F317981

General Info

Members Datasets Scaffolds Average Seq Length
208 139 416 160

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10000189|Ga0265338_10000189100
Length 195
Sequence MSDKSKSPKVQKSKVSSKELEAQVYALTEALQRERADADNIRRRHEDQIGGLKDMVKASVVRELLPVIDNFERALKHSPLSSSGEQGETRGSKIPNQVGNDNVADFVKGILAIIKQFEKTLSDMGVERIKTVGHEFDPHLHEAISMDEDGDGQVEIVCEELQPGYRLGDEVIRHAMVKVKMGHLPKASNKNSEEQ

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
85 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
86 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
89 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
90 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
91 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
92 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
120 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
121 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
124 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
125 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
126 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
127 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
128 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
129 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
130 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
131 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
132 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
133 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
134 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
135 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
136 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
137 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
138 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
139 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.42
Nodule 0
Rhizoplane 0
Rhizosphere 84.13
Stem 0
Stem Tuber 0
Unclassified 18.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10000189 3300028800 Bacteria 115979
2 JGI24736J21556_1017722 3300001904 Unclassified 1129
3 JGI24741J21665_1000035 3300001915 Bacteria 32655
4 JGI24741J21665_1003533 3300001915 Bacteria 3700
5 JGI24740J21852_10005212 3300001979 Bacteria 5518
6 JGI24740J21852_10058498 3300001979 Unclassified 1071
7 JGI24737J22298_10000108 3300001990 Bacteria 25113
8 JGI24735J21928_10000053 3300002067 Bacteria 50333
9 JGI24742J22300_10000127 3300002244 Bacteria 11015
10 JGI25406J46586_10061005 3300003203 Bacteria 1217
11 rootH1_10178829 3300003316 Unclassified 1544
12 rootH2_10209990 3300003320 Bacteria 1458
13 rootL2_10173799 3300003322 Bacteria 3081
14 JGI25405J52794_10023497 3300003911 Bacteria 1255
15 Ga0070658_10001231 3300005327 Bacteria 21949
16 Ga0070658_10014745 3300005327 Bacteria 6268
17 Ga0070658_11370685 3300005327 Unclassified 614
18 Ga0070676_10016323 3300005328 Bacteria 4104
19 Ga0070683_100000183 3300005329 Bacteria 41586
20 Ga0070683_100030683 3300005329 Bacteria 4883
21 Ga0070683_100487398 3300005329 Unclassified 1177
22 Ga0070690_100012370 3300005330 Bacteria 5022
23 Ga0070670_100022266 3300005331 Bacteria 5455
24 Ga0070680_100023994 3300005336 Bacteria 4868
25 Ga0070680_100134783 3300005336 Bacteria 2068
26 Ga0070680_100839889 3300005336 Bacteria 792
27 Ga0070660_100009890 3300005339 Bacteria 6727
28 Ga0070660_100018378 3300005339 Bacteria 5108
29 Ga0070660_101075712 3300005339 Unclassified 680
30 Ga0070691_10103056 3300005341 Bacteria 1419
31 Ga0070691_10926830 3300005341 Bacteria 539
32 Ga0070661_100767688 3300005344 Unclassified 789
33 Ga0070659_100339999 3300005366 Bacteria 1257
34 Ga0070659_100542016 3300005366 Unclassified 995
35 Ga0070681_10145285 3300005458 Bacteria 2301
36 Ga0070681_10467341 3300005458 Bacteria 1174
37 Ga0070681_10511332 3300005458 Bacteria 1114
38 Ga0068867_101070872 3300005459 Unclassified 735
39 Ga0070679_100011677 3300005530 Bacteria 8374
40 Ga0070679_100013700 3300005530 Bacteria 7767
41 Ga0070679_100014546 3300005530 Bacteria 7559
42 Ga0070679_100132735 3300005530 Bacteria 2471
43 Ga0070679_100583495 3300005530 Unclassified 1061
44 Ga0070684_100000792 3300005535 Bacteria 21969
45 Ga0070684_100001663 3300005535 Bacteria 16139
46 Ga0068855_100001675 3300005563 Bacteria 27736
47 Ga0068855_100006998 3300005563 Bacteria 13694
48 Ga0068855_100368193 3300005563 Bacteria 1580
49 Ga0068855_101175818 3300005563 Bacteria 798
50 Ga0070664_100070988 3300005564 Bacteria 2984
51 Ga0068857_100000002 3300005577 Bacteria 241401
52 Ga0068857_100126486 3300005577 Bacteria 2303
53 Ga0068854_101787511 3300005578 Bacteria 563
54 Ga0068856_100000002 3300005614 Bacteria 372816
55 Ga0068856_100000568 3300005614 Bacteria 40410
56 Ga0068856_101006578 3300005614 Bacteria 852
57 Ga0068856_101043945 3300005614 Unclassified 835
58 Ga0068852_100423624 3300005616 Unclassified 1313
59 Ga0068852_100663078 3300005616 Unclassified 1051
60 Ga0068864_100751941 3300005618 Unclassified 955
61 Ga0068863_100370357 3300005841 Unclassified 1398
62 Ga0068863_100700619 3300005841 Bacteria 1007
63 Ga0081455_10000008 3300005937 Bacteria 256558
64 Ga0081539_10000789 3300005985 Bacteria 61661
65 Ga0075368_10014652 3300006042 Bacteria 2900
66 Ga0075363_100179202 3300006048 Unclassified 1205
67 Ga0075364_10024500 3300006051 Unclassified 3833
68 Ga0075364_10033496 3300006051 Bacteria 3309
69 Ga0075367_10000166 3300006178 Bacteria 20919
70 Ga0075369_10000006 3300006186 Bacteria 132271
71 Ga0075366_10000223 3300006195 Bacteria 25208
72 Ga0068871_100154921 3300006358 Bacteria 1956
73 Ga0075428_100078250 3300006844 Bacteria 3610
74 Ga0075430_100004357 3300006846 Bacteria 11950
75 Ga0105240_10009060 3300009093 Bacteria 14130
76 Ga0105240_10110145 3300009093 Bacteria 3333
77 Ga0111539_10001364 3300009094 Bacteria 32516
78 Ga0105245_10033049 3300009098 Bacteria 4582
79 Ga0105245_11490450 3300009098 Bacteria 727
80 Ga0105241_10118185 3300009174 Bacteria 2131
81 Ga0105248_10346929 3300009177 Bacteria 1671
82 Ga0105248_10706376 3300009177 Unclassified 1138
83 Ga0105238_10157396 3300009551 Bacteria 2247
84 Ga0105238_10693418 3300009551 Bacteria 1030
85 Ga0105033_111963 3300009986 Unclassified 767
86 Ga0105239_11015524 3300010375 Unclassified 954
87 Ga0157373_10000059 3300013100 Bacteria 95794
88 Ga0157373_10393000 3300013100 Bacteria 993
89 Ga0157369_10119693 3300013105 Bacteria 2794
90 Ga0157369_10499898 3300013105 Bacteria 1258
91 Ga0157374_10009880 3300013296 Bacteria 8190
92 Ga0157374_10509248 3300013296 Bacteria 1209
93 Ga0157378_10348765 3300013297 Bacteria 1445
94 Ga0157378_11865268 3300013297 Bacteria 650
95 Ga0157372_10033943 3300013307 Bacteria 5607
96 Ga0157372_11312815 3300013307 Unclassified 835
97 Ga0157372_11314449 3300013307 Bacteria 834
98 Ga0163163_10162756 3300014325 Unclassified 2277
99 Ga0157379_10012270 3300014968 Bacteria 7484
100 Ga0207647_10001830 3300025904 Bacteria 16313
101 Ga0207645_10012949 3300025907 Bacteria 5642
102 Ga0207705_10001580 3300025909 Bacteria 18100
103 Ga0207705_10138928 3300025909 Bacteria 1813
104 Ga0207707_10103035 3300025912 Bacteria 2495
105 Ga0207707_10441581 3300025912 Bacteria 1114
106 Ga0207695_10010248 3300025913 Bacteria 11487
107 Ga0207660_10005124 3300025917 Bacteria 8525
108 Ga0207657_10004368 3300025919 Bacteria 14961
109 Ga0207657_10019883 3300025919 Bacteria 6363
110 Ga0207652_10007165 3300025921 Bacteria 8993
111 Ga0207652_10013064 3300025921 Bacteria 6720
112 Ga0207652_10015421 3300025921 Bacteria 6208
113 Ga0207694_10110349 3300025924 Bacteria 2188
114 Ga0207694_10480822 3300025924 Bacteria 1039
115 Ga0207687_10910863 3300025927 Unclassified 752
116 Ga0207664_10001316 3300025929 Bacteria 16373
117 Ga0207690_10255016 3300025932 Bacteria 1357
118 Ga0207686_10005474 3300025934 Bacteria 6813
119 Ga0207711_10520990 3300025941 Bacteria 1108
120 Ga0207661_10003959 3300025944 Bacteria 10344
121 Ga0207661_10004009 3300025944 Bacteria 10293
122 Ga0207661_10533642 3300025944 Bacteria 1074
123 Ga0207667_10000466 3300025949 Bacteria 54272
124 Ga0207667_10050666 3300025949 Bacteria 4380
125 Ga0207667_10567144 3300025949 Bacteria 1147
126 Ga0207640_10952032 3300025981 Bacteria 753
127 Ga0207702_10000001 3300026078 Bacteria 895738
128 Ga0207702_10001830 3300026078 Bacteria 20937
129 Ga0207702_10865710 3300026078 Bacteria 895
130 Ga0207648_10188715 3300026089 Bacteria 1826
131 Ga0207676_10680439 3300026095 Unclassified 995
132 Ga0207674_10000001 3300026116 Bacteria 616581
133 Ga0207674_10166970 3300026116 Unclassified 2155
134 Ga0207674_10750627 3300026116 Bacteria 942
135 Ga0207698_10608613 3300026142 Unclassified 1078
136 Ga0209813_10006435 3300027866 Bacteria 2900
137 Ga0207428_10037741 3300027907 Bacteria 3929
138 Ga0265337_1000055 3300028556 Bacteria 51887
139 Ga0265337_1000718 3300028556 Bacteria 17427
140 Ga0265337_1043611 3300028556 Bacteria 1282
141 Ga0265319_1013909 3300028563 Bacteria 3179
142 Ga0265319_1025749 3300028563 Unclassified 2102
143 Ga0265334_10171018 3300028573 Unclassified 761
144 Ga0265338_10001575 3300028800 Bacteria 36775
145 Ga0265338_10010358 3300028800 Bacteria 10947
146 Ga0265338_10017760 3300028800 Bacteria 7649
147 Ga0265338_10026213 3300028800 Bacteria 5887
148 Ga0265338_10034650 3300028800 Bacteria 4875
149 Ga0265338_10083336 3300028800 Bacteria 2675
150 Ga0265338_10099949 3300028800 Unclassified 2367
151 Ga0265338_10192673 3300028800 Unclassified 1544
152 Ga0265324_10263635 3300029957 Bacteria 585
153 Ga0316179_1007492 3300030734 Bacteria 974
154 Ga0265330_10211546 3300031235 Unclassified 819
155 Ga0265320_10058615 3300031240 Bacteria 1843
156 Ga0265331_10081773 3300031250 Bacteria 1499
157 Ga0265316_10123852 3300031344 Bacteria 1951
158 Ga0265314_10187332 3300031711 Unclassified 1234
159 Ga0265342_10029528 3300031712 Bacteria 3404
160 Ga0265342_10130665 3300031712 Unclassified 1408
161 Ga0373927_0652819 3300035695 Bacteria 695
162 Ga0395900_0038421 3300037418 Bacteria 4933
163 Ga0395901_0448219 3300038443 Bacteria 1320
164 Ga0495629_0063456 3300046459 Bacteria 2580
165 Ga0495658_0186310 3300046683 Bacteria 1289
166 Ga0495671_0397575 3300046692 Bacteria 660
167 Ga0495649_0000170 3300046694 Bacteria 57001
168 Ga0501033_0015049 3300049570 Bacteria 5870
169 Ga0501034_0003440 3300049571 Bacteria 18076
170 Ga0501034_0073257 3300049571 Bacteria 3434
171 Ga0501036_0010550 3300049572 Bacteria 7634
172 Ga0501037_0047613 3300049573 Bacteria 3141
173 Ga0501037_0162443 3300049573 Bacteria 1592
174 Ga0501038_0075091 3300049574 Bacteria 2858
175 Ga0501039_0714021 3300049575 Bacteria 784
176 Ga0501043_0027328 3300049579 Bacteria 4480
177 Ga0501046_0056150 3300049580 Bacteria 3092
178 Ga0501047_0000057 3300049581 Bacteria 140059
179 Ga0501070_0575165 3300049586 Bacteria 900
180 Ga0501083_0104890 3300049744 Bacteria 1862
181 Ga0501276_000092 3300049773 Bacteria 4642
182 Ga0501035_0000005 3300049822 Bacteria 392980
183 Ga0501044_0003768 3300049823 Bacteria 17033
184 nmdc:mga03n38_28077_c1 3300050490 Unclassified 2341
185 nmdc:mga00v17_19659_c1 3300050491 Unclassified 3860
186 nmdc:mga0k408_1069_c1 3300050493 Bacteria 15067
187 nmdc:mga06z11_21_c1 3300050494 Bacteria 69936
188 nmdc:mga06z11_401322_c1 3300050494 Unclassified 825
189 nmdc:mga04h51_7370_c1 3300050495 Bacteria 2900
190 nmdc:mga0qj67_2860_c1 3300050509 Bacteria 12381
191 nmdc:mga08y16_8567_c1 3300050511 Bacteria 10716
192 Ga0500610_0089321 3300053079 Bacteria 1601
193 Ga0500643_000034 3300053087 Bacteria 185705
194 Ga0500644_0000465 3300053088 Bacteria 18290
195 Ga0500646_0000816 3300053090 Bacteria 8651
196 Ga0500650_0000001 3300053098 Bacteria 818797
197 Ga0500555_017553 3300053103 Bacteria 2062
198 Ga0500594_0000001 3300053118 Bacteria 1178472
199 Ga0500628_005367 3300053129 Bacteria 2138
200 Ga0500655_000275 3300053133 Bacteria 11921
201 Ga0500561_0000002 3300053137 Bacteria 394147
202 Ga0500577_0000784 3300053142 Bacteria 8181
203 Ga0500577_0000979 3300053142 Bacteria 7360
204 Ga0500579_005619 3300053143 Bacteria 7717
205 Ga0500603_002825 3300053150 Bacteria 3764
206 Ga0500611_000725 3300053727 Unclassified 3387
207 Ga0500645_128008 3300053730 Unclassified 706
208 Ga0587094_011440 3300059513 Bacteria 1168
209 Ga0265338_10000189
210 JGI24736J21556_1017722
211 JGI24741J21665_1000035
212 JGI24741J21665_1003533
213 JGI24740J21852_10005212
214 JGI24740J21852_10058498
215 JGI24737J22298_10000108
216 JGI24735J21928_10000053
217 JGI24742J22300_10000127
218 JGI25406J46586_10061005
219 rootH1_10178829
220 rootH2_10209990
221 rootL2_10173799
222 JGI25405J52794_10023497
223 Ga0070658_10001231
224 Ga0070658_10014745
225 Ga0070658_11370685
226 Ga0070676_10016323
227 Ga0070683_100000183
228 Ga0070683_100030683
229 Ga0070683_100487398
230 Ga0070690_100012370
231 Ga0070670_100022266
232 Ga0070680_100023994
233 Ga0070680_100134783
234 Ga0070680_100839889
235 Ga0070660_100009890
236 Ga0070660_100018378
237 Ga0070660_101075712
238 Ga0070691_10103056
239 Ga0070691_10926830
240 Ga0070661_100767688
241 Ga0070659_100339999
242 Ga0070659_100542016
243 Ga0070681_10145285
244 Ga0070681_10467341
245 Ga0070681_10511332
246 Ga0068867_101070872
247 Ga0070679_100011677
248 Ga0070679_100013700
249 Ga0070679_100014546
250 Ga0070679_100132735
251 Ga0070679_100583495
252 Ga0070684_100000792
253 Ga0070684_100001663
254 Ga0068855_100001675
255 Ga0068855_100006998
256 Ga0068855_100368193
257 Ga0068855_101175818
258 Ga0070664_100070988
259 Ga0068857_100000002
260 Ga0068857_100126486
261 Ga0068854_101787511
262 Ga0068856_100000002
263 Ga0068856_100000568
264 Ga0068856_101006578
265 Ga0068856_101043945
266 Ga0068852_100423624
267 Ga0068852_100663078
268 Ga0068864_100751941
269 Ga0068863_100370357
270 Ga0068863_100700619
271 Ga0081455_10000008
272 Ga0081539_10000789
273 Ga0075368_10014652
274 Ga0075363_100179202
275 Ga0075364_10024500
276 Ga0075364_10033496
277 Ga0075367_10000166
278 Ga0075369_10000006
279 Ga0075366_10000223
280 Ga0068871_100154921
281 Ga0075428_100078250
282 Ga0075430_100004357
283 Ga0105240_10009060
284 Ga0105240_10110145
285 Ga0111539_10001364
286 Ga0105245_10033049
287 Ga0105245_11490450
288 Ga0105241_10118185
289 Ga0105248_10346929
290 Ga0105248_10706376
291 Ga0105238_10157396
292 Ga0105238_10693418
293 Ga0105033_111963
294 Ga0105239_11015524
295 Ga0157373_10000059
296 Ga0157373_10393000
297 Ga0157369_10119693
298 Ga0157369_10499898
299 Ga0157374_10009880
300 Ga0157374_10509248
301 Ga0157378_10348765
302 Ga0157378_11865268
303 Ga0157372_10033943
304 Ga0157372_11312815
305 Ga0157372_11314449
306 Ga0163163_10162756
307 Ga0157379_10012270
308 Ga0207647_10001830
309 Ga0207645_10012949
310 Ga0207705_10001580
311 Ga0207705_10138928
312 Ga0207707_10103035
313 Ga0207707_10441581
314 Ga0207695_10010248
315 Ga0207660_10005124
316 Ga0207657_10004368
317 Ga0207657_10019883
318 Ga0207652_10007165
319 Ga0207652_10013064
320 Ga0207652_10015421
321 Ga0207694_10110349
322 Ga0207694_10480822
323 Ga0207687_10910863
324 Ga0207664_10001316
325 Ga0207690_10255016
326 Ga0207686_10005474
327 Ga0207711_10520990
328 Ga0207661_10003959
329 Ga0207661_10004009
330 Ga0207661_10533642
331 Ga0207667_10000466
332 Ga0207667_10050666
333 Ga0207667_10567144
334 Ga0207640_10952032
335 Ga0207702_10000001
336 Ga0207702_10001830
337 Ga0207702_10865710
338 Ga0207648_10188715
339 Ga0207676_10680439
340 Ga0207674_10000001
341 Ga0207674_10166970
342 Ga0207674_10750627
343 Ga0207698_10608613
344 Ga0209813_10006435
345 Ga0207428_10037741
346 Ga0265337_1000055
347 Ga0265337_1000718
348 Ga0265337_1043611
349 Ga0265319_1013909
350 Ga0265319_1025749
351 Ga0265334_10171018
352 Ga0265338_10001575
353 Ga0265338_10010358
354 Ga0265338_10017760
355 Ga0265338_10026213
356 Ga0265338_10034650
357 Ga0265338_10083336
358 Ga0265338_10099949
359 Ga0265338_10192673
360 Ga0265324_10263635
361 Ga0316179_1007492
362 Ga0265330_10211546
363 Ga0265320_10058615
364 Ga0265331_10081773
365 Ga0265316_10123852
366 Ga0265314_10187332
367 Ga0265342_10029528
368 Ga0265342_10130665
369 Ga0373927_0652819
370 Ga0395900_0038421
371 Ga0395901_0448219
372 Ga0495629_0063456
373 Ga0495658_0186310
374 Ga0495671_0397575
375 Ga0495649_0000170
376 Ga0501033_0015049
377 Ga0501034_0003440
378 Ga0501034_0073257
379 Ga0501036_0010550
380 Ga0501037_0047613
381 Ga0501037_0162443
382 Ga0501038_0075091
383 Ga0501039_0714021
384 Ga0501043_0027328
385 Ga0501046_0056150
386 Ga0501047_0000057
387 Ga0501070_0575165
388 Ga0501083_0104890
389 Ga0501276_000092
390 Ga0501035_0000005
391 Ga0501044_0003768
392 nmdc:mga03n38_28077_c1
393 nmdc:mga00v17_19659_c1
394 nmdc:mga0k408_1069_c1
395 nmdc:mga06z11_21_c1
396 nmdc:mga06z11_401322_c1
397 nmdc:mga04h51_7370_c1
398 nmdc:mga0qj67_2860_c1
399 nmdc:mga08y16_8567_c1
400 Ga0500610_0089321
401 Ga0500643_000034
402 Ga0500644_0000465
403 Ga0500646_0000816
404 Ga0500650_0000001
405 Ga0500555_017553
406 Ga0500594_0000001
407 Ga0500628_005367
408 Ga0500655_000275
409 Ga0500561_0000002
410 Ga0500577_0000784
411 Ga0500577_0000979
412 Ga0500579_005619
413 Ga0500603_002825
414 Ga0500611_000725
415 Ga0500645_128008
416 Ga0587094_011440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01025

GrpE

GrpE

1

181

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4biu-assembly2.cif.gz_B crystal structure of cpxahdc (orthorhombic form 1) 0.6806 16 94
4ani-assembly1.cif.gz_B structural basis for the intermolecular communication between dnak and grpe in the dnak chaperone system from geobacillus kaustophilus hta426 0.6708 8 144
4etv-assembly3.cif.gz_A crystal structure of mouse ryanodine receptor 2 (2699-2904) 0.6702 62 97
4biu-assembly1.cif.gz_D crystal structure of cpxahdc (orthorhombic form 1) 0.6543 16 95
1dkg-assembly1.cif.gz_A crystal structure of the nucleotide exchange factor grpe bound to the atpase domain of the molecular chaperone dnak 0.6477 8 143
ID Description Score Start End Superfamily
af_P9WMT5_133_191_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9147 91 145 2.30.22.10
af_A0A0P0VLJ4_201_256_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9122 89 142 2.30.22.10
af_Q14765_135_314_1.20.1050.20 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2;STAT transcription factor, all-alpha domain 0.9069 41 85 1.20.1050.20
af_Q2FXZ1_152_207_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.886 89 142 2.30.22.10
3a6mB02 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.8797 89 145 2.30.22.10
ID Description Score Start End GO Terms
AF-A0A7W1KHZ3-F1-model_v4 Protein GrpE 1.003 85 145 GO:0000774
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A2T2QZZ2-F1-model_v4 Protein GrpE 0.9813 77 145 GO:0000774
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A1F7R8T9-F1-model_v4 Protein GrpE 0.9703 65 144 GO:0000774
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A7X9D6X1-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.955 8 143 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-A0A7C2W4T4-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9528 8 143 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087

Map