F317590

General Info

Members Datasets Scaffolds Average Seq Length
208 153 416 129

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10058522|Ga0081455_100585226
Length 114
Sequence VIEFRIDPNSGVPSYRQIVHQVRQALHLGLLHEGDQLPTVKDVVGQVAGLAAGRPGLGTFVTRSLVDESLAAHKGLRTELVRWLSKARRAGLDDGSILALFESTFHASSNEGVA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
53 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
54 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
74 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
75 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
76 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
88 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
89 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
90 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
91 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
92 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
93 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
94 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
124 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
129 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
130 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
135 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
136 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
137 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
138 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
139 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
140 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
141 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
142 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
143 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
144 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
145 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
146 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
147 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
148 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
151 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
152 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
153 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.56
Nodule 0
Rhizoplane 0.48
Rhizosphere 65.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10058522 3300005937 Bacteria 3260
2 JGI25407J50210_10042803 3300003373 Bacteria 1158
3 Ga0070658_10921018 3300005327 Bacteria 760
4 Ga0070683_100515532 3300005329 Bacteria 1143
5 Ga0068869_100200561 3300005334 Bacteria 1573
6 Ga0070692_10159395 3300005345 Bacteria 1291
7 Ga0070659_100540289 3300005366 Bacteria 997
8 Ga0070659_101748100 3300005366 Bacteria 557
9 Ga0070714_100066992 3300005435 Bacteria 3095
10 Ga0070700_101560091 3300005441 Bacteria 563
11 Ga0070708_100072433 3300005445 Bacteria 3105
12 Ga0070706_100083897 3300005467 Bacteria 2952
13 Ga0070706_100083926 3300005467 Bacteria 2952
14 Ga0070706_100265396 3300005467 Bacteria 1602
15 Ga0070707_100003785 3300005468 Bacteria 14274
16 Ga0070707_100023752 3300005468 Bacteria 5798
17 Ga0070707_100035620 3300005468 Bacteria 4748
18 Ga0070698_100078364 3300005471 Bacteria 3303
19 Ga0070699_101763858 3300005518 Bacteria 567
20 Ga0070684_100605645 3300005535 Bacteria 1019
21 Ga0070696_100227608 3300005546 Bacteria 1402
22 Ga0070704_101500916 3300005549 Bacteria 620
23 Ga0068857_100722822 3300005577 Bacteria 947
24 Ga0068856_100437051 3300005614 Bacteria 1329
25 Ga0068859_100835894 3300005617 Bacteria 1007
26 Ga0068864_100164025 3300005618 Bacteria 2022
27 Ga0068858_101128660 3300005842 Bacteria 770
28 Ga0068862_100406231 3300005844 Bacteria 1275
29 Ga0081455_10354842 3300005937 Bacteria 1033
30 Ga0081539_10057330 3300005985 Bacteria 2156
31 Ga0075365_10014804 3300006038 Bacteria 4701
32 Ga0075365_10016923 3300006038 Bacteria 4450
33 Ga0075365_10033622 3300006038 Bacteria 3306
34 Ga0075365_10046030 3300006038 Bacteria 2864
35 Ga0075365_10159659 3300006038 Bacteria 1570
36 Ga0075365_10507625 3300006038 Bacteria 852
37 Ga0075368_10012819 3300006042 Bacteria 3071
38 Ga0075363_100493469 3300006048 Bacteria 726
39 Ga0075363_101053566 3300006048 Bacteria 503
40 Ga0075364_10130835 3300006051 Bacteria 1684
41 Ga0070716_100099115 3300006173 Bacteria 1782
42 Ga0075362_10010148 3300006177 Bacteria 3669
43 Ga0075367_10008972 3300006178 Bacteria 5206
44 Ga0097621_101435266 3300006237 Bacteria 654
45 Ga0075370_10000475 3300006353 Bacteria 15085
46 Ga0075370_10177064 3300006353 Bacteria 1255
47 Ga0075370_10827082 3300006353 Bacteria 565
48 Ga0075431_100342153 3300006847 Bacteria 1505
49 Ga0075431_100495156 3300006847 Bacteria 1214
50 Ga0075436_100253742 3300006914 Bacteria 1253
51 Ga0097620_100835953 3300006931 Bacteria 1007
52 Ga0099794_10103904 3300007265 Bacteria 1419
53 Ga0111539_11400528 3300009094 Bacteria 811
54 Ga0114129_10161330 3300009147 Bacteria 3062
55 Ga0105248_10331004 3300009177 Bacteria 1715
56 Ga0105237_10112100 3300009545 Bacteria 2720
57 Ga0105239_11450278 3300010375 Bacteria 793
58 Ga0105239_11527164 3300010375 Bacteria 772
59 Ga0157371_10316966 3300013102 Bacteria 1131
60 Ga0157371_10683403 3300013102 Bacteria 767
61 Ga0157369_10069437 3300013105 Bacteria 3785
62 Ga0157369_10313007 3300013105 Bacteria 1632
63 Ga0157374_12131177 3300013296 Bacteria 587
64 Ga0157372_11668528 3300013307 Bacteria 733
65 Ga0157375_10488136 3300013308 Bacteria 1396
66 Ga0157375_11266798 3300013308 Bacteria 866
67 Ga0163163_10248062 3300014325 Bacteria 1831
68 Ga0163163_10590050 3300014325 Bacteria 1174
69 Ga0157380_11115481 3300014326 Bacteria 828
70 Ga0157380_13136997 3300014326 Bacteria 527
71 Ga0157379_10981953 3300014968 Bacteria 804
72 Ga0157379_12105505 3300014968 Bacteria 559
73 Ga0182006_1273996 3300015261 Bacteria 553
74 Ga0224571_114707 3300022734 Bacteria 560
75 Ga0224572_1006021 3300024225 Bacteria 2181
76 Ga0207643_10225845 3300025908 Bacteria 1147
77 Ga0207705_10753797 3300025909 Bacteria 756
78 Ga0207684_10051296 3300025910 Bacteria 3500
79 Ga0207684_10525954 3300025910 Bacteria 1013
80 Ga0207684_10565620 3300025910 Bacteria 972
81 Ga0207646_10022995 3300025922 Bacteria 5732
82 Ga0207646_10042059 3300025922 Bacteria 4106
83 Ga0207646_10292315 3300025922 Bacteria 1472
84 Ga0207646_10627258 3300025922 Bacteria 964
85 Ga0207659_10851610 3300025926 Bacteria 784
86 Ga0207664_10290097 3300025929 Bacteria 1438
87 Ga0207670_10442877 3300025936 Bacteria 1046
88 Ga0207665_10221558 3300025939 Bacteria 1386
89 Ga0207689_10187898 3300025942 Bacteria 1704
90 Ga0207677_12092335 3300026023 Bacteria 526
91 Ga0207708_10521570 3300026075 Bacteria 998
92 Ga0207708_10751892 3300026075 Bacteria 837
93 Ga0207702_10959882 3300026078 Bacteria 848
94 Ga0207674_10186901 3300026116 Bacteria 2022
95 Ga0207674_10304831 3300026116 Bacteria 1542
96 Ga0207675_100181199 3300026118 Bacteria 2017
97 Ga0207675_101656447 3300026118 Bacteria 660
98 Ga0209813_10036997 3300027866 Bacteria 1469
99 Ga0307517_10180919 3300028786 Bacteria 1361
100 Ga0307517_10197800 3300028786 Bacteria 1262
101 Ga0307517_10213167 3300028786 Bacteria 1186
102 Ga0307515_10032992 3300028794 Bacteria 8547
103 Ga0307515_10090016 3300028794 Bacteria 3854
104 Ga0307515_10187406 3300028794 Bacteria 1993
105 Ga0307512_10001742 3300030522 Bacteria 29690
106 Ga0307512_10005070 3300030522 Bacteria 13999
107 Ga0307513_10009283 3300031456 Bacteria 12456
108 Ga0307513_10732947 3300031456 Bacteria 694
109 Ga0307513_10810542 3300031456 Bacteria 642
110 Ga0307508_10034034 3300031616 Bacteria 4594
111 Ga0307508_10782266 3300031616 Bacteria 570
112 Ga0307516_10060400 3300031730 Bacteria 3683
113 Ga0307516_10394027 3300031730 Bacteria 1045
114 Ga0307405_10427853 3300031731 Bacteria 1044
115 Ga0307413_10503937 3300031824 Bacteria 973
116 Ga0307406_11322887 3300031901 Bacteria 629
117 Ga0307416_100515433 3300032002 Bacteria 1263
118 Ga0307411_10666110 3300032005 Bacteria 903
119 Ga0307415_101033327 3300032126 Bacteria 766
120 Ga0307507_10461333 3300033179 Bacteria 698
121 Ga0307510_10076367 3300033180 Bacteria 3296
122 Ga0373943_0340146 3300035170 Bacteria 858
123 Ga0395900_0104334 3300037418 Bacteria 2912
124 Ga0395900_0372658 3300037418 Bacteria 1397
125 Ga0395898_0186719 3300037466 Bacteria 1981
126 Ga0395905_1444151 3300037471 Bacteria 592
127 Ga0451795_0862132 3300041456 Bacteria 629
128 Ga0451833_0359028 3300041491 Bacteria 686
129 Ga0451837_1284865 3300041494 Bacteria 2468
130 Ga0451839_0186024 3300041496 Bacteria 644
131 Ga0451853_0028930 3300041512 Bacteria 9586
132 Ga0439450_143844 3300042008 Bacteria 623
133 Ga0439463_009588 3300042016 Bacteria 2382
134 Ga0439459_0041556 3300042438 Bacteria 979
135 Ga0466965_0013001 3300044683 Bacteria 3922
136 Ga0466958_1123580 3300045836 Bacteria 513
137 Ga0466967_0049793 3300045976 Bacteria 3666
138 Ga0466967_1387654 3300045976 Bacteria 700
139 Ga0495629_0048351 3300046459 Bacteria 2982
140 Ga0495651_0138786 3300046462 Bacteria 1766
141 Ga0495653_0147892 3300046463 Bacteria 1644
142 Ga0495639_0645224 3300046475 Bacteria 545
143 Ga0495662_0182119 3300046476 Bacteria 1035
144 Ga0495664_0633582 3300046477 Bacteria 634
145 Ga0495584_0507932 3300046491 Bacteria 614
146 Ga0495585_0414010 3300046492 Bacteria 648
147 Ga0495594_0322851 3300046499 Bacteria 879
148 Ga0495594_0456575 3300046499 Bacteria 726
149 Ga0495628_0298762 3300046516 Bacteria 1192
150 Ga0495632_0316183 3300046519 Bacteria 690
151 Ga0495648_0030458 3300046524 Bacteria 3567
152 Ga0495652_0050234 3300046529 Bacteria 3566
153 Ga0495586_0127681 3300046535 Bacteria 1423
154 Ga0495645_0173639 3300046543 Bacteria 1482
155 Ga0495611_0111115 3300046648 Bacteria 1276
156 Ga0495646_0637813 3300046680 Bacteria 539
157 Ga0495647_0502088 3300046681 Bacteria 565
158 Ga0495613_0044544 3300046689 Bacteria 3282
159 Ga0495613_0109635 3300046689 Bacteria 1990
160 Ga0495613_0667101 3300046689 Bacteria 687
161 Ga0495624_0044640 3300046690 Bacteria 2825
162 Ga0495674_0583432 3300047319 Bacteria 887
163 Ga0495674_0871730 3300047319 Bacteria 696
164 Ga0495676_0316223 3300047321 Bacteria 1050
165 Ga0495680_0101675 3300047322 Bacteria 2141
166 Ga0495685_081487 3300047447 Bacteria 1077
167 Ga0501080_0115006 3300049742 Bacteria 2495
168 nmdc:mga03683_5897_c1 3300050489 Bacteria 2392
169 nmdc:mga03n38_353917_c1 3300050490 Bacteria 800
170 nmdc:mga03n38_969523_c1 3300050490 Bacteria 503
171 nmdc:mga00v17_133201_c1 3300050491 Bacteria 1590
172 nmdc:mga00v17_255641_c1 3300050491 Bacteria 1136
173 nmdc:mga00v17_90790_c1 3300050491 Bacteria 1918
174 nmdc:mga0yw44_122806_c1 3300050492 Bacteria 1674
175 nmdc:mga0yw44_130469_c1 3300050492 Bacteria 1627
176 nmdc:mga0yw44_4224_c1 3300050492 Bacteria 6542
177 nmdc:mga0yw44_51877_c1 3300050492 Bacteria 2485
178 nmdc:mga0yw44_521013_c1 3300050492 Bacteria 807
179 nmdc:mga06z11_311256_c1 3300050494 Bacteria 938
180 nmdc:mga06z11_332287_c1 3300050494 Bacteria 908
181 nmdc:mga04h51_44048_c1 3300050495 Bacteria 1470
182 nmdc:mga07m45_13133_c1 3300050496 Bacteria 4386
183 nmdc:mga07m45_192294_c1 3300050496 Bacteria 1187
184 nmdc:mga05p37_818454_c1 3300050507 Bacteria 1016
185 nmdc:mga06r32_1485107_c1 3300050510 Bacteria 618
186 nmdc:mga08y16_7300_c1 3300050511 Bacteria 11597
187 nmdc:mga0rr50_688734_c1 3300050513 Bacteria 872
188 Ga0495601_0025286 3300053077 Bacteria 3661
189 Ga0495595_0122275 3300053084 Bacteria 1268
190 Ga0500578_0006866 3300053086 Bacteria 7554
191 Ga0500583_0411608 3300053092 Bacteria 647
192 Ga0500651_0559771 3300053093 Bacteria 624
193 Ga0500566_0259490 3300053094 Bacteria 840
194 Ga0500553_018407 3300053101 Bacteria 3539
195 Ga0500562_168578 3300053108 Bacteria 595
196 Ga0500569_066013 3300053109 Bacteria 1128
197 Ga0500594_0189274 3300053118 Bacteria 673
198 Ga0500621_296547 3300053126 Bacteria 519
199 Ga0500573_0133103 3300053140 Bacteria 1375
200 Ga0500579_133429 3300053143 Bacteria 1151
201 Ga0500600_0142912 3300053149 Bacteria 1202
202 Ga0500600_0179219 3300053149 Bacteria 1021
203 Ga0500603_150994 3300053150 Bacteria 720
204 Ga0500616_0007079 3300053153 Bacteria 7195
205 Ga0500633_0305818 3300053160 Bacteria 584
206 Ga0500634_0101469 3300053161 Bacteria 1439
207 2731906440 2731639228 Bacteria 4187555
208 2799186451 2799112218 Bacteria 4315149
209 Ga0081455_10058522
210 JGI25407J50210_10042803
211 Ga0070658_10921018
212 Ga0070683_100515532
213 Ga0068869_100200561
214 Ga0070692_10159395
215 Ga0070659_100540289
216 Ga0070659_101748100
217 Ga0070714_100066992
218 Ga0070700_101560091
219 Ga0070708_100072433
220 Ga0070706_100083897
221 Ga0070706_100083926
222 Ga0070706_100265396
223 Ga0070707_100003785
224 Ga0070707_100023752
225 Ga0070707_100035620
226 Ga0070698_100078364
227 Ga0070699_101763858
228 Ga0070684_100605645
229 Ga0070696_100227608
230 Ga0070704_101500916
231 Ga0068857_100722822
232 Ga0068856_100437051
233 Ga0068859_100835894
234 Ga0068864_100164025
235 Ga0068858_101128660
236 Ga0068862_100406231
237 Ga0081455_10354842
238 Ga0081539_10057330
239 Ga0075365_10014804
240 Ga0075365_10016923
241 Ga0075365_10033622
242 Ga0075365_10046030
243 Ga0075365_10159659
244 Ga0075365_10507625
245 Ga0075368_10012819
246 Ga0075363_100493469
247 Ga0075363_101053566
248 Ga0075364_10130835
249 Ga0070716_100099115
250 Ga0075362_10010148
251 Ga0075367_10008972
252 Ga0097621_101435266
253 Ga0075370_10000475
254 Ga0075370_10177064
255 Ga0075370_10827082
256 Ga0075431_100342153
257 Ga0075431_100495156
258 Ga0075436_100253742
259 Ga0097620_100835953
260 Ga0099794_10103904
261 Ga0111539_11400528
262 Ga0114129_10161330
263 Ga0105248_10331004
264 Ga0105237_10112100
265 Ga0105239_11450278
266 Ga0105239_11527164
267 Ga0157371_10316966
268 Ga0157371_10683403
269 Ga0157369_10069437
270 Ga0157369_10313007
271 Ga0157374_12131177
272 Ga0157372_11668528
273 Ga0157375_10488136
274 Ga0157375_11266798
275 Ga0163163_10248062
276 Ga0163163_10590050
277 Ga0157380_11115481
278 Ga0157380_13136997
279 Ga0157379_10981953
280 Ga0157379_12105505
281 Ga0182006_1273996
282 Ga0224571_114707
283 Ga0224572_1006021
284 Ga0207643_10225845
285 Ga0207705_10753797
286 Ga0207684_10051296
287 Ga0207684_10525954
288 Ga0207684_10565620
289 Ga0207646_10022995
290 Ga0207646_10042059
291 Ga0207646_10292315
292 Ga0207646_10627258
293 Ga0207659_10851610
294 Ga0207664_10290097
295 Ga0207670_10442877
296 Ga0207665_10221558
297 Ga0207689_10187898
298 Ga0207677_12092335
299 Ga0207708_10521570
300 Ga0207708_10751892
301 Ga0207702_10959882
302 Ga0207674_10186901
303 Ga0207674_10304831
304 Ga0207675_100181199
305 Ga0207675_101656447
306 Ga0209813_10036997
307 Ga0307517_10180919
308 Ga0307517_10197800
309 Ga0307517_10213167
310 Ga0307515_10032992
311 Ga0307515_10090016
312 Ga0307515_10187406
313 Ga0307512_10001742
314 Ga0307512_10005070
315 Ga0307513_10009283
316 Ga0307513_10732947
317 Ga0307513_10810542
318 Ga0307508_10034034
319 Ga0307508_10782266
320 Ga0307516_10060400
321 Ga0307516_10394027
322 Ga0307405_10427853
323 Ga0307413_10503937
324 Ga0307406_11322887
325 Ga0307416_100515433
326 Ga0307411_10666110
327 Ga0307415_101033327
328 Ga0307507_10461333
329 Ga0307510_10076367
330 Ga0373943_0340146
331 Ga0395900_0104334
332 Ga0395900_0372658
333 Ga0395898_0186719
334 Ga0395905_1444151
335 Ga0451795_0862132
336 Ga0451833_0359028
337 Ga0451837_1284865
338 Ga0451839_0186024
339 Ga0451853_0028930
340 Ga0439450_143844
341 Ga0439463_009588
342 Ga0439459_0041556
343 Ga0466965_0013001
344 Ga0466958_1123580
345 Ga0466967_0049793
346 Ga0466967_1387654
347 Ga0495629_0048351
348 Ga0495651_0138786
349 Ga0495653_0147892
350 Ga0495639_0645224
351 Ga0495662_0182119
352 Ga0495664_0633582
353 Ga0495584_0507932
354 Ga0495585_0414010
355 Ga0495594_0322851
356 Ga0495594_0456575
357 Ga0495628_0298762
358 Ga0495632_0316183
359 Ga0495648_0030458
360 Ga0495652_0050234
361 Ga0495586_0127681
362 Ga0495645_0173639
363 Ga0495611_0111115
364 Ga0495646_0637813
365 Ga0495647_0502088
366 Ga0495613_0044544
367 Ga0495613_0109635
368 Ga0495613_0667101
369 Ga0495624_0044640
370 Ga0495674_0583432
371 Ga0495674_0871730
372 Ga0495676_0316223
373 Ga0495680_0101675
374 Ga0495685_081487
375 Ga0501080_0115006
376 nmdc:mga03683_5897_c1
377 nmdc:mga03n38_353917_c1
378 nmdc:mga03n38_969523_c1
379 nmdc:mga00v17_133201_c1
380 nmdc:mga00v17_255641_c1
381 nmdc:mga00v17_90790_c1
382 nmdc:mga0yw44_122806_c1
383 nmdc:mga0yw44_130469_c1
384 nmdc:mga0yw44_4224_c1
385 nmdc:mga0yw44_51877_c1
386 nmdc:mga0yw44_521013_c1
387 nmdc:mga06z11_311256_c1
388 nmdc:mga06z11_332287_c1
389 nmdc:mga04h51_44048_c1
390 nmdc:mga07m45_13133_c1
391 nmdc:mga07m45_192294_c1
392 nmdc:mga05p37_818454_c1
393 nmdc:mga06r32_1485107_c1
394 nmdc:mga08y16_7300_c1
395 nmdc:mga0rr50_688734_c1
396 Ga0495601_0025286
397 Ga0495595_0122275
398 Ga0500578_0006866
399 Ga0500583_0411608
400 Ga0500651_0559771
401 Ga0500566_0259490
402 Ga0500553_018407
403 Ga0500562_168578
404 Ga0500569_066013
405 Ga0500594_0189274
406 Ga0500621_296547
407 Ga0500573_0133103
408 Ga0500579_133429
409 Ga0500600_0142912
410 Ga0500600_0179219
411 Ga0500603_150994
412 Ga0500616_0007079
413 Ga0500633_0305818
414 Ga0500634_0101469
415 2731906440
416 2799186451

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9567 2 63
4h0e-assembly1.cif.gz_A crystal structure of mutant orr3 in complex with ntd of arar 0.9481 2 63
5d4s-assembly1.cif.gz_B crystal structure of arar(dbd) in complex with operator orx1 0.9478 2 63
5d4r-assembly1.cif.gz_A crystal structure of arar(dbd) in complex with operator ore1 0.9476 2 63
4egz-assembly1.cif.gz_B crystal structure of arar(dbd) in complex with operator orr3 0.945 2 63
ID Description Score Start End Superfamily
af_P0ACM5_16_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.957 4 63 1.10.10.10
af_P13669_2_75_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9561 2 64 1.10.10.10
4r1hB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.953 2 64 1.10.10.10
2wv0D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9506 2 64 1.10.10.10
5d4sA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.948 2 63 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1I4ISM7-F1-model_v4 DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain 0.966 3 66 GO:0003677
GO:0003700
GO:0008483
GO:0009058
GO:0030170
AF-A0A2V8TEW4-F1-model_v4 HTH gntR-type domain-containing protein 0.9654 2 66 GO:0003677
GO:0003700
AF-A0A2T5NEY5-F1-model_v4 Trehalose operon repressor 0.964 2 65 GO:0003677
GO:0003700
GO:0045892
AF-A0A6N0JVV9-F1-model_v4 PLP-dependent aminotransferase family protein 0.9614 3 64 GO:0003677
GO:0003700
GO:0008483
GO:0009058
GO:0030170
AF-A0A2A5GQ75-F1-model_v4 Transcriptional regulator 0.9595 2 67 GO:0003677
GO:0003700
GO:0005737

Map