F317490

General Info

Members Datasets Scaffolds Average Seq Length
208 135 416 169

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_10222474|Ga0070685_102224742
Length 196
Sequence MADRNVHYEAAFEAFLREKGIPYVAVDEAKRALFSNAKLKSFDFVVYSKSGPNLLIDVKGRQRRDHSSRRSFESWTTERDVTDLLQWEQVFGDGFRAVLAFIYWIETPLTPEPGMFEHRDRWYLLMGIDLNEYRNHMRRRSPKWETVSLRAEDFKLLARPIESWLCYDQSHEAKMDLQSLGGGAGAHEPSSAAGGG

Samples

Sample ID Description Type Environment
1 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
99 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
103 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
104 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
114 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
115 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
126 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.48
Rhizosphere 99.04
Stem 0
Stem Tuber 0
Unclassified 32.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070685_10222474 3300005466 Bacteria 1237
2 JGI25406J46586_10132718 3300003203 Bacteria 730
3 Ga0070658_10081982 3300005327 Bacteria 2650
4 Ga0070658_10344973 3300005327 Unclassified 1274
5 Ga0070690_100128625 3300005330 Bacteria 1708
6 Ga0070690_100513545 3300005330 Bacteria 898
7 Ga0070670_100611007 3300005331 Unclassified 976
8 Ga0070670_100821648 3300005331 Bacteria 840
9 Ga0070666_10469517 3300005335 Unclassified 910
10 Ga0070666_10654210 3300005335 Unclassified 769
11 Ga0070660_100787987 3300005339 Bacteria 799
12 Ga0070689_101267896 3300005340 Bacteria 663
13 Ga0070687_100411965 3300005343 Bacteria 889
14 Ga0070661_100455215 3300005344 Bacteria 1019
15 Ga0070661_101031830 3300005344 Unclassified 683
16 Ga0070668_100515996 3300005347 Bacteria 1036
17 Ga0070669_100347475 3300005353 Bacteria 1203
18 Ga0070671_100105625 3300005355 Bacteria 2363
19 Ga0070674_100013849 3300005356 Bacteria 4997
20 Ga0070673_100178091 3300005364 Bacteria 1818
21 Ga0070673_100966158 3300005364 Unclassified 792
22 Ga0070667_100259973 3300005367 Unclassified 1554
23 Ga0070709_10560337 3300005434 Bacteria 875
24 Ga0070714_100037155 3300005435 Bacteria 4091
25 Ga0070713_100125747 3300005436 Unclassified 2255
26 Ga0070713_100173835 3300005436 Bacteria 1931
27 Ga0070713_101176024 3300005436 Unclassified 742
28 Ga0070708_100817192 3300005445 Bacteria 876
29 Ga0070663_101331283 3300005455 Unclassified 634
30 Ga0070678_100243326 3300005456 Bacteria 1505
31 Ga0070678_101213715 3300005456 Unclassified 700
32 Ga0068853_100472961 3300005539 Bacteria 1181
33 Ga0070672_100183777 3300005543 Bacteria 1743
34 Ga0070665_100000578 3300005548 Bacteria 51146
35 Ga0068855_100160014 3300005563 Bacteria 2556
36 Ga0068855_100219096 3300005563 Bacteria 2135
37 Ga0068855_100445376 3300005563 Bacteria 1414
38 Ga0070664_100576825 3300005564 Bacteria 1042
39 Ga0068854_101056433 3300005578 Bacteria 722
40 Ga0068856_101010765 3300005614 Bacteria 850
41 Ga0068852_100727009 3300005616 Bacteria 1004
42 Ga0068864_100333403 3300005618 Bacteria 1428
43 Ga0068864_100610987 3300005618 Bacteria 1059
44 Ga0068864_100699583 3300005618 Bacteria 990
45 Ga0068863_100406485 3300005841 Bacteria 1332
46 Ga0068863_101136376 3300005841 Bacteria 786
47 Ga0068858_100339364 3300005842 Bacteria 1438
48 Ga0068858_100448383 3300005842 Unclassified 1243
49 Ga0068858_100634990 3300005842 Unclassified 1037
50 Ga0068860_100027100 3300005843 Bacteria 5521
51 Ga0081539_10042862 3300005985 Bacteria 2630
52 Ga0070717_10195511 3300006028 Bacteria 1769
53 Ga0097621_100409804 3300006237 Unclassified 1215
54 Ga0075428_100635897 3300006844 Bacteria 1138
55 Ga0075428_101065107 3300006844 Bacteria 855
56 Ga0075431_100144336 3300006847 Bacteria 2453
57 Ga0075435_100671594 3300007076 Unclassified 900
58 Ga0105240_10157002 3300009093 Bacteria 2705
59 Ga0105240_11439166 3300009093 Unclassified 724
60 Ga0111539_10068070 3300009094 Bacteria 4203
61 Ga0105245_10186189 3300009098 Bacteria 1986
62 Ga0105245_10218563 3300009098 Bacteria 1837
63 Ga0105245_11670622 3300009098 Unclassified 689
64 Ga0105241_10312846 3300009174 Unclassified 1351
65 Ga0105241_10731567 3300009174 Unclassified 906
66 Ga0105241_11349544 3300009174 Unclassified 681
67 Ga0105242_10216047 3300009176 Bacteria 1711
68 Ga0105248_10025208 3300009177 Bacteria 6611
69 Ga0105248_10674098 3300009177 Bacteria 1167
70 Ga0105248_11310291 3300009177 Bacteria 819
71 Ga0105238_10323393 3300009551 Bacteria 1529
72 Ga0157373_10737819 3300013100 Unclassified 723
73 Ga0157371_10326906 3300013102 Unclassified 1113
74 Ga0157371_10571349 3300013102 Unclassified 839
75 Ga0157370_10038638 3300013104 Bacteria 4617
76 Ga0157370_10039275 3300013104 Bacteria 4574
77 Ga0157369_10006500 3300013105 Bacteria 13547
78 Ga0157369_10043853 3300013105 Bacteria 4873
79 Ga0157369_10070904 3300013105 Bacteria 3743
80 Ga0157369_11053999 3300013105 Bacteria 832
81 Ga0157374_10172525 3300013296 Bacteria 2110
82 Ga0163162_10557584 3300013306 Unclassified 1274
83 Ga0163162_10746075 3300013306 Unclassified 1098
84 Ga0157372_10015073 3300013307 Bacteria 8274
85 Ga0157372_10139274 3300013307 Bacteria 2794
86 Ga0157372_10143744 3300013307 Bacteria 2751
87 Ga0157372_10215677 3300013307 Unclassified 2224
88 Ga0157372_10541167 3300013307 Bacteria 1358
89 Ga0157372_10778961 3300013307 Bacteria 1112
90 Ga0157372_10839804 3300013307 Unclassified 1066
91 Ga0157372_11970874 3300013307 Unclassified 671
92 Ga0157377_10758539 3300014745 Unclassified 711
93 Ga0157379_10204864 3300014968 Bacteria 1784
94 Ga0207682_10067027 3300025893 Bacteria 1514
95 Ga0207682_10084674 3300025893 Bacteria 1365
96 Ga0207680_10017636 3300025903 Bacteria 3775
97 Ga0207680_10430743 3300025903 Bacteria 935
98 Ga0207680_10852698 3300025903 Unclassified 653
99 Ga0207705_10021328 3300025909 Bacteria 4622
100 Ga0207705_10122985 3300025909 Unclassified 1927
101 Ga0207695_10001078 3300025913 Bacteria 47698
102 Ga0207649_10629959 3300025920 Unclassified 827
103 Ga0207650_10112199 3300025925 Bacteria 2112
104 Ga0207650_11104720 3300025925 Unclassified 675
105 Ga0207659_10035303 3300025926 Bacteria 3455
106 Ga0207659_10165981 3300025926 Bacteria 1738
107 Ga0207659_10280606 3300025926 Bacteria 1362
108 Ga0207700_10581547 3300025928 Unclassified 996
109 Ga0207700_10589217 3300025928 Unclassified 989
110 Ga0207664_10030947 3300025929 Bacteria 4091
111 Ga0207644_10118997 3300025931 Bacteria 2008
112 Ga0207644_10527645 3300025931 Bacteria 976
113 Ga0207706_10398814 3300025933 Bacteria 1193
114 Ga0207669_10229148 3300025937 Bacteria 1369
115 Ga0207691_10154286 3300025940 Bacteria 2017
116 Ga0207711_10149943 3300025941 Bacteria 2103
117 Ga0207661_10598675 3300025944 Unclassified 1012
118 Ga0207679_10161711 3300025945 Bacteria 1834
119 Ga0207667_10120403 3300025949 Bacteria 2705
120 Ga0207667_10370291 3300025949 Bacteria 1460
121 Ga0207667_10567350 3300025949 Unclassified 1147
122 Ga0207667_10888856 3300025949 Unclassified 883
123 Ga0207651_10063093 3300025960 Bacteria 2586
124 Ga0207651_10377717 3300025960 Bacteria 1200
125 Ga0207668_10747930 3300025972 Bacteria 862
126 Ga0207658_10196138 3300025986 Unclassified 1682
127 Ga0207703_10404628 3300026035 Unclassified 1267
128 Ga0207639_10800687 3300026041 Bacteria 878
129 Ga0207702_10203240 3300026078 Bacteria 1838
130 Ga0207641_11094615 3300026088 Unclassified 795
131 Ga0207641_11674983 3300026088 Unclassified 638
132 Ga0207683_10651762 3300026121 Bacteria 975
133 Ga0207698_11665616 3300026142 Bacteria 653
134 Ga0268266_10001297 3300028379 Bacteria 30416
135 Ga0268266_10948712 3300028379 Unclassified 832
136 Ga0268264_10022569 3300028381 Bacteria 5137
137 Ga0265338_10320585 3300028800 Unclassified 1122
138 Ga0307408_100190145 3300031548 Bacteria 1653
139 Ga0307408_101311157 3300031548 Bacteria 679
140 Ga0265313_10031738 3300031595 Unclassified 2705
141 Ga0307410_10340082 3300031852 Unclassified 1196
142 Ga0307410_10419975 3300031852 Bacteria 1085
143 Ga0307410_10726713 3300031852 Unclassified 839
144 Ga0307410_10778759 3300031852 Unclassified 812
145 Ga0307407_10694876 3300031903 Unclassified 766
146 Ga0307409_100181015 3300031995 Bacteria 1866
147 Ga0307409_100490389 3300031995 Unclassified 1194
148 Ga0307409_100597562 3300031995 Unclassified 1090
149 Ga0307409_101649871 3300031995 Bacteria 670
150 Ga0307416_100234261 3300032002 Bacteria 1773
151 Ga0307416_100536442 3300032002 Bacteria 1241
152 Ga0307415_100600105 3300032126 Unclassified 980
153 Ga0373933_0162663 3300035724 Unclassified 1418
154 Ga0373947_0033542 3300035725 Bacteria 3032
155 Ga0373937_0057471 3300036401 Unclassified 3574
156 Ga0395900_0164730 3300037418 Bacteria 2260
157 Ga0395900_0362239 3300037418 Bacteria 1421
158 Ga0436365_0812130 3300039437 Bacteria 1101
159 Ga0466972_0210195 3300044658 Bacteria 911
160 Ga0453683_0338952 3300044673 Bacteria 965
161 Ga0451576_0000330 3300045051 Bacteria 114680
162 Ga0451576_0012857 3300045051 Bacteria 9387
163 Ga0451576_0222919 3300045051 Bacteria 1969
164 Ga0495592_0537710 3300046454 Unclassified 720
165 Ga0495580_0414712 3300046472 Bacteria 907
166 Ga0495582_0078640 3300046473 Bacteria 1830
167 Ga0495639_0079018 3300046475 Bacteria 1529
168 Ga0495594_0619503 3300046499 Bacteria 613
169 Ga0495618_0756105 3300046514 Unclassified 568
170 Ga0495628_0412161 3300046516 Bacteria 986
171 Ga0495630_0000667 3300046517 Bacteria 24749
172 Ga0495666_0053194 3300046526 Bacteria 1944
173 Ga0495665_0067940 3300046531 Bacteria 1880
174 Ga0495586_0183490 3300046535 Bacteria 1184
175 Ga0495586_0239582 3300046535 Unclassified 1034
176 Ga0495587_0374083 3300046536 Unclassified 793
177 Ga0495587_0652931 3300046536 Unclassified 578
178 Ga0495667_0007816 3300046559 Bacteria 7245
179 Ga0495634_0315725 3300046642 Bacteria 942
180 Ga0495635_0375616 3300046663 Unclassified 946
181 Ga0495613_0006645 3300046689 Bacteria 8640
182 Ga0495613_0223596 3300046689 Bacteria 1321
183 Ga0495624_0040761 3300046690 Bacteria 2973
184 Ga0495581_0025547 3300047315 Bacteria 3425
185 Ga0495581_0212270 3300047315 Bacteria 1132
186 Ga0495604_0299838 3300047317 Bacteria 1080
187 Ga0495604_0853813 3300047317 Unclassified 571
188 Ga0495674_0010961 3300047319 Bacteria 8564
189 Ga0495676_0241816 3300047321 Bacteria 1235
190 Ga0495680_0181946 3300047322 Unclassified 1517
191 Ga0495684_0006627 3300047471 Bacteria 8982
192 Ga0495684_0014865 3300047471 Bacteria 5993
193 Ga0495684_0100552 3300047471 Bacteria 2186
194 Ga0495602_0447978 3300048088 Unclassified 912
195 Ga0496110_1015997 3300048913 Unclassified 737
196 Ga0501034_0000532 3300049571 Bacteria 60495
197 Ga0501034_0137448 3300049571 Unclassified 2424
198 Ga0501069_0389710 3300049585 Bacteria 824
199 Ga0501070_0218527 3300049586 Bacteria 1563
200 Ga0501206_014677 3300049653 Bacteria 1079
201 Ga0501080_0012961 3300049742 Bacteria 7654
202 Ga0501083_0006467 3300049744 Bacteria 8312
203 Ga0501044_0000696 3300049823 Bacteria 40634
204 Ga0501044_0014974 3300049823 Bacteria 8362
205 Ga0501044_0778463 3300049823 Unclassified 837
206 nmdc:mga06r32_552151_c1 3300050510 Bacteria 1126
207 nmdc:mga08y16_98093_c1 3300050511 Bacteria 3051
208 Ga0501082_0637590 3300060353 Unclassified 932
209 Ga0070685_10222474
210 JGI25406J46586_10132718
211 Ga0070658_10081982
212 Ga0070658_10344973
213 Ga0070690_100128625
214 Ga0070690_100513545
215 Ga0070670_100611007
216 Ga0070670_100821648
217 Ga0070666_10469517
218 Ga0070666_10654210
219 Ga0070660_100787987
220 Ga0070689_101267896
221 Ga0070687_100411965
222 Ga0070661_100455215
223 Ga0070661_101031830
224 Ga0070668_100515996
225 Ga0070669_100347475
226 Ga0070671_100105625
227 Ga0070674_100013849
228 Ga0070673_100178091
229 Ga0070673_100966158
230 Ga0070667_100259973
231 Ga0070709_10560337
232 Ga0070714_100037155
233 Ga0070713_100125747
234 Ga0070713_100173835
235 Ga0070713_101176024
236 Ga0070708_100817192
237 Ga0070663_101331283
238 Ga0070678_100243326
239 Ga0070678_101213715
240 Ga0068853_100472961
241 Ga0070672_100183777
242 Ga0070665_100000578
243 Ga0068855_100160014
244 Ga0068855_100219096
245 Ga0068855_100445376
246 Ga0070664_100576825
247 Ga0068854_101056433
248 Ga0068856_101010765
249 Ga0068852_100727009
250 Ga0068864_100333403
251 Ga0068864_100610987
252 Ga0068864_100699583
253 Ga0068863_100406485
254 Ga0068863_101136376
255 Ga0068858_100339364
256 Ga0068858_100448383
257 Ga0068858_100634990
258 Ga0068860_100027100
259 Ga0081539_10042862
260 Ga0070717_10195511
261 Ga0097621_100409804
262 Ga0075428_100635897
263 Ga0075428_101065107
264 Ga0075431_100144336
265 Ga0075435_100671594
266 Ga0105240_10157002
267 Ga0105240_11439166
268 Ga0111539_10068070
269 Ga0105245_10186189
270 Ga0105245_10218563
271 Ga0105245_11670622
272 Ga0105241_10312846
273 Ga0105241_10731567
274 Ga0105241_11349544
275 Ga0105242_10216047
276 Ga0105248_10025208
277 Ga0105248_10674098
278 Ga0105248_11310291
279 Ga0105238_10323393
280 Ga0157373_10737819
281 Ga0157371_10326906
282 Ga0157371_10571349
283 Ga0157370_10038638
284 Ga0157370_10039275
285 Ga0157369_10006500
286 Ga0157369_10043853
287 Ga0157369_10070904
288 Ga0157369_11053999
289 Ga0157374_10172525
290 Ga0163162_10557584
291 Ga0163162_10746075
292 Ga0157372_10015073
293 Ga0157372_10139274
294 Ga0157372_10143744
295 Ga0157372_10215677
296 Ga0157372_10541167
297 Ga0157372_10778961
298 Ga0157372_10839804
299 Ga0157372_11970874
300 Ga0157377_10758539
301 Ga0157379_10204864
302 Ga0207682_10067027
303 Ga0207682_10084674
304 Ga0207680_10017636
305 Ga0207680_10430743
306 Ga0207680_10852698
307 Ga0207705_10021328
308 Ga0207705_10122985
309 Ga0207695_10001078
310 Ga0207649_10629959
311 Ga0207650_10112199
312 Ga0207650_11104720
313 Ga0207659_10035303
314 Ga0207659_10165981
315 Ga0207659_10280606
316 Ga0207700_10581547
317 Ga0207700_10589217
318 Ga0207664_10030947
319 Ga0207644_10118997
320 Ga0207644_10527645
321 Ga0207706_10398814
322 Ga0207669_10229148
323 Ga0207691_10154286
324 Ga0207711_10149943
325 Ga0207661_10598675
326 Ga0207679_10161711
327 Ga0207667_10120403
328 Ga0207667_10370291
329 Ga0207667_10567350
330 Ga0207667_10888856
331 Ga0207651_10063093
332 Ga0207651_10377717
333 Ga0207668_10747930
334 Ga0207658_10196138
335 Ga0207703_10404628
336 Ga0207639_10800687
337 Ga0207702_10203240
338 Ga0207641_11094615
339 Ga0207641_11674983
340 Ga0207683_10651762
341 Ga0207698_11665616
342 Ga0268266_10001297
343 Ga0268266_10948712
344 Ga0268264_10022569
345 Ga0265338_10320585
346 Ga0307408_100190145
347 Ga0307408_101311157
348 Ga0265313_10031738
349 Ga0307410_10340082
350 Ga0307410_10419975
351 Ga0307410_10726713
352 Ga0307410_10778759
353 Ga0307407_10694876
354 Ga0307409_100181015
355 Ga0307409_100490389
356 Ga0307409_100597562
357 Ga0307409_101649871
358 Ga0307416_100234261
359 Ga0307416_100536442
360 Ga0307415_100600105
361 Ga0373933_0162663
362 Ga0373947_0033542
363 Ga0373937_0057471
364 Ga0395900_0164730
365 Ga0395900_0362239
366 Ga0436365_0812130
367 Ga0466972_0210195
368 Ga0453683_0338952
369 Ga0451576_0000330
370 Ga0451576_0012857
371 Ga0451576_0222919
372 Ga0495592_0537710
373 Ga0495580_0414712
374 Ga0495582_0078640
375 Ga0495639_0079018
376 Ga0495594_0619503
377 Ga0495618_0756105
378 Ga0495628_0412161
379 Ga0495630_0000667
380 Ga0495666_0053194
381 Ga0495665_0067940
382 Ga0495586_0183490
383 Ga0495586_0239582
384 Ga0495587_0374083
385 Ga0495587_0652931
386 Ga0495667_0007816
387 Ga0495634_0315725
388 Ga0495635_0375616
389 Ga0495613_0006645
390 Ga0495613_0223596
391 Ga0495624_0040761
392 Ga0495581_0025547
393 Ga0495581_0212270
394 Ga0495604_0299838
395 Ga0495604_0853813
396 Ga0495674_0010961
397 Ga0495676_0241816
398 Ga0495680_0181946
399 Ga0495684_0006627
400 Ga0495684_0014865
401 Ga0495684_0100552
402 Ga0495602_0447978
403 Ga0496110_1015997
404 Ga0501034_0000532
405 Ga0501034_0137448
406 Ga0501069_0389710
407 Ga0501070_0218527
408 Ga0501206_014677
409 Ga0501080_0012961
410 Ga0501083_0006467
411 Ga0501044_0000696
412 Ga0501044_0014974
413 Ga0501044_0778463
414 nmdc:mga06r32_552151_c1
415 nmdc:mga08y16_98093_c1
416 Ga0501082_0637590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wcw-assembly1.cif.gz_B 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.7641 3 167
2wcw-assembly2.cif.gz_C 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.7528 7 167
2wcz-assembly1.cif.gz_A 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.7407 6 161
2wcz-assembly1.cif.gz_B 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.7304 14 167
2wcw-assembly2.cif.gz_C 1.6a resolution structure of archaeoglobus fulgidus hjc, a holliday junction resolvase from an archaeal hyperthermophile 0.7218 7 167
ID Description Score Start End Superfamily
af_Q57920_2_133_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.7415 7 167 3.40.1350.10
2wczB00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.7304 14 167 3.40.1350.10
1ob8A00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.693 7 167 3.40.1350.10
2wczB00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.6878 14 167 3.40.1350.10
af_D3ZYC4_132_269_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.643 7 63 3.40.1350.10
ID Description Score Start End GO Terms
AF-A0A3D4PGA4-F1-model_v4 PD(D/E)XK endonuclease domain-containing protein 0.9027 1 169
AF-A0A7Y3KBC9-F1-model_v4 HYExAFE family protein 0.8996 3 169
AF-A0A847HZX7-F1-model_v4 HYExAFE family protein 0.8967 3 169
AF-A0A7Y5RT60-F1-model_v4 HYExAFE family protein 0.8966 2 168
AF-A0A7C4IJS5-F1-model_v4 Holliday junction resolvase 0.8943 1 169

Map