F317719

General Info

Members Datasets Scaffolds Average Seq Length
208 152 208 321

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10000022|Ga0105245_1000002295
Length 352
Sequence MRRALARPIPVEAPVIKTDFTRARLTSLPMAETAFVTGGSGFIGGKLVQRLVGEGHAVRALARSDAAAERVAALGAEPVRGELGDPASLTAGADGAKVAFHLAAHLGEWGDXDDFERGNVVGTRNVLAACEEAGVGRFVHCGTEAALMAGEPLVQVDETAPLRPDSRAPYPATKAKAEQAVRAASREGFETVVLRPRFVWGKGDTTLLPEMVATVKAGRFAWVGGGTNITETTHVDNVVEGLLLAARKGRPGEAYFVTDGEPVAFREFVTAMLRTQGVEPPDRSLPAWTAAPMARFCEAAWKLLPLPGEPPMTAFRAWLLTQECTIDISKARSGLGYEPIIDHERGLAEMRI

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
75 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
90 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
100 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
103 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
104 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
107 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
120 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
123 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
124 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
132 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
133 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
134 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
144 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
145 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
150 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
152 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.58
Rhizosphere 87.5
Stem 0
Stem Tuber 0
Unclassified 1.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10196566 3300005327 Bacteria 1701
2 Ga0070676_10094375 3300005328 Bacteria 1838
3 Ga0070683_100001170 3300005329 Bacteria 19890
4 Ga0070677_10000020 3300005333 Bacteria 48941
5 Ga0070682_100000009 3300005337 Bacteria 291635
6 Ga0068868_100051778 3300005338 Bacteria 3231
7 Ga0070689_100005996 3300005340 Bacteria 8366
8 Ga0070691_10000003 3300005341 Bacteria 86538
9 Ga0070668_100010931 3300005347 Bacteria 6753
10 Ga0070713_100041980 3300005436 Bacteria 3730
11 Ga0070700_100014637 3300005441 Bacteria 4433
12 Ga0070700_100039594 3300005441 Bacteria 2880
13 Ga0070694_100101186 3300005444 Bacteria 2039
14 Ga0070662_100002091 3300005457 Bacteria 12243
15 Ga0070681_10004871 3300005458 Bacteria 12877
16 Ga0070679_100000134 3300005530 Bacteria 59591
17 Ga0070684_100001306 3300005535 Bacteria 17854
18 Ga0070665_100000022 3300005548 Bacteria 379286
19 Ga0070704_100102143 3300005549 Unclassified 2163
20 Ga0068854_100085987 3300005578 Bacteria 2330
21 Ga0068854_100168358 3300005578 Bacteria 1703
22 Ga0068854_100224177 3300005578 Bacteria 1489
23 Ga0068856_100055496 3300005614 Bacteria 3909
24 Ga0068864_100073882 3300005618 Bacteria 2974
25 Ga0068861_100003720 3300005719 Bacteria 10172
26 Ga0068863_100000291 3300005841 Bacteria 51978
27 Ga0068858_100000329 3300005842 Bacteria 50177
28 Ga0068858_100000763 3300005842 Bacteria 33724
29 Ga0081538_10000207 3300005981 Bacteria 65439
30 Ga0081538_10004815 3300005981 Bacteria 12303
31 Ga0068871_100084968 3300006358 Bacteria 2626
32 Ga0075430_100003555 3300006846 Bacteria 13056
33 Ga0075430_100013074 3300006846 Bacteria 7073
34 Ga0075430_100015207 3300006846 Bacteria 6552
35 Ga0075430_100080506 3300006846 Bacteria 2728
36 Ga0075430_100088138 3300006846 Bacteria 2597
37 Ga0075431_100050154 3300006847 Bacteria 4303
38 Ga0075431_100155394 3300006847 Archaea 2354
39 Ga0075433_10190817 3300006852 Bacteria 1823
40 Ga0075434_100274623 3300006871 Bacteria 1705
41 Ga0075429_100013578 3300006880 Bacteria 7063
42 Ga0075429_100038457 3300006880 Bacteria 4165
43 Ga0075429_100113262 3300006880 Bacteria 2371
44 Ga0075435_100031796 3300007076 Bacteria 4162
45 Ga0111539_10011886 3300009094 Bacteria 10912
46 Ga0111539_10473295 3300009094 Bacteria 1459
47 Ga0105245_10000022 3300009098 Bacteria 181225
48 Ga0105245_10004006 3300009098 Bacteria 13092
49 Ga0105245_10027672 3300009098 Bacteria 4995
50 Ga0105245_10048103 3300009098 Bacteria 3815
51 Ga0105247_10009731 3300009101 Bacteria 5830
52 Ga0114129_10014113 3300009147 Bacteria 11382
53 Ga0114129_10199930 3300009147 Bacteria 2708
54 Ga0114129_10353792 3300009147 Bacteria 1945
55 Ga0105243_10119798 3300009148 Bacteria 2217
56 Ga0105243_10130512 3300009148 Bacteria 2131
57 Ga0105242_10026514 3300009176 Bacteria 4594
58 Ga0105238_10000016 3300009551 Bacteria 236218
59 Ga0105249_10000054 3300009553 Bacteria 162883
60 Ga0105249_10007880 3300009553 Bacteria 9280
61 Ga0157371_10236466 3300013102 Bacteria 1313
62 Ga0163162_10037702 3300013306 Bacteria 4825
63 Ga0157372_10453973 3300013307 Bacteria 1494
64 Ga0163163_10291250 3300014325 Bacteria 1685
65 Ga0163163_10334177 3300014325 Bacteria 1570
66 Ga0157380_10322261 3300014326 Bacteria 1433
67 Ga0157379_10011255 3300014968 Bacteria 7793
68 Ga0213876_10177864 3300021384 Bacteria 1132
69 Ga0207682_10000050 3300025893 Bacteria 49908
70 Ga0207710_10054347 3300025900 Bacteria 1803
71 Ga0207645_10106616 3300025907 Bacteria 1812
72 Ga0207707_10004060 3300025912 Bacteria 12972
73 Ga0207662_10019185 3300025918 Bacteria 3887
74 Ga0207652_10002993 3300025921 Bacteria 14109
75 Ga0207694_10000012 3300025924 Bacteria 411218
76 Ga0207687_10001519 3300025927 Bacteria 15898
77 Ga0207687_10006762 3300025927 Bacteria 7554
78 Ga0207700_10032100 3300025928 Bacteria 3741
79 Ga0207664_10075696 3300025929 Bacteria 2722
80 Ga0207706_10001700 3300025933 Bacteria 21687
81 Ga0207670_10006130 3300025936 Bacteria 6649
82 Ga0207704_10056146 3300025938 Bacteria 2411
83 Ga0207689_10188207 3300025942 Bacteria 1703
84 Ga0207661_10000758 3300025944 Bacteria 21006
85 Ga0207712_10000032 3300025961 Bacteria 210628
86 Ga0207712_10039784 3300025961 Bacteria 3223
87 Ga0207640_10024101 3300025981 Bacteria 3666
88 Ga0207677_10035271 3300026023 Bacteria 3247
89 Ga0207703_10000070 3300026035 Bacteria 123480
90 Ga0207703_10000122 3300026035 Bacteria 92656
91 Ga0207708_10006062 3300026075 Bacteria 8964
92 Ga0207702_10033752 3300026078 Bacteria 4275
93 Ga0207641_10000252 3300026088 Bacteria 68086
94 Ga0207675_100002904 3300026118 Bacteria 16857
95 Ga0207698_10225439 3300026142 Bacteria 1697
96 Ga0207428_10314269 3300027907 Bacteria 1158
97 Ga0268266_10000029 3300028379 Bacteria 424015
98 Ga0265337_1000349 3300028556 Bacteria 24642
99 Ga0265326_10000132 3300028558 Bacteria 38517
100 Ga0265319_1000030 3300028563 Bacteria 129742
101 Ga0265322_10000012 3300028654 Bacteria 152373
102 Ga0265338_10000156 3300028800 Bacteria 125065
103 Ga0265324_10000466 3300029957 Bacteria 28483
104 Ga0265328_10001670 3300031239 Bacteria 10162
105 Ga0265320_10000001 3300031240 Bacteria 847191
106 Ga0265325_10019018 3300031241 Bacteria 3805
107 Ga0265331_10005078 3300031250 Bacteria 8040
108 Ga0265327_10000003 3300031251 Bacteria 852750
109 Ga0265314_10000334 3300031711 Bacteria 66204
110 Ga0265342_10084329 3300031712 Bacteria 1830
111 Ga0307411_10080837 3300032005 Bacteria 2236
112 Ga0307415_100180551 3300032126 Bacteria 1655
113 Ga0307507_10047518 3300033179 Bacteria 4190
114 Ga0373960_0019666 3300035121 Bacteria 1776
115 Ga0373931_0037124 3300035691 Bacteria 2543
116 Ga0373937_0520836 3300036401 Unclassified 1130
117 Ga0436365_1715285 3300039437 Bacteria 2530
118 Ga0451853_2068213 3300041512 Bacteria 2995
119 Ga0466969_0021426 3300044656 Bacteria 3342
120 Ga0466961_0005807 3300044693 Bacteria 7819
121 Ga0466963_0000961 3300044694 Bacteria 14791
122 Ga0466963_0001073 3300044694 Bacteria 14269
123 Ga0466963_0004185 3300044694 Bacteria 8355
124 Ga0466963_0093618 3300044694 Bacteria 2049
125 Ga0466970_0085235 3300044765 Unclassified 1711
126 Ga0466959_0001845 3300045049 Bacteria 13305
127 Ga0466958_0000216 3300045836 Bacteria 21669
128 Ga0466967_0320667 3300045976 Bacteria 1494
129 Ga0495592_0204517 3300046454 Bacteria 1330
130 Ga0495603_0000083 3300046455 Bacteria 42311
131 Ga0495641_0122108 3300046461 Unclassified 1162
132 Ga0495662_0087336 3300046476 Bacteria 1519
133 Ga0495662_0147674 3300046476 Bacteria 1158
134 Ga0495607_0177401 3300046501 Bacteria 1071
135 Ga0495620_0000782 3300046515 Bacteria 19484
136 Ga0495628_0255515 3300046516 Unclassified 1307
137 Ga0495628_0259599 3300046516 Bacteria 1295
138 Ga0495630_0000599 3300046517 Bacteria 26251
139 Ga0495630_0015829 3300046517 Bacteria 5511
140 Ga0495652_0055392 3300046529 Bacteria 3372
141 Ga0495652_0309590 3300046529 Bacteria 1145
142 Ga0495587_0023180 3300046536 Bacteria 3816
143 Ga0495645_0021713 3300046543 Bacteria 4640
144 Ga0495645_0044697 3300046543 Bacteria 3230
145 Ga0495667_0010192 3300046559 Bacteria 6361
146 Ga0495656_0000721 3300046615 Bacteria 10685
147 Ga0495634_0000021 3300046642 Bacteria 120521
148 Ga0495634_0001593 3300046642 Bacteria 19872
149 Ga0495634_0012621 3300046642 Bacteria 6115
150 Ga0495634_0162478 3300046642 Unclassified 1407
151 Ga0495647_0000002 3300046681 Bacteria 174959
152 Ga0495669_0000132 3300046684 Bacteria 47843
153 Ga0495649_0007489 3300046694 Bacteria 6645
154 Ga0495589_0029193 3300046794 Bacteria 2780
155 Ga0495600_0139763 3300046809 Bacteria 1572
156 Ga0495636_0010704 3300047318 Bacteria 3626
157 Ga0495676_0000089 3300047321 Bacteria 67896
158 Ga0495680_0000332 3300047322 Bacteria 52925
159 Ga0495615_0023284 3300048090 Bacteria 1418
160 Ga0496100_0000006 3300048903 Bacteria 297429
161 Ga0496101_0000009 3300048904 Bacteria 297429
162 Ga0496104_0000008 3300048907 Bacteria 516976
163 Ga0496105_0000003 3300048908 Bacteria 713251
164 Ga0496106_0000090 3300048909 Bacteria 72270
165 Ga0496107_0000015 3300048910 Bacteria 173644
166 Ga0496108_0000004 3300048911 Bacteria 545055
167 Ga0496108_0129992 3300048911 Bacteria 2165
168 Ga0496109_0000031 3300048912 Bacteria 163998
169 Ga0496109_0002968 3300048912 Bacteria 14188
170 Ga0496110_0012761 3300048913 Bacteria 6918
171 Ga0496110_0091369 3300048913 Bacteria 2723
172 Ga0496111_0148468 3300048914 Bacteria 1739
173 Ga0496111_0236948 3300048914 Bacteria 1355
174 Ga0496113_0019785 3300048916 Bacteria 4718
175 Ga0496113_0059676 3300048916 Bacteria 2874
176 Ga0496113_0214142 3300048916 Bacteria 1534
177 Ga0496114_0000159 3300048917 Bacteria 47728
178 Ga0496114_0002516 3300048917 Bacteria 14000
179 Ga0496115_0000257 3300048918 Bacteria 47123
180 Ga0496115_0044019 3300048918 Bacteria 3560
181 Ga0496115_0160015 3300048918 Bacteria 1861
182 Ga0501031_0251350 3300049568 Unclassified 1149
183 Ga0501033_0041056 3300049570 Bacteria 3453
184 Ga0501034_0168644 3300049571 Bacteria 2157
185 Ga0501040_0215408 3300049576 Bacteria 1366
186 Ga0501035_0000094 3300049822 Bacteria 111052
187 nmdc:mga05p37_201186_c1 3300050507 Bacteria 2412
188 nmdc:mga05p37_97932_c1 3300050507 Bacteria 3613
189 nmdc:mga09592_25208_c1 3300050508 Bacteria 4920
190 nmdc:mga09592_32100_c1 3300050508 Bacteria 4377
191 nmdc:mga09592_72264_c1 3300050508 Bacteria 2929
192 nmdc:mga0qj67_11027_c1 3300050509 Bacteria 6767
193 nmdc:mga0qj67_335159_c1 3300050509 Bacteria 1224
194 nmdc:mga06r32_201230_c1 3300050510 Archaea 1979
195 nmdc:mga06r32_2234_c1 3300050510 Bacteria 17338
196 nmdc:mga06r32_24313_c1 3300050510 Bacteria 5621
197 nmdc:mga08y16_46219_c1 3300050511 Bacteria 4558
198 nmdc:mga08y16_51943_c1 3300050511 Bacteria 4289
199 nmdc:mga0a205_225885_c1 3300050515 Bacteria 1757
200 Ga0495601_0000117 3300053077 Bacteria 43844
201 Ga0495601_0004310 3300053077 Bacteria 8216
202 Ga0495601_0154143 3300053077 Unclassified 1500
203 Ga0495612_0013543 3300053078 Bacteria 3284
204 Ga0495619_0002691 3300053085 Bacteria 11627
205 Ga0495619_0006180 3300053085 Bacteria 7590
206 Ga0495619_0072680 3300053085 Bacteria 2304
207 Ga0495619_0073261 3300053085 Bacteria 2295
208 Ga0501084_0382089 3300054114 Bacteria 1190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050507 nmdc:mga05p37_97932_c1 nmdc:mga05p37_97932_c1_2014_2880 265
2 3300005578 Ga0068854_100168358 Ga0068854_1001683582 271
3 3300005333 Ga0070677_10000020 Ga0070677_1000002030 273
4 3300006846 Ga0075430_100013074 Ga0075430_1000130748 273
5 3300025893 Ga0207682_10000050 Ga0207682_1000005018 273
6 3300048912 Ga0496109_0002968 Ga0496109_0002968_11415_12416 273
7 3300048916 Ga0496113_0059676 Ga0496113_0059676_1804_2805 273
8 3300048918 Ga0496115_0044019 Ga0496115_0044019_2394_3380 274
9 3300046476 Ga0495662_0147674 Ga0495662_0147674_14_901 276
10 3300005981 Ga0081538_10000207 Ga0081538_1000020756 277
11 3300032126 Ga0307415_100180551 Ga0307415_1001805512 278
12 3300048913 Ga0496110_0091369 Ga0496110_0091369_1782_2681 278
13 3300050508 nmdc:mga09592_32100_c1 nmdc:mga09592_32100_c1_3251_4156 278
14 3300046501 Ga0495607_0177401 Ga0495607_0177401_10_918 283
15 3300046529 Ga0495652_0309590 Ga0495652_0309590_111_1085 284
16 3300053078 Ga0495612_0013543 Ga0495612_0013543_852_1826 284
17 3300009101 Ga0105247_10009731 Ga0105247_100097315 286
18 3300025900 Ga0207710_10054347 Ga0207710_100543472 286
19 3300009551 Ga0105238_10000016 Ga0105238_1000001632 288
20 3300021384 Ga0213876_10177864 Ga0213876_101778642 288
21 3300025924 Ga0207694_10000012 Ga0207694_10000012389 288
22 3300032005 Ga0307411_10080837 Ga0307411_100808373 288
23 3300005340 Ga0070689_100005996 Ga0070689_1000059966 289
24 3300025936 Ga0207670_10006130 Ga0207670_100061302 289
25 3300005436 Ga0070713_100041980 Ga0070713_1000419802 291
26 3300025928 Ga0207700_10032100 Ga0207700_100321002 291
27 3300046516 Ga0495628_0259599 Ga0495628_0259599_175_1155 293
28 3300046529 Ga0495652_0055392 Ga0495652_0055392_2292_3272 293
29 3300046543 Ga0495645_0044697 Ga0495645_0044697_815_1795 293
30 3300045976 Ga0466967_0320667 Ga0466967_0320667_73_1017 295
31 3300046684 Ga0495669_0000132 Ga0495669_0000132_3959_4930 295
32 3300005328 Ga0070676_10094375 Ga0070676_100943752 296
33 3300005347 Ga0070668_100010931 Ga0070668_1000109313 296
34 3300005441 Ga0070700_100014637 Ga0070700_1000146372 296
35 3300005457 Ga0070662_100002091 Ga0070662_10000209111 296
36 3300005578 Ga0068854_100085987 Ga0068854_1000859872 296
37 3300005719 Ga0068861_100003720 Ga0068861_10000372011 296
38 3300009094 Ga0111539_10473295 Ga0111539_104732952 296
39 3300009098 Ga0105245_10004006 Ga0105245_100040066 296
40 3300009553 Ga0105249_10007880 Ga0105249_1000788010 296
41 3300013102 Ga0157371_10236466 Ga0157371_102364662 296
42 3300013306 Ga0163162_10037702 Ga0163162_100377025 296
43 3300025907 Ga0207645_10106616 Ga0207645_101066161 296
44 3300025927 Ga0207687_10006762 Ga0207687_100067623 296
45 3300025933 Ga0207706_10001700 Ga0207706_1000170011 296
46 3300025961 Ga0207712_10039784 Ga0207712_100397843 296
47 3300026075 Ga0207708_10006062 Ga0207708_100060622 296
48 3300026118 Ga0207675_100002904 Ga0207675_1000029042 296
49 3300026142 Ga0207698_10225439 Ga0207698_102254391 296
50 3300046809 Ga0495600_0139763 Ga0495600_0139763_188_1165 296
51 3300047321 Ga0495676_0000089 Ga0495676_0000089_56123_57121 297
52 3300005329 Ga0070683_100001170 Ga0070683_10000117017 298
53 3300005535 Ga0070684_100001306 Ga0070684_1000013062 298
54 3300025944 Ga0207661_10000758 Ga0207661_100007582 298
55 3300047322 Ga0495680_0000332 Ga0495680_0000332_27880_28851 298
56 3300048903 Ga0496100_0000006 Ga0496100_0000006_223364_224335 298
57 3300048904 Ga0496101_0000009 Ga0496101_0000009_223364_224335 298
58 3300048909 Ga0496106_0000090 Ga0496106_0000090_21812_22783 298
59 3300048910 Ga0496107_0000015 Ga0496107_0000015_119592_120563 298
60 3300054114 Ga0501084_0382089 Ga0501084_0382089_32_985 298
61 3300006846 Ga0075430_100088138 Ga0075430_1000881382 299
62 3300006880 Ga0075429_100038457 Ga0075429_1000384573 299
63 3300006880 Ga0075429_100113262 Ga0075429_1001132622 299
64 3300014968 Ga0157379_10011255 Ga0157379_100112556 299
65 3300049571 Ga0501034_0168644 Ga0501034_0168644_1086_2042 299
66 3300050508 nmdc:mga09592_25208_c1 nmdc:mga09592_25208_c1_3188_4138 299
67 3300050508 nmdc:mga09592_72264_c1 nmdc:mga09592_72264_c1_658_1608 299
68 3300050509 nmdc:mga0qj67_335159_c1 nmdc:mga0qj67_335159_c1_23_973 299
69 3300006852 Ga0075433_10190817 Ga0075433_101908171 300
70 3300009094 Ga0111539_10011886 Ga0111539_1001188610 300
71 3300009147 Ga0114129_10199930 Ga0114129_101999302 300
72 3300009553 Ga0105249_10000054 Ga0105249_10000054153 300
73 3300035121 Ga0373960_0019666 Ga0373960_0019666_276_1241 300
74 3300035691 Ga0373931_0037124 Ga0373931_0037124_348_1313 300
75 3300050507 nmdc:mga05p37_201186_c1 nmdc:mga05p37_201186_c1_158_1123 300
76 3300050511 nmdc:mga08y16_46219_c1 nmdc:mga08y16_46219_c1_1207_2172 300
77 3300050515 nmdc:mga0a205_225885_c1 nmdc:mga0a205_225885_c1_124_1089 300
78 3300006846 Ga0075430_100015207 Ga0075430_1000152077 301
79 3300006847 Ga0075431_100155394 Ga0075431_1001553944 301
80 3300049568 Ga0501031_0251350 Ga0501031_0251350_129_1097 301
81 3300050510 nmdc:mga06r32_201230_c1 nmdc:mga06r32_201230_c1_100_1170 301
82 3300046536 Ga0495587_0023180 Ga0495587_0023180_1754_2731 302
83 3300047318 Ga0495636_0010704 Ga0495636_0010704_248_1216 302
84 3300048090 Ga0495615_0023284 Ga0495615_0023284_149_1117 302
85 3300005841 Ga0068863_100000291 Ga0068863_1000002912 303
86 3300014325 Ga0163163_10291250 Ga0163163_102912502 303
87 3300026088 Ga0207641_10000252 Ga0207641_1000025253 303
88 3300005338 Ga0068868_100051778 Ga0068868_1000517782 304
89 3300005458 Ga0070681_10004871 Ga0070681_100048716 304
90 3300005530 Ga0070679_100000134 Ga0070679_10000013433 304
91 3300005548 Ga0070665_100000022 Ga0070665_100000022302 304
92 3300005578 Ga0068854_100224177 Ga0068854_1002241772 304
93 3300005614 Ga0068856_100055496 Ga0068856_1000554962 304
94 3300005618 Ga0068864_100073882 Ga0068864_1000738823 304
95 3300005842 Ga0068858_100000763 Ga0068858_1000007636 304
96 3300006358 Ga0068871_100084968 Ga0068871_1000849682 304
97 3300006846 Ga0075430_100080506 Ga0075430_1000805063 304
98 3300006847 Ga0075431_100050154 Ga0075431_1000501543 304
99 3300009098 Ga0105245_10027672 Ga0105245_100276726 304
100 3300009148 Ga0105243_10130512 Ga0105243_101305123 304
101 3300014325 Ga0163163_10334177 Ga0163163_103341771 304
102 3300014326 Ga0157380_10322261 Ga0157380_103222611 304
103 3300025912 Ga0207707_10004060 Ga0207707_100040608 304
104 3300025918 Ga0207662_10019185 Ga0207662_100191853 304
105 3300025921 Ga0207652_10002993 Ga0207652_100029939 304
106 3300025927 Ga0207687_10001519 Ga0207687_100015192 304
107 3300025929 Ga0207664_10075696 Ga0207664_100756963 304
108 3300025938 Ga0207704_10056146 Ga0207704_100561462 304
109 3300025942 Ga0207689_10188207 Ga0207689_101882071 304
110 3300025961 Ga0207712_10000032 Ga0207712_1000003212 304
111 3300025981 Ga0207640_10024101 Ga0207640_100241014 304
112 3300026023 Ga0207677_10035271 Ga0207677_100352712 304
113 3300026035 Ga0207703_10000070 Ga0207703_1000007061 304
114 3300026078 Ga0207702_10033752 Ga0207702_100337523 304
115 3300028379 Ga0268266_10000029 Ga0268266_10000029152 304
116 3300028556 Ga0265337_1000349 Ga0265337_100034912 304
117 3300028558 Ga0265326_10000132 Ga0265326_1000013221 304
118 3300028654 Ga0265322_10000012 Ga0265322_10000012141 304
119 3300029957 Ga0265324_10000466 Ga0265324_1000046622 304
120 3300031239 Ga0265328_10001670 Ga0265328_100016705 304
121 3300031240 Ga0265320_10000001 Ga0265320_10000001839 304
122 3300031250 Ga0265331_10005078 Ga0265331_100050784 304
123 3300031251 Ga0265327_10000003 Ga0265327_10000003839 304
124 3300031711 Ga0265314_10000334 Ga0265314_1000033421 304
125 3300041512 Ga0451853_2068213 Ga0451853_2068213_1016_1987 304
126 3300046515 Ga0495620_0000782 Ga0495620_0000782_18177_19148 304
127 3300046517 Ga0495630_0015829 Ga0495630_0015829_2726_3697 304
128 3300046642 Ga0495634_0001593 Ga0495634_0001593_12280_13251 304
129 3300046642 Ga0495634_0012621 Ga0495634_0012621_5015_5986 304
130 3300046694 Ga0495649_0007489 Ga0495649_0007489_1163_2134 304
131 3300048907 Ga0496104_0000008 Ga0496104_0000008_412375_413346 304
132 3300048908 Ga0496105_0000003 Ga0496105_0000003_412375_413346 304
133 3300048911 Ga0496108_0129992 Ga0496108_0129992_475_1446 304
134 3300048914 Ga0496111_0148468 Ga0496111_0148468_281_1252 304
135 3300048916 Ga0496113_0019785 Ga0496113_0019785_292_1263 304
136 3300048917 Ga0496114_0002516 Ga0496114_0002516_2025_2996 304
137 3300049822 Ga0501035_0000094 Ga0501035_0000094_16881_17876 304
138 3300050510 nmdc:mga06r32_24313_c1 nmdc:mga06r32_24313_c1_835_1809 304
139 3300053077 Ga0495601_0000117 Ga0495601_0000117_17267_18238 304
140 3300053085 Ga0495619_0072680 Ga0495619_0072680_1162_2133 304
141 3300005341 Ga0070691_10000003 Ga0070691_1000000329 305
142 3300006846 Ga0075430_100003555 Ga0075430_1000035555 305
143 3300006871 Ga0075434_100274623 Ga0075434_1002746232 305
144 3300007076 Ga0075435_100031796 Ga0075435_1000317965 305
145 3300009147 Ga0114129_10353792 Ga0114129_103537922 305
146 3300027907 Ga0207428_10314269 Ga0207428_103142691 305
147 3300028563 Ga0265319_1000030 Ga0265319_1000030113 305
148 3300028800 Ga0265338_10000156 Ga0265338_10000156112 305
149 3300031241 Ga0265325_10019018 Ga0265325_100190184 305
150 3300031712 Ga0265342_10084329 Ga0265342_100843292 305
151 3300033179 Ga0307507_10047518 Ga0307507_100475185 305
152 3300039437 Ga0436365_1715285 Ga0436365_1715285_849_1829 305
153 3300044656 Ga0466969_0021426 Ga0466969_0021426_2185_3165 305
154 3300044693 Ga0466961_0005807 Ga0466961_0005807_1998_2978 305
155 3300044694 Ga0466963_0000961 Ga0466963_0000961_2544_3524 305
156 3300044694 Ga0466963_0004185 Ga0466963_0004185_2299_3297 305
157 3300044694 Ga0466963_0093618 Ga0466963_0093618_737_1735 305
158 3300044765 Ga0466970_0085235 Ga0466970_0085235_37_1017 305
159 3300045049 Ga0466959_0001845 Ga0466959_0001845_8787_9767 305
160 3300045836 Ga0466958_0000216 Ga0466958_0000216_5093_6073 305
161 3300046516 Ga0495628_0255515 Ga0495628_0255515_224_1198 305
162 3300046517 Ga0495630_0000599 Ga0495630_0000599_23439_24413 305
163 3300046559 Ga0495667_0010192 Ga0495667_0010192_2421_3407 305
164 3300046642 Ga0495634_0000021 Ga0495634_0000021_32419_33393 305
165 3300046642 Ga0495634_0162478 Ga0495634_0162478_372_1346 305
166 3300046794 Ga0495589_0029193 Ga0495589_0029193_1180_2112 305
167 3300048913 Ga0496110_0012761 Ga0496110_0012761_1200_2174 305
168 3300048914 Ga0496111_0236948 Ga0496111_0236948_303_1277 305
169 3300048916 Ga0496113_0214142 Ga0496113_0214142_15_989 305
170 3300048917 Ga0496114_0000159 Ga0496114_0000159_7466_8452 305
171 3300048918 Ga0496115_0000257 Ga0496115_0000257_7466_8452 305
172 3300048918 Ga0496115_0160015 Ga0496115_0160015_665_1639 305
173 3300049570 Ga0501033_0041056 Ga0501033_0041056_120_1052 305
174 3300050509 nmdc:mga0qj67_11027_c1 nmdc:mga0qj67_11027_c1_4330_5313 305
175 3300050510 nmdc:mga06r32_2234_c1 nmdc:mga06r32_2234_c1_12939_13922 305
176 3300050511 nmdc:mga08y16_51943_c1 nmdc:mga08y16_51943_c1_1125_2165 305
177 3300053077 Ga0495601_0004310 Ga0495601_0004310_5046_6020 305
178 3300053077 Ga0495601_0154143 Ga0495601_0154143_119_1093 305
179 3300053085 Ga0495619_0006180 Ga0495619_0006180_3834_4808 305
180 3300005441 Ga0070700_100039594 Ga0070700_1000395942 306
181 3300005842 Ga0068858_100000329 Ga0068858_10000032922 306
182 3300009176 Ga0105242_10026514 Ga0105242_100265143 306
183 3300026035 Ga0207703_10000122 Ga0207703_100001229 306
184 3300036401 Ga0373937_0520836 Ga0373937_0520836_64_1053 306
185 3300044694 Ga0466963_0001073 Ga0466963_0001073_12515_13513 306
186 3300046454 Ga0495592_0204517 Ga0495592_0204517_19_999 306
187 3300046455 Ga0495603_0000083 Ga0495603_0000083_22841_23830 306
188 3300046461 Ga0495641_0122108 Ga0495641_0122108_151_1131 306
189 3300046543 Ga0495645_0021713 Ga0495645_0021713_2001_2993 306
190 3300046615 Ga0495656_0000721 Ga0495656_0000721_3233_4210 306
191 3300046681 Ga0495647_0000002 Ga0495647_0000002_63713_64693 306
192 3300048911 Ga0496108_0000004 Ga0496108_0000004_157947_158927 306
193 3300048912 Ga0496109_0000031 Ga0496109_0000031_4101_5081 306
194 3300049576 Ga0501040_0215408 Ga0501040_0215408_236_1225 306
195 3300053085 Ga0495619_0073261 Ga0495619_0073261_982_1971 306
196 3300013307 Ga0157372_10453973 Ga0157372_104539732 307
197 3300053085 Ga0495619_0002691 Ga0495619_0002691_1036_2016 307
198 3300005337 Ga0070682_100000009 Ga0070682_100000009198 308
199 3300009098 Ga0105245_10000022 Ga0105245_1000002295 308
200 3300046476 Ga0495662_0087336 Ga0495662_0087336_519_1502 308
201 3300005327 Ga0070658_10196566 Ga0070658_101965662 310
202 3300005444 Ga0070694_100101186 Ga0070694_1001011863 310
203 3300005549 Ga0070704_100102143 Ga0070704_1001021431 310
204 3300005981 Ga0081538_10004815 Ga0081538_100048155 310
205 3300006880 Ga0075429_100013578 Ga0075429_1000135786 310
206 3300009098 Ga0105245_10048103 Ga0105245_100481033 310
207 3300009147 Ga0114129_10014113 Ga0114129_100141135 310
208 3300009148 Ga0105243_10119798 Ga0105243_101197982 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

35

287

0.93

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

34

258

0.89

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

35

285

0.86

PF05368

NmrA

NmrA-like family

34

237

0.84

PF07993

NAD_binding_4

Male sterility protein

67

240

0.84

PF04321

RmlD_sub_bind

RmlD substrate binding domain

32

292

0.82

PF13460

NAD_binding_10

NAD(P)H-binding

38

214

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ic5-assembly2.cif.gz_B n-terminal domain of putative saccharopine dehydrogenase from ruegeria pomeroyi. 0.865 5 110
6s2j-assembly1.cif.gz_A square conformation of ktra r16k mutant ring with bound atp 0.8625 7 117
6rfq-assembly1.cif.gz_E cryo-em structure of a respiratory complex i assembly intermediate with ndufaf2 0.862 7 245
3m2p-assembly3.cif.gz_E the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8592 7 308
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8436 7 308
ID Description Score Start End Superfamily
af_Q54L85_1_328_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9492 6 305 3.40.50.720
af_Q54L85_1_328_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9166 6 305 3.40.50.720
af_Q6ZHP8_7_375_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9129 7 309 3.40.50.720
af_A4HSS6_18_376_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8907 5 309 3.40.50.720
af_Q6ZHP8_7_375_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8904 7 309 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6G6W8M3-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9974 6 309 GO:0004029
GO:0005737
AF-A0A6G6W8M3-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9876 6 309 GO:0004029
GO:0005737
AF-A7A6N3-F1-model_v4 NAD dependent epimerase/dehydratase family protein 0.9699 6 137 GO:0004029
GO:0005737
AF-A0A7V8XK22-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9686 6 264 GO:0004029
GO:0005737
GO:0006694
GO:0016616
AF-A0A1E4PJ61-F1-model_v4 deleted 0.968 5 137

Feature Viewer

pLDDT pTM Quality
94.87 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map