022
329 Ga0496105_0000012
330 Ga0496113_0161941
331 Ga0496122_0000853
332 Ga0496123_0000748
333 Ga0501031_0033537
334 Ga0501032_0001550
335 Ga0501032_0003829
336 Ga0501032_0017057
337 Ga0501033_0000246
338 Ga0501034_0000046
339 Ga0501034_0005876
340 Ga0501034_0128712
341 Ga0501036_0014942
342 Ga0501036_0016313
343 Ga0501037_0009422
344 Ga0501037_0016702
345 Ga0501038_0004160
346 Ga0501038_0083351
347 Ga0501038_0187778
348 Ga0501039_0000311
349 Ga0501039_0000880
350 Ga0501041_0130433
351 Ga0501042_0046422
352 Ga0501046_0000416
353 Ga0501046_0007787
354 Ga0501046_0016300
355 Ga0501046_0057754
356 Ga0501047_0000241
357 Ga0501047_0006407
358 Ga0501048_0006955
359 Ga0501048_0243777
360 Ga0501067_0001168
361 Ga0501068_0013968
362 Ga0501068_0075312
363 Ga0501069_0018230
364 Ga0501070_0062079
365 Ga0501070_0097468
366 Ga0501072_0029938
367 Ga0501073_0019360
368 Ga0501073_0061712
369 Ga0501074_0005111
370 Ga0501079_0028400
371 Ga0501080_0000052
372 Ga0501080_0036563
373 Ga0501080_0107742
374 Ga0501080_0228714
375 Ga0501083_0020257
376 Ga0501280_000088
377 Ga0501035_0000228
378 Ga0501035_0005905
379 Ga0501035_0234222
380 Ga0501044_0000020
381 Ga0501044_0008843
382 Ga0501044_0010205
383 Ga0501044_0055894
384 Ga0501044_0056474
385 Ga0501045_0015246
386 Ga0501045_0103895
387 nmdc:mga00v17_148091_c1
388 Ga0500651_0000458
389 Ga0500651_0010877
390 Ga0500556_0001026
391 Ga0500562_020387
392 Ga0500559_0104967
393 Ga0500568_0000816
394 Ga0500616_0007718
395 Ga0501082_0000954
396 Ga0501082_0030119
397 2512036719
398 2523107557
399 2596376733
400 2738747138
401 2739356367
402 2829747126
403 2842698461
404 2861694165
405 2891091032
406 2902334677
407 2902409823
408 2919455061
409 2928128198
410 3003671075
411 643592565
412 8001525298
413 8001848348
414 8002063341
415 8045864829
416 8048749219

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07728

AAA_5

AAA domain (dynein-related subfamily)

44

175

0.95

PF07726

AAA_3

ATPase family associated with various cellular activities (AAA)

44

177

0.9

PF17863

AAA_lid_2

AAA lid domain

263

327

0.9

PF20030

bpMoxR

MoxR domain in the MoxR-vWA-beta-propeller ternary systems

12

204

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.8676 2 340
2r44-assembly1.cif.gz_A crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution 0.8533 2 340
6q7m-assembly1.cif.gz_Z spiral structure of e. coli rava in the rava-ldci cage-like complex 0.7662 12 325
3nbx-assembly1.cif.gz_X crystal structure of e. coli rava (regulatory atpase variant a) in complex with adp 0.7657 12 333
4upb-assembly1.cif.gz_E electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci 0.7622 12 333
ID Description Score Start End Superfamily
2r44A03 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.8765 218 337 1.10.8.80
af_Q79FN7_37_232_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8718 6 198 3.40.50.300
af_I6YGX9_248_354_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.8669 218 337 1.10.8.80
af_Q79FN7_233_349_1.10.8.80 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain 0.8613 215 337 1.10.8.80
af_M9PHH0_754_932_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8607 36 191 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A5Q0BE14-F1-model_v4 MoxR family ATPase 0.9924 1 340 GO:0005524
GO:0016887
AF-A0A250KY63-F1-model_v4 MoxR protein 0.9898 8 340 GO:0005524
GO:0016887
AF-A0A564FX46-F1-model_v4 AAA+ ATPase domain-containing protein 0.9896 2 340 GO:0005524
GO:0016887
AF-A0A5Q0BE14-F1-model_v4 MoxR family ATPase 0.9895 1 340 GO:0005524
GO:0016887
AF-A0A4P7F6J2-F1-model_v4 AAA family ATPase 0.9885 8 340 GO:0005524
GO:0016887

Map