F317526

General Info

Members Datasets Scaffolds Average Seq Length
208 129 208 327

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100055075|Ga0068853_1000550752
Length 338
Sequence VYLAIVPADRFINQRKNAWQRLEELLALLDHASLRRLNREEVRELGRIYRRTASDLAIARAESRDPRLVNYLNSLVIRAHGCIYRADAQGGKRIRNFFAHELPRTFRRTWRYTALSFSVFAIFAAFSFVATRIDPEFSELVGVNPAFREVYIETKTHWWEGLNEEGNQVGAAFIMQNNIRVTILTFAFGAMLGLGTIYYLAFNGANIASVLALCYQSGFGNDLVTFMVGHGVIELSCIFIAGGAGLLIGSAMLMPGDLSRADAMKTRGMEAVRLMIGVALLLVVAATIEGFISPAPISPRIKFGIGAITGIALYSYLLFAGRDTTNEETIPTNMATRI

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
107 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
115 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
116 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
117 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
118 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
119 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
120 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
121 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
122 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
125 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.37
Rhizosphere 96.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000010 3300002074 Bacteria 166979
2 JGI24034J26672_10000001 3300002239 Bacteria 1118280
3 JGI24751J29686_10000010 3300002459 Bacteria 124816
4 JGI25406J46586_10003640 3300003203 Bacteria 7229
5 Ga0065714_10064435 3300005288 Bacteria 121919
6 Ga0065704_10083357 3300005289 Bacteria 3477
7 Ga0065712_10000118 3300005290 Bacteria 121959
8 Ga0065715_10090333 3300005293 Bacteria 7192
9 Ga0065715_10102668 3300005293 Unclassified 3095
10 Ga0065707_10004347 3300005295 Bacteria 5110
11 Ga0065707_10028493 3300005295 Unclassified 2047
12 Ga0065707_10122901 3300005295 Unclassified 2078
13 Ga0065707_10158664 3300005295 Bacteria 1584
14 Ga0070676_10092613 3300005328 Bacteria 1854
15 Ga0070670_100000172 3300005331 Bacteria 58670
16 Ga0070670_100000531 3300005331 Bacteria 30505
17 Ga0068869_100001535 3300005334 Bacteria 13709
18 Ga0068869_100021730 3300005334 Bacteria 4416
19 Ga0070680_100000737 3300005336 Bacteria 22831
20 Ga0070682_100000692 3300005337 Bacteria 20370
21 Ga0070689_100000223 3300005340 Bacteria 33953
22 Ga0070689_100031748 3300005340 Bacteria 4015
23 Ga0070669_100001601 3300005353 Bacteria 16362
24 Ga0070659_100034982 3300005366 Unclassified 3910
25 Ga0070701_10149822 3300005438 Bacteria 1342
26 Ga0070694_100027002 3300005444 Bacteria 3725
27 Ga0070694_100118517 3300005444 Unclassified 1896
28 Ga0070708_100000103 3300005445 Bacteria 56127
29 Ga0070708_100585972 3300005445 Bacteria 1051
30 Ga0070681_10000083 3300005458 Bacteria 71010
31 Ga0070706_100001203 3300005467 Bacteria 27707
32 Ga0070706_100003065 3300005467 Bacteria 16548
33 Ga0070706_100005301 3300005467 Bacteria 12290
34 Ga0070707_100000565 3300005468 Bacteria 37208
35 Ga0070707_100135019 3300005468 Bacteria 2400
36 Ga0070707_100151405 3300005468 Bacteria 2259
37 Ga0070698_100003853 3300005471 Bacteria 16501
38 Ga0070698_100015887 3300005471 Bacteria 7948
39 Ga0070698_100056331 3300005471 Bacteria 3984
40 Ga0070698_100065533 3300005471 Unclassified 3657
41 Ga0070698_100141446 3300005471 Bacteria 2357
42 Ga0070699_100004013 3300005518 Bacteria 13012
43 Ga0070699_100163285 3300005518 Bacteria 1972
44 Ga0070699_100276117 3300005518 Unclassified 1505
45 Ga0070699_100370764 3300005518 Unclassified 1291
46 Ga0070679_100000087 3300005530 Bacteria 69339
47 Ga0070697_100000217 3300005536 Bacteria 47346
48 Ga0070697_100002687 3300005536 Bacteria 13685
49 Ga0070697_100070123 3300005536 Bacteria 2873
50 Ga0070697_100162109 3300005536 Bacteria 1889
51 Ga0070697_100229357 3300005536 Unclassified 1584
52 Ga0068853_100055075 3300005539 Bacteria 3428
53 Ga0070695_100027628 3300005545 Bacteria 3516
54 Ga0070695_100027951 3300005545 Bacteria 3497
55 Ga0070696_100114565 3300005546 Bacteria 1944
56 Ga0070696_100222771 3300005546 Bacteria 1416
57 Ga0070693_100012715 3300005547 Bacteria 4267
58 Ga0070704_100183025 3300005549 Bacteria 1677
59 Ga0070704_100241687 3300005549 Bacteria 1478
60 Ga0070704_100373997 3300005549 Bacteria 1209
61 Ga0068857_100086995 3300005577 Bacteria 2795
62 Ga0068857_100177386 3300005577 Unclassified 1938
63 Ga0068859_100136288 3300005617 Bacteria 2528
64 Ga0068864_100081923 3300005618 Bacteria 2830
65 Ga0068864_100125268 3300005618 Unclassified 2301
66 Ga0068861_100003062 3300005719 Bacteria 11043
67 Ga0068861_100172203 3300005719 Archaea 1795
68 Ga0068863_100058225 3300005841 Unclassified 3657
69 Ga0068863_100231736 3300005841 Bacteria 1781
70 Ga0068858_100000005 3300005842 Bacteria 305830
71 Ga0068860_100097925 3300005843 Bacteria 2797
72 Ga0081539_10000067 3300005985 Bacteria 246361
73 Ga0081539_10001827 3300005985 Bacteria 33597
74 Ga0070715_10000020 3300006163 Bacteria 119605
75 Ga0070716_100000003 3300006173 Bacteria 312721
76 Ga0097621_100240270 3300006237 Unclassified 1583
77 Ga0075433_10003325 3300006852 Bacteria 12419
78 Ga0075433_10107455 3300006852 Bacteria 2474
79 Ga0075433_10132636 3300006852 Unclassified 2213
80 Ga0075433_10431022 3300006852 Bacteria 1163
81 Ga0075434_100051872 3300006871 Unclassified 4075
82 Ga0075436_100013615 3300006914 Bacteria 5571
83 Ga0075436_100196738 3300006914 Bacteria 1427
84 Ga0097620_100136289 3300006931 Bacteria 2528
85 Ga0097620_100370946 3300006931 Bacteria 1527
86 Ga0099794_10001402 3300007265 Bacteria 8411
87 Ga0099794_10089451 3300007265 Unclassified 1526
88 Ga0111539_10100407 3300009094 Bacteria 3398
89 Ga0111539_10138937 3300009094 Unclassified 2845
90 Ga0105247_10000002 3300009101 Bacteria 724587
91 Ga0105247_10073423 3300009101 Bacteria 2143
92 Ga0114129_10002938 3300009147 Bacteria 23853
93 Ga0114129_10052735 3300009147 Bacteria 5708
94 Ga0105241_10032688 3300009174 Unclassified 3902
95 Ga0105241_10296196 3300009174 Unclassified 1387
96 Ga0105242_10604801 3300009176 Bacteria 1060
97 Ga0105248_10391202 3300009177 Bacteria 1565
98 Ga0105249_10007691 3300009553 Bacteria 9390
99 Ga0105249_10017330 3300009553 Bacteria 6396
100 Ga0105239_10090846 3300010375 Unclassified 3369
101 Ga0105246_10020472 3300011119 Unclassified 4243
102 Ga0157373_10140731 3300013100 Bacteria 1697
103 Ga0157371_10053941 3300013102 Bacteria 2855
104 Ga0163162_10026201 3300013306 Bacteria 5763
105 Ga0157372_10157126 3300013307 Unclassified 2627
106 Ga0157375_10517412 3300013308 Unclassified 1357
107 Ga0157375_10667383 3300013308 Unclassified 1195
108 Ga0163163_10000172 3300014325 Bacteria 67754
109 Ga0163163_10050934 3300014325 Unclassified 4080
110 Ga0163163_10311294 3300014325 Bacteria 1628
111 Ga0163163_10447116 3300014325 Bacteria 1352
112 Ga0163163_10603540 3300014325 Unclassified 1161
113 Ga0157380_10002703 3300014326 Bacteria 12029
114 Ga0157380_10024666 3300014326 Bacteria 4553
115 Ga0157380_10297722 3300014326 Bacteria 1484
116 Ga0157379_10045777 3300014968 Unclassified 3906
117 Ga0207710_10000002 3300025900 Bacteria 1251998
118 Ga0207685_10000008 3300025905 Bacteria 273136
119 Ga0207643_10006124 3300025908 Bacteria 6434
120 Ga0207684_10010408 3300025910 Bacteria 8189
121 Ga0207684_10019047 3300025910 Bacteria 5871
122 Ga0207684_10025122 3300025910 Bacteria 5077
123 Ga0207684_10098556 3300025910 Bacteria 2496
124 Ga0207684_10347392 3300025910 Bacteria 1277
125 Ga0207654_10007355 3300025911 Bacteria 5545
126 Ga0207707_10000006 3300025912 Bacteria 374131
127 Ga0207660_10000124 3300025917 Bacteria 45248
128 Ga0207652_10000517 3300025921 Bacteria 39157
129 Ga0207646_10001480 3300025922 Bacteria 28962
130 Ga0207646_10004787 3300025922 Bacteria 14532
131 Ga0207646_10064032 3300025922 Unclassified 3282
132 Ga0207646_10123737 3300025922 Bacteria 2325
133 Ga0207650_10000001 3300025925 Bacteria 1545726
134 Ga0207650_10000517 3300025925 Bacteria 31837
135 Ga0207687_10240235 3300025927 Bacteria 1435
136 Ga0207690_10022970 3300025932 Unclassified 3887
137 Ga0207709_10224485 3300025935 Bacteria 1357
138 Ga0207670_10001017 3300025936 Bacteria 14833
139 Ga0207665_10000003 3300025939 Bacteria 220666
140 Ga0207711_10033234 3300025941 Unclassified 4363
141 Ga0207711_10531440 3300025941 Bacteria 1097
142 Ga0207689_10003842 3300025942 Bacteria 13692
143 Ga0207689_10011419 3300025942 Bacteria 7612
144 Ga0207689_10209766 3300025942 Bacteria 1609
145 Ga0207689_10427347 3300025942 Bacteria 1106
146 Ga0207712_10013958 3300025961 Bacteria 5154
147 Ga0207712_10061983 3300025961 Bacteria 2656
148 Ga0207703_10000150 3300026035 Bacteria 80047
149 Ga0207703_10219332 3300026035 Bacteria 1700
150 Ga0207639_10043037 3300026041 Bacteria 3387
151 Ga0207708_10161561 3300026075 Unclassified 1769
152 Ga0207702_10068377 3300026078 Unclassified 3051
153 Ga0207641_10025386 3300026088 Bacteria 4886
154 Ga0207641_10132290 3300026088 Bacteria 2241
155 Ga0207648_10215742 3300026089 Bacteria 1704
156 Ga0207676_10059237 3300026095 Unclassified 3023
157 Ga0207674_10073433 3300026116 Unclassified 3434
158 Ga0207674_10103819 3300026116 Bacteria 2821
159 Ga0207674_10458110 3300026116 Bacteria 1232
160 Ga0207674_10468887 3300026116 Unclassified 1217
161 Ga0207675_100006396 3300026118 Bacteria 11161
162 Ga0207675_100220696 3300026118 Archaea 1826
163 Ga0209588_1029159 3300027671 Unclassified 1759
164 Ga0268265_10111356 3300028380 Bacteria 2236
165 Ga0268264_10051298 3300028381 Bacteria 3437
166 Ga0268264_10078018 3300028381 Bacteria 2823
167 Ga0307408_100391296 3300031548 Bacteria 1191
168 Ga0307413_10019265 3300031824 Bacteria 3601
169 Ga0307416_100009624 3300032002 Bacteria 6337
170 Ga0307411_10065818 3300032005 Bacteria 2432
171 Ga0373951_0003701 3300035091 Bacteria 3688
172 Ga0395900_0360581 3300037418 Unclassified 1425
173 Ga0395898_0160401 3300037466 Unclassified 2151
174 Ga0395905_0129537 3300037471 Unclassified 2373
175 Ga0451577_0106075 3300042876 Unclassified 2511
176 Ga0451576_0008498 3300045051 Bacteria 12045
177 Ga0495621_0053663 3300046539 Unclassified 1447
178 Ga0495636_0015003 3300047318 Unclassified 3086
179 Ga0495636_0020428 3300047318 Unclassified 2669
180 Ga0496102_0227007 3300048905 Bacteria 1761
181 Ga0496104_0258094 3300048907 Unclassified 1656
182 Ga0496104_0299937 3300048907 Bacteria 1519
183 Ga0496107_0016748 3300048910 Bacteria 5153
184 Ga0496110_0084108 3300048913 Bacteria 2840
185 Ga0496112_0088587 3300048915 Unclassified 3063
186 Ga0496113_0134501 3300048916 Unclassified 1942
187 Ga0501298_001152 3300049521 Bacteria 3831
188 Ga0501299_005236 3300049522 Bacteria 1982
189 Ga0501217_007345 3300049661 Bacteria 2360
190 Ga0501217_012664 3300049661 Bacteria 1882
191 Ga0501233_009315 3300049668 Bacteria 1913
192 Ga0501235_011836 3300049669 Bacteria 1915
193 Ga0501258_009556 3300049687 Bacteria 1015
194 Ga0501260_000827 3300049689 Bacteria 2457
195 Ga0501283_002766 3300049779 Bacteria 2293
196 Ga0501212_005393 3300049851 Bacteria 1686
197 nmdc:mga05p37_67085_c1 3300050507 Bacteria 4414
198 nmdc:mga0qj67_83088_c1 3300050509 Unclassified 2568
199 nmdc:mga06r32_230790_c1 3300050510 Unclassified 1839
200 nmdc:mga06r32_473398_c1 3300050510 Unclassified 1231
201 nmdc:mga0n895_264301_c1 3300050512 Bacteria 1746
202 nmdc:mga0n895_54452_c1 3300050512 Unclassified 3935
203 nmdc:mga08x19_8787_c1 3300050514 Bacteria 6027
204 nmdc:mga0a205_19187_c1 3300050515 Bacteria 6444
205 nmdc:mga0a205_225685_c1 3300050515 Unclassified 1758
206 nmdc:mga0a205_59147_c1 3300050515 Bacteria 3702
207 nmdc:mga0a205_7869_c1 3300050515 Bacteria 9680
208 Ga0501084_0059255 3300054114 Bacteria 3205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10092613 Ga0070676_100926131 297
2 3300005295 Ga0065707_10158664 Ga0065707_101586641 298
3 3300009147 Ga0114129_10052735 Ga0114129_100527351 298
4 3300050515 nmdc:mga0a205_59147_c1 nmdc:mga0a205_59147_c1_2665_3660 305
5 3300005340 Ga0070689_100000223 Ga0070689_10000022317 309
6 3300005843 Ga0068860_100097925 Ga0068860_1000979251 309
7 3300025908 Ga0207643_10006124 Ga0207643_100061247 309
8 3300025936 Ga0207670_10001017 Ga0207670_100010175 309
9 3300028381 Ga0268264_10078018 Ga0268264_100780181 309
10 3300005336 Ga0070680_100000737 Ga0070680_1000007372 312
11 3300005458 Ga0070681_10000083 Ga0070681_1000008348 312
12 3300005518 Ga0070699_100276117 Ga0070699_1002761172 312
13 3300005530 Ga0070679_100000087 Ga0070679_10000008733 312
14 3300006852 Ga0075433_10431022 Ga0075433_104310222 312
15 3300009553 Ga0105249_10017330 Ga0105249_100173303 312
16 3300025912 Ga0207707_10000006 Ga0207707_1000000695 312
17 3300025917 Ga0207660_10000124 Ga0207660_1000012410 312
18 3300025921 Ga0207652_10000517 Ga0207652_1000051710 312
19 3300025961 Ga0207712_10061983 Ga0207712_100619833 312
20 3300037466 Ga0395898_0160401 Ga0395898_0160401_1055_2047 312
21 3300050512 nmdc:mga0n895_264301_c1 nmdc:mga0n895_264301_c1_97_1089 312
22 3300005546 Ga0070696_100114565 Ga0070696_1001145651 313
23 3300025910 Ga0207684_10347392 Ga0207684_103473921 314
24 3300005293 Ga0065715_10090333 Ga0065715_100903333 315
25 3300005331 Ga0070670_100000531 Ga0070670_10000053118 315
26 3300005334 Ga0068869_100021730 Ga0068869_1000217303 315
27 3300005340 Ga0070689_100031748 Ga0070689_1000317483 315
28 3300005353 Ga0070669_100001601 Ga0070669_1000016019 315
29 3300009176 Ga0105242_10604801 Ga0105242_106048011 315
30 3300025925 Ga0207650_10000517 Ga0207650_1000051713 315
31 3300025942 Ga0207689_10003842 Ga0207689_100038429 315
32 3300026088 Ga0207641_10132290 Ga0207641_101322902 315
33 3300005445 Ga0070708_100585972 Ga0070708_1005859721 316
34 3300005471 Ga0070698_100056331 Ga0070698_1000563313 316
35 3300005577 Ga0068857_100086995 Ga0068857_1000869951 316
36 3300009174 Ga0105241_10296196 Ga0105241_102961961 316
37 3300026116 Ga0207674_10103819 Ga0207674_101038191 316
38 3300037471 Ga0395905_0129537 Ga0395905_0129537_1307_2260 316
39 3300005334 Ga0068869_100001535 Ga0068869_1000015356 317
40 3300005444 Ga0070694_100118517 Ga0070694_1001185172 317
41 3300005468 Ga0070707_100151405 Ga0070707_1001514052 317
42 3300005471 Ga0070698_100065533 Ga0070698_1000655332 317
43 3300005518 Ga0070699_100004013 Ga0070699_10000401312 317
44 3300005545 Ga0070695_100027628 Ga0070695_1000276283 317
45 3300005618 Ga0068864_100125268 Ga0068864_1001252683 317
46 3300006931 Ga0097620_100370946 Ga0097620_1003709462 317
47 3300014325 Ga0163163_10603540 Ga0163163_106035401 317
48 3300014326 Ga0157380_10002703 Ga0157380_100027032 317
49 3300025910 Ga0207684_10098556 Ga0207684_100985562 317
50 3300025922 Ga0207646_10123737 Ga0207646_101237371 317
51 3300025941 Ga0207711_10531440 Ga0207711_105314401 317
52 3300026075 Ga0207708_10161561 Ga0207708_101615611 317
53 3300026116 Ga0207674_10468887 Ga0207674_104688872 317
54 3300028380 Ga0268265_10111356 Ga0268265_101113561 317
55 3300028381 Ga0268264_10051298 Ga0268264_100512982 317
56 3300031548 Ga0307408_100391296 Ga0307408_1003912961 317
57 3300042876 Ga0451577_0106075 Ga0451577_0106075_747_1700 317
58 3300045051 Ga0451576_0008498 Ga0451576_0008498_4467_5420 317
59 3300048915 Ga0496112_0088587 Ga0496112_0088587_475_1512 317
60 3300049661 Ga0501217_012664 Ga0501217_012664_322_1284 317
61 3300050515 nmdc:mga0a205_225685_c1 nmdc:mga0a205_225685_c1_100_1068 317
62 3300054114 Ga0501084_0059255 Ga0501084_0059255_1313_2266 317
63 3300003203 JGI25406J46586_10003640 JGI25406J46586_100036407 318
64 3300005289 Ga0065704_10083357 Ga0065704_100833572 318
65 3300005295 Ga0065707_10004347 Ga0065707_100043473 318
66 3300005295 Ga0065707_10028493 Ga0065707_100284932 318
67 3300005366 Ga0070659_100034982 Ga0070659_1000349823 318
68 3300005444 Ga0070694_100027002 Ga0070694_1000270023 318
69 3300005467 Ga0070706_100005301 Ga0070706_10000530112 318
70 3300005471 Ga0070698_100015887 Ga0070698_1000158874 318
71 3300005536 Ga0070697_100002687 Ga0070697_1000026875 318
72 3300005549 Ga0070704_100241687 Ga0070704_1002416871 318
73 3300005617 Ga0068859_100136288 Ga0068859_1001362882 318
74 3300005719 Ga0068861_100003062 Ga0068861_1000030623 318
75 3300005985 Ga0081539_10000067 Ga0081539_10000067177 318
76 3300006237 Ga0097621_100240270 Ga0097621_1002402702 318
77 3300006852 Ga0075433_10003325 Ga0075433_1000332511 318
78 3300006871 Ga0075434_100051872 Ga0075434_1000518724 318
79 3300006931 Ga0097620_100136289 Ga0097620_1001362892 318
80 3300010375 Ga0105239_10090846 Ga0105239_100908462 318
81 3300013102 Ga0157371_10053941 Ga0157371_100539412 318
82 3300025910 Ga0207684_10019047 Ga0207684_100190473 318
83 3300025932 Ga0207690_10022970 Ga0207690_100229702 318
84 3300025942 Ga0207689_10011419 Ga0207689_100114192 318
85 3300025942 Ga0207689_10209766 Ga0207689_102097662 318
86 3300026035 Ga0207703_10219332 Ga0207703_102193321 318
87 3300026118 Ga0207675_100006396 Ga0207675_1000063966 318
88 3300035091 Ga0373951_0003701 Ga0373951_0003701_1913_2896 318
89 3300047318 Ga0495636_0015003 Ga0495636_0015003_1921_2895 318
90 3300048905 Ga0496102_0227007 Ga0496102_0227007_104_1087 318
91 3300048910 Ga0496107_0016748 Ga0496107_0016748_738_1694 318
92 3300050512 nmdc:mga0n895_54452_c1 nmdc:mga0n895_54452_c1_1877_2833 318
93 3300050515 nmdc:mga0a205_19187_c1 nmdc:mga0a205_19187_c1_1609_2565 318
94 3300005288 Ga0065714_10064435 Ga0065714_1006443556 319
95 3300005290 Ga0065712_10000118 Ga0065712_1000011857 319
96 3300005293 Ga0065715_10102668 Ga0065715_101026682 319
97 3300005518 Ga0070699_100163285 Ga0070699_1001632852 319
98 3300005536 Ga0070697_100000217 Ga0070697_10000021710 319
99 3300005545 Ga0070695_100027951 Ga0070695_1000279512 319
100 3300005841 Ga0068863_100231736 Ga0068863_1002317362 319
101 3300006852 Ga0075433_10132636 Ga0075433_101326362 319
102 3300007265 Ga0099794_10089451 Ga0099794_100894512 319
103 3300009553 Ga0105249_10007691 Ga0105249_100076913 319
104 3300013306 Ga0163162_10026201 Ga0163162_100262016 319
105 3300014326 Ga0157380_10297722 Ga0157380_102977221 319
106 3300025941 Ga0207711_10033234 Ga0207711_100332344 319
107 3300025942 Ga0207689_10427347 Ga0207689_104273471 319
108 3300025961 Ga0207712_10013958 Ga0207712_100139585 319
109 3300026116 Ga0207674_10458110 Ga0207674_104581102 319
110 3300050515 nmdc:mga0a205_7869_c1 nmdc:mga0a205_7869_c1_8640_9626 319
111 3300002074 JGI24748J21848_1000010 JGI24748J21848_1000010102 320
112 3300002239 JGI24034J26672_10000001 JGI24034J26672_10000001580 320
113 3300002459 JGI24751J29686_10000010 JGI24751J29686_1000001042 320
114 3300005295 Ga0065707_10122901 Ga0065707_101229012 320
115 3300005331 Ga0070670_100000172 Ga0070670_10000017210 320
116 3300005337 Ga0070682_100000692 Ga0070682_1000006923 320
117 3300005438 Ga0070701_10149822 Ga0070701_101498221 320
118 3300005445 Ga0070708_100000103 Ga0070708_10000010312 320
119 3300005467 Ga0070706_100001203 Ga0070706_1000012039 320
120 3300005467 Ga0070706_100003065 Ga0070706_1000030659 320
121 3300005468 Ga0070707_100000565 Ga0070707_1000005659 320
122 3300005468 Ga0070707_100135019 Ga0070707_1001350192 320
123 3300005471 Ga0070698_100003853 Ga0070698_1000038532 320
124 3300005471 Ga0070698_100141446 Ga0070698_1001414462 320
125 3300005518 Ga0070699_100370764 Ga0070699_1003707641 320
126 3300005536 Ga0070697_100070123 Ga0070697_1000701231 320
127 3300005536 Ga0070697_100162109 Ga0070697_1001621092 320
128 3300005536 Ga0070697_100229357 Ga0070697_1002293571 320
129 3300005539 Ga0068853_100055075 Ga0068853_1000550752 320
130 3300005546 Ga0070696_100222771 Ga0070696_1002227711 320
131 3300005547 Ga0070693_100012715 Ga0070693_1000127152 320
132 3300005549 Ga0070704_100183025 Ga0070704_1001830252 320
133 3300005549 Ga0070704_100373997 Ga0070704_1003739971 320
134 3300005577 Ga0068857_100177386 Ga0068857_1001773862 320
135 3300005618 Ga0068864_100081923 Ga0068864_1000819233 320
136 3300005719 Ga0068861_100172203 Ga0068861_1001722031 320
137 3300005841 Ga0068863_100058225 Ga0068863_1000582252 320
138 3300005842 Ga0068858_100000005 Ga0068858_100000005159 320
139 3300005985 Ga0081539_10001827 Ga0081539_100018279 320
140 3300006163 Ga0070715_10000020 Ga0070715_100000205 320
141 3300006173 Ga0070716_100000003 Ga0070716_10000000361 320
142 3300006852 Ga0075433_10107455 Ga0075433_101074552 320
143 3300006914 Ga0075436_100013615 Ga0075436_1000136154 320
144 3300006914 Ga0075436_100196738 Ga0075436_1001967381 320
145 3300007265 Ga0099794_10001402 Ga0099794_100014027 320
146 3300009094 Ga0111539_10100407 Ga0111539_101004071 320
147 3300009094 Ga0111539_10138937 Ga0111539_101389372 320
148 3300009101 Ga0105247_10000002 Ga0105247_10000002414 320
149 3300009101 Ga0105247_10073423 Ga0105247_100734232 320
150 3300009147 Ga0114129_10002938 Ga0114129_1000293818 320
151 3300009174 Ga0105241_10032688 Ga0105241_100326883 320
152 3300009177 Ga0105248_10391202 Ga0105248_103912022 320
153 3300011119 Ga0105246_10020472 Ga0105246_100204723 320
154 3300013100 Ga0157373_10140731 Ga0157373_101407311 320
155 3300013307 Ga0157372_10157126 Ga0157372_101571261 320
156 3300013308 Ga0157375_10517412 Ga0157375_105174121 320
157 3300013308 Ga0157375_10667383 Ga0157375_106673831 320
158 3300014325 Ga0163163_10000172 Ga0163163_1000017223 320
159 3300014325 Ga0163163_10050934 Ga0163163_100509342 320
160 3300014325 Ga0163163_10311294 Ga0163163_103112942 320
161 3300014325 Ga0163163_10447116 Ga0163163_104471162 320
162 3300014326 Ga0157380_10024666 Ga0157380_100246662 320
163 3300014968 Ga0157379_10045777 Ga0157379_100457772 320
164 3300025900 Ga0207710_10000002 Ga0207710_10000002414 320
165 3300025905 Ga0207685_10000008 Ga0207685_10000008145 320
166 3300025910 Ga0207684_10010408 Ga0207684_100104084 320
167 3300025910 Ga0207684_10025122 Ga0207684_100251224 320
168 3300025911 Ga0207654_10007355 Ga0207654_100073553 320
169 3300025922 Ga0207646_10001480 Ga0207646_100014804 320
170 3300025922 Ga0207646_10004787 Ga0207646_100047877 320
171 3300025922 Ga0207646_10064032 Ga0207646_100640322 320
172 3300025925 Ga0207650_10000001 Ga0207650_10000001470 320
173 3300025927 Ga0207687_10240235 Ga0207687_102402352 320
174 3300025935 Ga0207709_10224485 Ga0207709_102244851 320
175 3300025939 Ga0207665_10000003 Ga0207665_1000000358 320
176 3300026035 Ga0207703_10000150 Ga0207703_1000015056 320
177 3300026041 Ga0207639_10043037 Ga0207639_100430372 320
178 3300026078 Ga0207702_10068377 Ga0207702_100683771 320
179 3300026088 Ga0207641_10025386 Ga0207641_100253865 320
180 3300026089 Ga0207648_10215742 Ga0207648_102157421 320
181 3300026095 Ga0207676_10059237 Ga0207676_100592373 320
182 3300026116 Ga0207674_10073433 Ga0207674_100734333 320
183 3300026118 Ga0207675_100220696 Ga0207675_1002206961 320
184 3300027671 Ga0209588_1029159 Ga0209588_10291592 320
185 3300031824 Ga0307413_10019265 Ga0307413_100192652 320
186 3300032002 Ga0307416_100009624 Ga0307416_1000096242 320
187 3300032005 Ga0307411_10065818 Ga0307411_100658182 320
188 3300037418 Ga0395900_0360581 Ga0395900_0360581_402_1385 320
189 3300046539 Ga0495621_0053663 Ga0495621_0053663_395_1396 320
190 3300047318 Ga0495636_0020428 Ga0495636_0020428_367_1329 320
191 3300048907 Ga0496104_0258094 Ga0496104_0258094_386_1402 320
192 3300048907 Ga0496104_0299937 Ga0496104_0299937_82_1077 320
193 3300048913 Ga0496110_0084108 Ga0496110_0084108_182_1153 320
194 3300048916 Ga0496113_0134501 Ga0496113_0134501_812_1828 320
195 3300049521 Ga0501298_001152 Ga0501298_001152_632_1609 320
196 3300049522 Ga0501299_005236 Ga0501299_005236_86_1063 320
197 3300049661 Ga0501217_007345 Ga0501217_007345_512_1489 320
198 3300049668 Ga0501233_009315 Ga0501233_009315_154_1131 320
199 3300049669 Ga0501235_011836 Ga0501235_011836_100_1077 320
200 3300049687 Ga0501258_009556 Ga0501258_009556_26_1003 320
201 3300049689 Ga0501260_000827 Ga0501260_000827_653_1630 320
202 3300049779 Ga0501283_002766 Ga0501283_002766_439_1431 320
203 3300049851 Ga0501212_005393 Ga0501212_005393_285_1262 320
204 3300050507 nmdc:mga05p37_67085_c1 nmdc:mga05p37_67085_c1_1389_2363 320
205 3300050509 nmdc:mga0qj67_83088_c1 nmdc:mga0qj67_83088_c1_743_1786 320
206 3300050510 nmdc:mga06r32_230790_c1 nmdc:mga06r32_230790_c1_201_1244 320
207 3300050510 nmdc:mga06r32_473398_c1 nmdc:mga06r32_473398_c1_62_1105 320
208 3300050514 nmdc:mga08x19_8787_c1 nmdc:mga08x19_8787_c1_3267_4262 320

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01944

SpoIIM

Stage II sporulation protein M

113

294

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j2c-assembly1.cif.gz_A garp-snare interaction 0.5162 1 84
4j2c-assembly2.cif.gz_C garp-snare interaction 0.5149 1 86
4j2c-assembly2.cif.gz_C garp-snare interaction 0.4225 1 86
4j2c-assembly1.cif.gz_A garp-snare interaction 0.4067 1 84
2l10-assembly1.cif.gz_A solution structure of the r6 domain of talin 0.3537 138 279
ID Description Score Start End Superfamily
af_O69662_1_106_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.7321 1 106 1.20.120.330
af_O69662_1_106_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.693 1 106 1.20.120.330
af_Q95QX5_245_346_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.6121 2 88 1.20.58.160
af_Q95QX5_245_346_1.20.58.160 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.5456 2 88 1.20.58.160
af_P19658_60_156_1.20.58.1150 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4313 2 86 1.20.58.1150
ID Description Score Start End GO Terms
AF-A0A352FT34-F1-model_v4 Stage II sporulation protein M 0.96 96 319 GO:0016020
AF-A0A2V8NQM3-F1-model_v4 Stage II sporulation protein M 0.9475 126 320 GO:0016020
AF-A0A2V9QNG0-F1-model_v4 Stage II sporulation protein M 0.9451 89 319 GO:0016020
AF-A0A352FT34-F1-model_v4 Stage II sporulation protein M 0.9356 96 319 GO:0016020
AF-A0A535BIG9-F1-model_v4 Stage II sporulation protein M 0.9313 166 316 GO:0016020

Feature Viewer

pLDDT pTM Quality
81.44 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map