F317918

General Info

Members Datasets Scaffolds Average Seq Length
208 129 416 246

Family's Representative Sequence

Representative Sequence 3300025932|Ga0207690_10085498|Ga0207690_100854982
Length 278
Sequence MLRLATCFFCGAPKESRDHCAQDRASVIMCRSEPGPMPKRKISPRYIADHIRRVLKDGGSAPHAEDVQWFFKEEIQSRGWYTAELRRVAVRFRRTIKSERGTEFLIQVANDLFRGKVLEEKVFAVLMLETLTDEFGDPEFRLFESWLDRITSWADHDALAHYLIAPMLAAEPSRKAFVFRWAKSKNRWHRRAACVGLIQGTRQKLFFPDIVRLSNKLLSDEDDMVQKGLGWLLRETAKADPKRTVPYLMKIRLRAPRLVLRTACETLPQQHRSRVLGF

Samples

Sample ID Description Type Environment
1 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
22 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
46 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
47 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
48 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
92 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
93 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
107 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
108 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
114 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
127 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.56
Metatranscriptomes 1.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.33
Rhizosphere 94.23
Stem 0
Stem Tuber 0
Unclassified 17.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207690_10085498 3300025932 Unclassified 2214
2 Ga0070683_100134150 3300005329 Bacteria 2344
3 Ga0068869_100156217 3300005334 Bacteria 1773
4 Ga0070709_10085909 3300005434 Bacteria 2064
5 Ga0070709_10091045 3300005434 Unclassified 2012
6 Ga0070714_100032495 3300005435 Bacteria 4356
7 Ga0070714_100263922 3300005435 Bacteria 1595
8 Ga0070714_100419080 3300005435 Bacteria 1268
9 Ga0070713_100000134 3300005436 Bacteria 48639
10 Ga0070713_100000441 3300005436 Bacteria 26508
11 Ga0070713_100040197 3300005436 Bacteria 3801
12 Ga0070713_100118563 3300005436 Bacteria 2317
13 Ga0070713_100372952 3300005436 Unclassified 1328
14 Ga0070710_10008124 3300005437 Bacteria 5102
15 Ga0070711_100000271 3300005439 Bacteria 26787
16 Ga0070708_100018576 3300005445 Bacteria 5820
17 Ga0070708_100027364 3300005445 Bacteria 4892
18 Ga0070708_100035029 3300005445 Bacteria 4371
19 Ga0070708_100053746 3300005445 Unclassified 3575
20 Ga0070708_100253985 3300005445 Bacteria 1652
21 Ga0070708_100428145 3300005445 Bacteria 1248
22 Ga0070708_100618322 3300005445 Bacteria 1021
23 Ga0070662_100423652 3300005457 Bacteria 1101
24 Ga0070706_100012428 3300005467 Bacteria 7889
25 Ga0070706_100031452 3300005467 Bacteria 4894
26 Ga0070707_100156588 3300005468 Bacteria 2219
27 Ga0070698_100041613 3300005471 Unclassified 4717
28 Ga0070699_100002709 3300005518 Bacteria 15794
29 Ga0070679_100009235 3300005530 Bacteria 9319
30 Ga0070697_100011265 3300005536 Bacteria 6988
31 Ga0070697_100039836 3300005536 Bacteria 3800
32 Ga0070697_100086761 3300005536 Unclassified 2583
33 Ga0068855_100192253 3300005563 Bacteria 2301
34 Ga0068856_100010172 3300005614 Bacteria 9144
35 Ga0068859_100001851 3300005617 Bacteria 21505
36 Ga0068864_100060510 3300005618 Bacteria 3279
37 Ga0068866_10003790 3300005718 Bacteria 6201
38 Ga0068863_100251663 3300005841 Bacteria 1707
39 Ga0068860_100018451 3300005843 Bacteria 6786
40 Ga0068860_100183327 3300005843 Bacteria 2023
41 Ga0068862_100468291 3300005844 Bacteria 1191
42 Ga0070717_10099431 3300006028 Bacteria 2468
43 Ga0070717_10130385 3300006028 Bacteria 2161
44 Ga0070715_10003006 3300006163 Bacteria 5274
45 Ga0070715_10006826 3300006163 Bacteria 3897
46 Ga0070715_10012101 3300006163 Unclassified 3127
47 Ga0070716_100003540 3300006173 Bacteria 7367
48 Ga0070716_100030626 3300006173 Unclassified 2921
49 Ga0070712_100000262 3300006175 Bacteria 29465
50 Ga0070712_100000618 3300006175 Bacteria 20900
51 Ga0070712_100002390 3300006175 Bacteria 11557
52 Ga0070712_100011797 3300006175 Bacteria 5553
53 Ga0075433_10201980 3300006852 Bacteria 1767
54 Ga0075434_100000242 3300006871 Bacteria 38087
55 Ga0097620_100001850 3300006931 Bacteria 21505
56 Ga0105240_10495442 3300009093 Bacteria 1359
57 Ga0105241_10345167 3300009174 Bacteria 1291
58 Ga0105237_10246828 3300009545 Bacteria 1787
59 Ga0105237_10516140 3300009545 Unclassified 1201
60 Ga0105238_10065612 3300009551 Unclassified 3632
61 Ga0105238_10441283 3300009551 Bacteria 1298
62 Ga0105246_10010563 3300011119 Bacteria 5720
63 Ga0157373_10097565 3300013100 Bacteria 2069
64 Ga0157373_10294373 3300013100 Unclassified 1151
65 Ga0157370_10144950 3300013104 Bacteria 2212
66 Ga0157369_10005867 3300013105 Bacteria 14265
67 Ga0157369_10015743 3300013105 Bacteria 8521
68 Ga0157374_10005580 3300013296 Bacteria 10593
69 Ga0157374_10008005 3300013296 Bacteria 9037
70 Ga0157378_10000680 3300013297 Bacteria 31989
71 Ga0157372_10024941 3300013307 Bacteria 6499
72 Ga0157372_10164570 3300013307 Unclassified 2564
73 Ga0157372_10529051 3300013307 Unclassified 1374
74 Ga0182008_10066660 3300014497 Bacteria 1772
75 Ga0182007_10021631 3300015262 Bacteria 2281
76 Ga0224569_100109 3300022732 Bacteria 5745
77 Ga0224571_100014 3300022734 Bacteria 5135
78 Ga0224572_1000176 3300024225 Bacteria 5867
79 Ga0224572_1022063 3300024225 Archaea 1224
80 Ga0228598_1010652 3300024227 Bacteria 1830
81 Ga0207692_10002000 3300025898 Bacteria 7789
82 Ga0207647_10034850 3300025904 Bacteria 3210
83 Ga0207685_10003971 3300025905 Bacteria 3683
84 Ga0207685_10007955 3300025905 Unclassified 2990
85 Ga0207685_10082293 3300025905 Bacteria 1335
86 Ga0207699_10000209 3300025906 Bacteria 34945
87 Ga0207699_10055931 3300025906 Bacteria 2350
88 Ga0207699_10130744 3300025906 Bacteria 1637
89 Ga0207684_10020974 3300025910 Bacteria 5580
90 Ga0207707_10110913 3300025912 Bacteria 2398
91 Ga0207695_10211344 3300025913 Bacteria 1851
92 Ga0207693_10000026 3300025915 Bacteria 122717
93 Ga0207693_10000275 3300025915 Bacteria 47590
94 Ga0207693_10008118 3300025915 Bacteria 8605
95 Ga0207693_10018551 3300025915 Bacteria 5539
96 Ga0207693_10049654 3300025915 Bacteria 3295
97 Ga0207663_10004323 3300025916 Bacteria 7053
98 Ga0207663_10004728 3300025916 Bacteria 6803
99 Ga0207663_10022755 3300025916 Bacteria 3587
100 Ga0207652_10179608 3300025921 Bacteria 1901
101 Ga0207650_10067199 3300025925 Bacteria 2690
102 Ga0207700_10000111 3300025928 Bacteria 48784
103 Ga0207700_10002704 3300025928 Bacteria 10219
104 Ga0207700_10224561 3300025928 Bacteria 1594
105 Ga0207664_10065633 3300025929 Bacteria 2906
106 Ga0207664_10140028 3300025929 Bacteria 2045
107 Ga0207664_10195411 3300025929 Bacteria 1744
108 Ga0207706_10081611 3300025933 Unclassified 2841
109 Ga0207704_10036846 3300025938 Bacteria 2818
110 Ga0207665_10000358 3300025939 Bacteria 31676
111 Ga0207665_10036636 3300025939 Bacteria 3263
112 Ga0207665_10070031 3300025939 Bacteria 2392
113 Ga0207665_10118252 3300025939 Bacteria 1870
114 Ga0207689_10007004 3300025942 Bacteria 9912
115 Ga0207689_10157922 3300025942 Bacteria 1869
116 Ga0207658_10251147 3300025986 Bacteria 1503
117 Ga0207678_10485605 3300026067 Bacteria 1076
118 Ga0207641_10213152 3300026088 Bacteria 1787
119 Ga0207674_10000867 3300026116 Bacteria 39599
120 Ga0265356_1000478 3300028017 Bacteria 7213
121 Ga0268264_10103983 3300028381 Bacteria 2474
122 Ga0265326_10042345 3300028558 Bacteria 1292
123 Ga0265338_10004711 3300028800 Bacteria 18253
124 Ga0265338_10197186 3300028800 Bacteria 1521
125 Ga0265338_10318004 3300028800 Unclassified 1127
126 Ga0265762_1000119 3300030760 Bacteria 11713
127 Ga0265760_10014469 3300031090 Unclassified 2261
128 Ga0265760_10014810 3300031090 Unclassified 2236
129 Ga0265330_10010847 3300031235 Bacteria 4282
130 Ga0265325_10017529 3300031241 Bacteria 3979
131 Ga0265339_10012933 3300031249 Bacteria 5073
132 Ga0265339_10027092 3300031249 Bacteria 3277
133 Ga0265339_10059178 3300031249 Bacteria 2067
134 Ga0265339_10083235 3300031249 Bacteria 1688
135 Ga0265331_10041301 3300031250 Bacteria 2241
136 Ga0265316_10014157 3300031344 Bacteria 7036
137 Ga0265316_10223178 3300031344 Unclassified 1390
138 Ga0265316_10486940 3300031344 Bacteria 882
139 Ga0307408_100277581 3300031548 Bacteria 1394
140 Ga0265314_10009668 3300031711 Bacteria 8120
141 Ga0265314_10041329 3300031711 Bacteria 3301
142 Ga0265314_10147303 3300031711 Bacteria 1448
143 Ga0307410_10030830 3300031852 Bacteria 3432
144 Ga0307406_10048137 3300031901 Bacteria 2691
145 Ga0307409_100012125 3300031995 Bacteria 5476
146 Ga0307409_100024575 3300031995 Unclassified 4205
147 Ga0307416_100108397 3300032002 Bacteria 2440
148 Ga0307414_10078262 3300032004 Bacteria 2410
149 Ga0307415_100012606 3300032126 Unclassified 4895
150 Ga0373926_0213164 3300035083 Unclassified 745
151 Ga0373936_0000926 3300035113 Bacteria 10468
152 Ga0373945_0006173 3300035116 Unclassified 3853
153 Ga0373954_0097298 3300035118 Bacteria 1418
154 Ga0373943_0000008 3300035170 Bacteria 69214
155 Ga0373955_0033146 3300035172 Bacteria 2718
156 Ga0373955_0037087 3300035172 Bacteria 2591
157 Ga0373955_0056196 3300035172 Unclassified 2159
158 Ga0373931_0499004 3300035691 Unclassified 785
159 Ga0373935_0009893 3300035692 Bacteria 5714
160 Ga0373927_0000102 3300035695 Bacteria 64428
161 Ga0373947_0007459 3300035725 Bacteria 6330
162 Ga0373947_0026776 3300035725 Unclassified 3372
163 Ga0373937_0045025 3300036401 Bacteria 4031
164 Ga0373937_0125733 3300036401 Bacteria 2392
165 Ga0373937_0236352 3300036401 Bacteria 1721
166 Ga0373925_0005430 3300037068 Bacteria 9495
167 Ga0373925_0027423 3300037068 Unclassified 4169
168 Ga0436364_0988102 3300037853 Unclassified 1143
169 Ga0436364_1531402 3300037853 Bacteria 2370
170 Ga0436360_0130742 3300039438 Unclassified 1047
171 Ga0436363_1035544 3300039450 Unclassified 2669
172 Ga0451576_0154394 3300045051 Bacteria 2394
173 Ga0466967_0002520 3300045976 Bacteria 11456
174 Ga0466967_0057583 3300045976 Bacteria 3432
175 Ga0466967_0062899 3300045976 Unclassified 3296
176 Ga0466967_0918035 3300045976 Bacteria 871
177 Ga0495629_0018762 3300046459 Bacteria 4945
178 Ga0495580_0002140 3300046472 Bacteria 17326
179 Ga0495580_0012747 3300046472 Bacteria 6443
180 Ga0495580_0052874 3300046472 Bacteria 2868
181 Ga0495582_0001976 3300046473 Bacteria 11502
182 Ga0495608_0310303 3300046511 Unclassified 976
183 Ga0495652_0294261 3300046529 Bacteria 1183
184 Ga0495587_0053780 3300046536 Bacteria 2373
185 Ga0495645_0097018 3300046543 Unclassified 2100
186 Ga0495645_0313814 3300046543 Unclassified 1020
187 Ga0495623_0131927 3300046679 Unclassified 1495
188 Ga0495623_0149380 3300046679 Bacteria 1382
189 Ga0495658_0007843 3300046683 Bacteria 5287
190 Ga0495674_0006305 3300047319 Bacteria 11371
191 Ga0495674_0031174 3300047319 Bacteria 4845
192 Ga0495676_0089810 3300047321 Bacteria 2301
193 Ga0495675_0023510 3300047444 Bacteria 3927
194 Ga0495602_0104320 3300048088 Bacteria 2319
195 Ga0495602_0360227 3300048088 Bacteria 1047
196 Ga0496100_0110769 3300048903 Bacteria 1907
197 Ga0496100_0139942 3300048903 Bacteria 1714
198 Ga0496102_0270517 3300048905 Bacteria 1602
199 Ga0496104_0211512 3300048907 Bacteria 1851
200 Ga0496105_0008491 3300048908 Bacteria 7980
201 Ga0496112_0106726 3300048915 Bacteria 2770
202 Ga0496114_0560244 3300048917 Bacteria 1009
203 Ga0496115_0039011 3300048918 Unclassified 3771
204 Ga0496115_0299838 3300048918 Unclassified 1317
205 Ga0501216_027903 3300049660 Bacteria 1027
206 Ga0501257_026672 3300049686 Bacteria 1380
207 nmdc:mga0n895_1177_c1 3300050512 Bacteria 19184
208 Ga0495601_0015532 3300053077 Bacteria 4602
209 Ga0207690_10085498
210 Ga0070683_100134150
211 Ga0068869_100156217
212 Ga0070709_10085909
213 Ga0070709_10091045
214 Ga0070714_100032495
215 Ga0070714_100263922
216 Ga0070714_100419080
217 Ga0070713_100000134
218 Ga0070713_100000441
219 Ga0070713_100040197
220 Ga0070713_100118563
221 Ga0070713_100372952
222 Ga0070710_10008124
223 Ga0070711_100000271
224 Ga0070708_100018576
225 Ga0070708_100027364
226 Ga0070708_100035029
227 Ga0070708_100053746
228 Ga0070708_100253985
229 Ga0070708_100428145
230 Ga0070708_100618322
231 Ga0070662_100423652
232 Ga0070706_100012428
233 Ga0070706_100031452
234 Ga0070707_100156588
235 Ga0070698_100041613
236 Ga0070699_100002709
237 Ga0070679_100009235
238 Ga0070697_100011265
239 Ga0070697_100039836
240 Ga0070697_100086761
241 Ga0068855_100192253
242 Ga0068856_100010172
243 Ga0068859_100001851
244 Ga0068864_100060510
245 Ga0068866_10003790
246 Ga0068863_100251663
247 Ga0068860_100018451
248 Ga0068860_100183327
249 Ga0068862_100468291
250 Ga0070717_10099431
251 Ga0070717_10130385
252 Ga0070715_10003006
253 Ga0070715_10006826
254 Ga0070715_10012101
255 Ga0070716_100003540
256 Ga0070716_100030626
257 Ga0070712_100000262
258 Ga0070712_100000618
259 Ga0070712_100002390
260 Ga0070712_100011797
261 Ga0075433_10201980
262 Ga0075434_100000242
263 Ga0097620_100001850
264 Ga0105240_10495442
265 Ga0105241_10345167
266 Ga0105237_10246828
267 Ga0105237_10516140
268 Ga0105238_10065612
269 Ga0105238_10441283
270 Ga0105246_10010563
271 Ga0157373_10097565
272 Ga0157373_10294373
273 Ga0157370_10144950
274 Ga0157369_10005867
275 Ga0157369_10015743
276 Ga0157374_10005580
277 Ga0157374_10008005
278 Ga0157378_10000680
279 Ga0157372_10024941
280 Ga0157372_10164570
281 Ga0157372_10529051
282 Ga0182008_10066660
283 Ga0182007_10021631
284 Ga0224569_100109
285 Ga0224571_100014
286 Ga0224572_1000176
287 Ga0224572_1022063
288 Ga0228598_1010652
289 Ga0207692_10002000
290 Ga0207647_10034850
291 Ga0207685_10003971
292 Ga0207685_10007955
293 Ga0207685_10082293
294 Ga0207699_10000209
295 Ga0207699_10055931
296 Ga0207699_10130744
297 Ga0207684_10020974
298 Ga0207707_10110913
299 Ga0207695_10211344
300 Ga0207693_10000026
301 Ga0207693_10000275
302 Ga0207693_10008118
303 Ga0207693_10018551
304 Ga0207693_10049654
305 Ga0207663_10004323
306 Ga0207663_10004728
307 Ga0207663_10022755
308 Ga0207652_10179608
309 Ga0207650_10067199
310 Ga0207700_10000111
311 Ga0207700_10002704
312 Ga0207700_10224561
313 Ga0207664_10065633
314 Ga0207664_10140028
315 Ga0207664_10195411
316 Ga0207706_10081611
317 Ga0207704_10036846
318 Ga0207665_10000358
319 Ga0207665_10036636
320 Ga0207665_10070031
321 Ga0207665_10118252
322 Ga0207689_10007004
323 Ga0207689_10157922
324 Ga0207658_10251147
325 Ga0207678_10485605
326 Ga0207641_10213152
327 Ga0207674_10000867
328 Ga0265356_1000478
329 Ga0268264_10103983
330 Ga0265326_10042345
331 Ga0265338_10004711
332 Ga0265338_10197186
333 Ga0265338_10318004
334 Ga0265762_1000119
335 Ga0265760_10014469
336 Ga0265760_10014810
337 Ga0265330_10010847
338 Ga0265325_10017529
339 Ga0265339_10012933
340 Ga0265339_10027092
341 Ga0265339_10059178
342 Ga0265339_10083235
343 Ga0265331_10041301
344 Ga0265316_10014157
345 Ga0265316_10223178
346 Ga0265316_10486940
347 Ga0307408_100277581
348 Ga0265314_10009668
349 Ga0265314_10041329
350 Ga0265314_10147303
351 Ga0307410_10030830
352 Ga0307406_10048137
353 Ga0307409_100012125
354 Ga0307409_100024575
355 Ga0307416_100108397
356 Ga0307414_10078262
357 Ga0307415_100012606
358 Ga0373926_0213164
359 Ga0373936_0000926
360 Ga0373945_0006173
361 Ga0373954_0097298
362 Ga0373943_0000008
363 Ga0373955_0033146
364 Ga0373955_0037087
365 Ga0373955_0056196
366 Ga0373931_0499004
367 Ga0373935_0009893
368 Ga0373927_0000102
369 Ga0373947_0007459
370 Ga0373947_0026776
371 Ga0373937_0045025
372 Ga0373937_0125733
373 Ga0373937_0236352
374 Ga0373925_0005430
375 Ga0373925_0027423
376 Ga0436364_0988102
377 Ga0436364_1531402
378 Ga0436360_0130742
379 Ga0436363_1035544
380 Ga0451576_0154394
381 Ga0466967_0002520
382 Ga0466967_0057583
383 Ga0466967_0062899
384 Ga0466967_0918035
385 Ga0495629_0018762
386 Ga0495580_0002140
387 Ga0495580_0012747
388 Ga0495580_0052874
389 Ga0495582_0001976
390 Ga0495608_0310303
391 Ga0495652_0294261
392 Ga0495587_0053780
393 Ga0495645_0097018
394 Ga0495645_0313814
395 Ga0495623_0131927
396 Ga0495623_0149380
397 Ga0495658_0007843
398 Ga0495674_0006305
399 Ga0495674_0031174
400 Ga0495676_0089810
401 Ga0495675_0023510
402 Ga0495602_0104320
403 Ga0495602_0360227
404 Ga0496100_0110769
405 Ga0496100_0139942
406 Ga0496102_0270517
407 Ga0496104_0211512
408 Ga0496105_0008491
409 Ga0496112_0106726
410 Ga0496114_0560244
411 Ga0496115_0039011
412 Ga0496115_0299838
413 Ga0501216_027903
414 Ga0501257_026672
415 nmdc:mga0n895_1177_c1
416 Ga0495601_0015532

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08713

DNA_alkylation

DNA alkylation repair enzyme

51

267

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b6c-assembly1.cif.gz_A predicted dna alkylation repair enzyme from enterococcus faecalis. 0.8882 22 213
5clc-assembly1.cif.gz_A alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog (9-mer b) 0.8624 1 212
5cl3-assembly1.cif.gz_A alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog (100% substrate at 4 hours) 0.8373 1 212
2b6c-assembly1.cif.gz_A predicted dna alkylation repair enzyme from enterococcus faecalis. 0.7957 22 213
5clc-assembly1.cif.gz_A alkylpurine dna glycosylase alkd bound to dna containing a 3-methyladenine analog (9-mer b) 0.788 1 212
ID Description Score Start End Superfamily
6m9mA02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;ARM repeat domains 0.8703 135 212 1.25.40.290
3l9tA02 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;ARM repeat domains 0.8703 135 212 1.25.40.290
5clcA00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant; 0.8624 1 212 1.25.10.90
af_A0A1D8PRI9_710_817_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8609 139 214 1.25.10.10
af_A0A1D6HPB1_249_353_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8562 137 213 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A2V9XVB8-F1-model_v4 DNA alkylation repair protein 0.9936 11 218
AF-A0A2V9VM43-F1-model_v4 DNA alkylation repair protein 0.9883 67 218
AF-A0A317HBF8-F1-model_v4 DNA alkylation repair protein 0.9841 4 218
AF-A0A1Q7LBG5-F1-model_v4 DNA alkylation repair protein 0.9834 1 216
AF-A0A2V9ZNJ0-F1-model_v4 DNA alkylation repair protein 0.9789 1 167

Map