F317420

General Info

Members Datasets Scaffolds Average Seq Length
208 148 414 262

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100098047|Ga0070671_1000980472
Length 306
Sequence MYPSMLAGVESGALHSARSKRPEGRLPDRIRRLMRKFPIQNVLIGASALVVAAGFVMPERDNTGPVLNAAATFVKGTASSTSQATTTVTAMDDGEVSEGVAEAAVNAFSGIVRGLSHPEALTAAFTSYFAFKAAHPDEVKKPYLYFVDYGQPATAKRGYVFDMQKLQIVDGPFTVAAGKGSAPDGGVPTRFSNGSGTGATSLGLYVTKALYAFTGHASGRVYNSVGLRLDGVSKGFNDKAFARGVVAHGAPYVTPNKAGRSKGCPAMEPSRAQRLLPKLAEGALVFLFAPNQNWLSHDPWVTSNKA

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
112 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
132 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
148 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.92
Rhizosphere 98.08
Stem 0
Stem Tuber 0
Unclassified 25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100098047 3300005355 Bacteria 2458
2 JGI24737J22298_10059476 3300001990 Unclassified 1151
3 Ga0065707_10195210 3300005295 Bacteria 1339
4 Ga0070658_10001014 3300005327 Bacteria 24089
5 Ga0070676_10091632 3300005328 Unclassified 1863
6 Ga0070683_100010257 3300005329 Bacteria 8051
7 Ga0070683_100029727 3300005329 Bacteria 4951
8 Ga0070683_100058336 3300005329 Bacteria 3586
9 Ga0070683_100064322 3300005329 Bacteria 3414
10 Ga0070683_100110787 3300005329 Bacteria 2589
11 Ga0070690_100001169 3300005330 Bacteria 13507
12 Ga0070690_100151254 3300005330 Bacteria 1584
13 Ga0070670_100425289 3300005331 Bacteria 1174
14 Ga0070677_10023724 3300005333 Unclassified 2274
15 Ga0070680_100009688 3300005336 Bacteria 7411
16 Ga0070680_100051482 3300005336 Bacteria 3360
17 Ga0068868_100061419 3300005338 Bacteria 2977
18 Ga0070687_100004995 3300005343 Bacteria 5340
19 Ga0070661_100057199 3300005344 Bacteria 2858
20 Ga0070668_100217137 3300005347 Bacteria 1575
21 Ga0070668_100682323 3300005347 Bacteria 905
22 Ga0070669_100003783 3300005353 Bacteria 10933
23 Ga0070669_100208369 3300005353 Bacteria 1541
24 Ga0070675_100028120 3300005354 Bacteria 4524
25 Ga0070675_100464023 3300005354 Bacteria 1137
26 Ga0070674_100162029 3300005356 Bacteria 1698
27 Ga0070673_100413898 3300005364 Bacteria 1207
28 Ga0070659_100352507 3300005366 Bacteria 1235
29 Ga0070667_100229357 3300005367 Bacteria 1655
30 Ga0070709_10002273 3300005434 Bacteria 10417
31 Ga0070709_10081062 3300005434 Bacteria 2117
32 Ga0070700_100477628 3300005441 Bacteria 954
33 Ga0070678_100265534 3300005456 Bacteria 1445
34 Ga0070662_100000382 3300005457 Bacteria 26313
35 Ga0070662_100056414 3300005457 Bacteria 2852
36 Ga0070681_10057602 3300005458 Unclassified 3866
37 Ga0070681_10132000 3300005458 Unclassified 2430
38 Ga0068867_100102121 3300005459 Bacteria 2191
39 Ga0068867_100454492 3300005459 Bacteria 1092
40 Ga0070706_100033984 3300005467 Bacteria 4707
41 Ga0070698_100140790 3300005471 Bacteria 2363
42 Ga0070679_100000633 3300005530 Bacteria 29947
43 Ga0070679_100001228 3300005530 Bacteria 22505
44 Ga0070684_100015596 3300005535 Bacteria 6195
45 Ga0070684_100097808 3300005535 Bacteria 2618
46 Ga0070684_100136878 3300005535 Unclassified 2213
47 Ga0070684_100163193 3300005535 Bacteria 2022
48 Ga0070697_100278259 3300005536 Bacteria 1435
49 Ga0070697_100410152 3300005536 Unclassified 1176
50 Ga0068853_100214954 3300005539 Bacteria 1754
51 Ga0070672_100359220 3300005543 Unclassified 1243
52 Ga0070686_100037709 3300005544 Bacteria 2999
53 Ga0070696_100006144 3300005546 Bacteria 8027
54 Ga0070665_100645897 3300005548 Bacteria 1071
55 Ga0070664_100047355 3300005564 Bacteria 3632
56 Ga0070664_100051740 3300005564 Bacteria 3478
57 Ga0070664_100094960 3300005564 Unclassified 2586
58 Ga0070664_100109712 3300005564 Bacteria 2407
59 Ga0070664_100266857 3300005564 Bacteria 1541
60 Ga0068857_100082352 3300005577 Bacteria 2874
61 Ga0068854_100186057 3300005578 Bacteria 1625
62 Ga0068856_100023550 3300005614 Bacteria 5988
63 Ga0068856_100448410 3300005614 Bacteria 1311
64 Ga0068852_100067769 3300005616 Unclassified 3121
65 Ga0068852_100176534 3300005616 Unclassified 2006
66 Ga0068859_100203372 3300005617 Bacteria 2065
67 Ga0068864_100197375 3300005618 Unclassified 1847
68 Ga0068870_10059788 3300005840 Bacteria 2044
69 Ga0068863_100522744 3300005841 Unclassified 1170
70 Ga0068858_100145494 3300005842 Bacteria 2225
71 Ga0068858_100242093 3300005842 Bacteria 1712
72 Ga0068860_100074720 3300005843 Bacteria 3223
73 Ga0068862_100116266 3300005844 Unclassified 2353
74 Ga0068862_100208757 3300005844 Bacteria 1764
75 Ga0070717_10076967 3300006028 Bacteria 2793
76 Ga0075434_100261960 3300006871 Unclassified 1748
77 Ga0068865_100020022 3300006881 Bacteria 4337
78 Ga0097620_100203357 3300006931 Bacteria 2065
79 Ga0111539_10080083 3300009094 Bacteria 3842
80 Ga0105245_10132791 3300009098 Bacteria 2337
81 Ga0114129_10953812 3300009147 Unclassified 1083
82 Ga0105243_10127025 3300009148 Unclassified 2159
83 Ga0105242_10014107 3300009176 Archaea 6187
84 Ga0105242_10024847 3300009176 Bacteria 4735
85 Ga0105248_10088413 3300009177 Bacteria 3487
86 Ga0105249_10623550 3300009553 Unclassified 1134
87 Ga0105246_10334574 3300011119 Bacteria 1235
88 Ga0157373_10054208 3300013100 Plasmid 2850
89 Ga0157371_10237580 3300013102 Bacteria 1310
90 Ga0157369_10060915 3300013105 Bacteria 4069
91 Ga0157369_10149413 3300013105 Bacteria 2469
92 Ga0157374_10306440 3300013296 Bacteria 1572
93 Ga0163162_10129754 3300013306 Bacteria 2629
94 Ga0163162_10300209 3300013306 Unclassified 1738
95 Ga0157372_10050166 3300013307 Bacteria 4643
96 Ga0157372_10237564 3300013307 Unclassified 2114
97 Ga0157372_10927643 3300013307 Bacteria 1010
98 Ga0157375_10011432 3300013308 Bacteria 7838
99 Ga0157375_10011475 3300013308 Bacteria 7827
100 Ga0157375_10335294 3300013308 Bacteria 1678
101 Ga0163163_10766748 3300014325 Bacteria 1028
102 Ga0157380_10394459 3300014326 Bacteria 1311
103 Ga0157379_10428795 3300014968 Bacteria 1218
104 Ga0157376_10248287 3300014969 Bacteria 1661
105 Ga0163161_10043122 3300017792 Bacteria 3248
106 Ga0207682_10003359 3300025893 Bacteria 6979
107 Ga0207692_10217893 3300025898 Unclassified 1130
108 Ga0207645_10041926 3300025907 Unclassified 2929
109 Ga0207645_10162257 3300025907 Bacteria 1462
110 Ga0207643_10036110 3300025908 Bacteria 2771
111 Ga0207705_10015233 3300025909 Bacteria 5522
112 Ga0207654_10114426 3300025911 Bacteria 1683
113 Ga0207707_10007084 3300025912 Bacteria 9771
114 Ga0207707_10010363 3300025912 Bacteria 8088
115 Ga0207707_10092616 3300025912 Bacteria 2641
116 Ga0207707_10393690 3300025912 Unclassified 1190
117 Ga0207660_10015092 3300025917 Bacteria 5093
118 Ga0207662_10001579 3300025918 Bacteria 11151
119 Ga0207649_10033277 3300025920 Unclassified 3079
120 Ga0207649_10171436 3300025920 Bacteria 1512
121 Ga0207649_10297062 3300025920 Unclassified 1180
122 Ga0207652_10005621 3300025921 Bacteria 10172
123 Ga0207652_10300740 3300025921 Bacteria 1448
124 Ga0207646_10069589 3300025922 Bacteria 3143
125 Ga0207681_10037200 3300025923 Bacteria 3215
126 Ga0207681_10067841 3300025923 Bacteria 2475
127 Ga0207650_10318218 3300025925 Unclassified 1274
128 Ga0207659_10032712 3300025926 Bacteria 3573
129 Ga0207659_10035850 3300025926 Bacteria 3432
130 Ga0207644_10235621 3300025931 Unclassified 1456
131 Ga0207644_10248175 3300025931 Unclassified 1419
132 Ga0207690_10065912 3300025932 Bacteria 2478
133 Ga0207690_10105996 3300025932 Unclassified 2016
134 Ga0207706_10039258 3300025933 Bacteria 4196
135 Ga0207686_10015751 3300025934 Bacteria 4235
136 Ga0207686_10077347 3300025934 Bacteria 2160
137 Ga0207670_10053875 3300025936 Bacteria 2712
138 Ga0207704_10082675 3300025938 Bacteria 2081
139 Ga0207665_10000515 3300025939 Bacteria 26165
140 Ga0207691_10106229 3300025940 Bacteria 2501
141 Ga0207661_10026553 3300025944 Bacteria 4414
142 Ga0207661_10144828 3300025944 Unclassified 2048
143 Ga0207661_10279633 3300025944 Bacteria 1491
144 Ga0207679_10014089 3300025945 Bacteria 5247
145 Ga0207679_10118377 3300025945 Unclassified 2104
146 Ga0207679_10148375 3300025945 Bacteria 1905
147 Ga0207651_10110881 3300025960 Bacteria 2059
148 Ga0207651_10371497 3300025960 Bacteria 1210
149 Ga0207651_10410054 3300025960 Bacteria 1154
150 Ga0207712_10327735 3300025961 Bacteria 1266
151 Ga0207668_10232410 3300025972 Bacteria 1487
152 Ga0207658_10311301 3300025986 Bacteria 1360
153 Ga0207703_10179088 3300026035 Bacteria 1870
154 Ga0207639_10155397 3300026041 Bacteria 1921
155 Ga0207702_10020803 3300026078 Bacteria 5427
156 Ga0207648_10021309 3300026089 Archaea 5826
157 Ga0207648_10228281 3300026089 Bacteria 1656
158 Ga0207675_100878913 3300026118 Bacteria 912
159 Ga0207683_10416831 3300026121 Bacteria 1236
160 Ga0207698_10008439 3300026142 Bacteria 6518
161 Ga0207698_10245816 3300026142 Unclassified 1634
162 Ga0207698_10328416 3300026142 Bacteria 1436
163 Ga0268265_10061089 3300028380 Unclassified 2891
164 Ga0268265_10175520 3300028380 Bacteria 1836
165 Ga0268264_10135553 3300028381 Bacteria 2188
166 Ga0307408_100292296 3300031548 Unclassified 1361
167 Ga0307410_10234037 3300031852 Bacteria 1420
168 Ga0307406_10148847 3300031901 Bacteria 1667
169 Ga0307406_10341357 3300031901 Unclassified 1167
170 Ga0307416_100185111 3300032002 Unclassified 1956
171 Ga0307411_10117389 3300032005 Unclassified 1917
172 Ga0307415_100260249 3300032126 Unclassified 1415
173 Ga0373934_0074225 3300035086 Bacteria 1362
174 Ga0373937_0033274 3300036401 Bacteria 4681
175 Ga0395900_0545885 3300037418 Bacteria 1104
176 Ga0395905_0406172 3300037471 Unclassified 1257
177 Ga0466966_0006196 3300044684 Bacteria 7908
178 Ga0466957_0130116 3300044842 Unclassified 1612
179 Ga0466959_0013347 3300045049 Bacteria 5955
180 Ga0466959_0069617 3300045049 Bacteria 2549
181 Ga0451576_0095314 3300045051 Bacteria 3095
182 Ga0495629_0052322 3300046459 Bacteria 2857
183 Ga0495662_0150608 3300046476 Bacteria 1146
184 Ga0495594_0244334 3300046499 Unclassified 1023
185 Ga0495596_0052500 3300046500 Bacteria 1596
186 Ga0495621_0018920 3300046539 Unclassified 2243
187 Ga0495588_0249261 3300046674 Unclassified 936
188 Ga0495623_0059321 3300046679 Unclassified 2403
189 Ga0495669_0220128 3300046684 Bacteria 910
190 Ga0495600_0014471 3300046809 Bacteria 4971
191 Ga0495600_0150532 3300046809 Unclassified 1507
192 Ga0495672_0006369 3300047320 Bacteria 9169
193 Ga0496109_0430793 3300048912 Unclassified 1246
194 Ga0496111_0362109 3300048914 Unclassified 1073
195 Ga0496112_0182804 3300048915 Unclassified 2060
196 Ga0496113_0118412 3300048916 Bacteria 2068
197 Ga0501033_0039008 3300049570 Unclassified 3548
198 Ga0501034_0037983 3300049571 Bacteria 4877
199 Ga0501038_0290723 3300049574 Bacteria 1284
200 Ga0501043_0179027 3300049579 Unclassified 1652
201 Ga0501047_0050344 3300049581 Unclassified 4023
202 Ga0501070_0455045 3300049586 Bacteria 1032
203 Ga0501035_0035365 3300049822 Unclassified 4534
204 Ga0501035_0102539 3300049822 Bacteria 2510
205 nmdc:mga05p37_837716_c1 3300050507 Bacteria 1001
206 nmdc:mga08y16_48545_c1 3300050511 Bacteria 4442
207 nmdc:mga0n895_35342_c1 3300050512 Bacteria 4817
208 Ga0070671_100098047
209 JGI24737J22298_10059476
210 Ga0065707_10195210
211 Ga0070658_10001014
212 Ga0070676_10091632
213 Ga0070683_100010257
214 Ga0070683_100029727
215 Ga0070683_100058336
216 Ga0070683_100064322
217 Ga0070683_100110787
218 Ga0070690_100001169
219 Ga0070690_100151254
220 Ga0070670_100425289
221 Ga0070677_10023724
222 Ga0070680_100009688
223 Ga0070680_100051482
224 Ga0068868_100061419
225 Ga0070687_100004995
226 Ga0070661_100057199
227 Ga0070668_100217137
228 Ga0070668_100682323
229 Ga0070669_100003783
230 Ga0070669_100208369
231 Ga0070675_100028120
232 Ga0070675_100464023
233 Ga0070674_100162029
234 Ga0070673_100413898
235 Ga0070659_100352507
236 Ga0070667_100229357
237 Ga0070709_10002273
238 Ga0070709_10081062
239 Ga0070700_100477628
240 Ga0070678_100265534
241 Ga0070662_100000382
242 Ga0070662_100056414
243 Ga0070681_10057602
244 Ga0070681_10132000
245 Ga0068867_100102121
246 Ga0068867_100454492
247 Ga0070706_100033984
248 Ga0070698_100140790
249 Ga0070679_100000633
250 Ga0070679_100001228
251 Ga0070684_100015596
252 Ga0070684_100097808
253 Ga0070684_100136878
254 Ga0070684_100163193
255 Ga0070697_100278259
256 Ga0070697_100410152
257 Ga0068853_100214954
258 Ga0070672_100359220
259 Ga0070686_100037709
260 Ga0070696_100006144
261 Ga0070665_100645897
262 Ga0070664_100047355
263 Ga0070664_100051740
264 Ga0070664_100094960
265 Ga0070664_100109712
266 Ga0070664_100266857
267 Ga0068857_100082352
268 Ga0068854_100186057
269 Ga0068856_100023550
270 Ga0068856_100448410
271 Ga0068852_100067769
272 Ga0068852_100176534
273 Ga0068859_100203372
274 Ga0068864_100197375
275 Ga0068870_10059788
276 Ga0068863_100522744
277 Ga0068858_100145494
278 Ga0068858_100242093
279 Ga0068860_100074720
280 Ga0068862_100116266
281 Ga0068862_100208757
282 Ga0070717_10076967
283 Ga0075434_100261960
284 Ga0068865_100020022
285 Ga0097620_100203357
286 Ga0111539_10080083
287 Ga0105245_10132791
288 Ga0114129_10953812
289 Ga0105243_10127025
290 Ga0105242_10014107
291 Ga0105242_10024847
292 Ga0105248_10088413
293 Ga0105249_10623550
294 Ga0105246_10334574
295 Ga0157373_10054208
296 Ga0157371_10237580
297 Ga0157369_10060915
298 Ga0157369_10149413
299 Ga0157374_10306440
300 Ga0163162_10129754
301 Ga0163162_10300209
302 Ga0157372_10050166
303 Ga0157372_10237564
304 Ga0157372_10927643
305 Ga0157375_10011432
306 Ga0157375_10011475
307 Ga0157375_10335294
308 Ga0163163_10766748
309 Ga0157380_10394459
310 Ga0157379_10428795
311 Ga0157376_10248287
312 Ga0163161_10043122
313 Ga0207682_10003359
314 Ga0207692_10217893
315 Ga0207645_10041926
316 Ga0207645_10162257
317 Ga0207643_10036110
318 Ga0207705_10015233
319 Ga0207654_10114426
320 Ga0207707_10007084
321 Ga0207707_10010363
322 Ga0207707_10092616
323 Ga0207707_10393690
324 Ga0207660_10015092
325 Ga0207662_10001579
326 Ga0207649_10033277
327 Ga0207649_10171436
328 Ga0207649_10297062
329 Ga0207652_10005621
330 Ga0207652_10300740
331 Ga0207646_10069589
332 Ga0207681_10037200
333 Ga0207681_10067841
334 Ga0207650_10318218
335 Ga0207659_10032712
336 Ga0207659_10035850
337 Ga0207644_10235621
338 Ga0207644_10248175
339 Ga0207690_10065912
340 Ga0207690_10105996
341 Ga0207706_10039258
342 Ga0207686_10015751
343 Ga0207686_10077347
344 Ga0207670_10053875
345 Ga0207704_10082675
346 Ga0207665_10000515
347 Ga0207691_10106229
348 Ga0207661_10026553
349 Ga0207661_10144828
350 Ga0207661_10279633
351 Ga0207679_10014089
352 Ga0207679_10118377
353 Ga0207679_10148375
354 Ga0207651_10110881
355 Ga0207651_10371497
356 Ga0207651_10410054
357 Ga0207712_10327735
358 Ga0207668_10232410
359 Ga0207658_10311301
360 Ga0207703_10179088
361 Ga0207639_10155397
362 Ga0207702_10020803
363 Ga0207648_10021309
364 Ga0207648_10228281
365 Ga0207675_100878913
366 Ga0207683_10416831
367 Ga0207698_10008439
368 Ga0207698_10245816
369 Ga0207698_10328416
370 Ga0268265_10061089
371 Ga0268265_10175520
372 Ga0268264_10135553
373 Ga0307408_100292296
374 Ga0307410_10234037
375 Ga0307406_10148847
376 Ga0307406_10341357
377 Ga0307416_100185111
378 Ga0307411_10117389
379 Ga0307415_100260249
380 Ga0373934_0074225
381 Ga0373937_0033274
382 Ga0395900_0545885
383 Ga0395905_0406172
384 Ga0466966_0006196
385 Ga0466957_0130116
386 Ga0466959_0013347
387 Ga0466959_0069617
388 Ga0451576_0095314
389 Ga0495629_0052322
390 Ga0495662_0150608
391 Ga0495594_0244334
392 Ga0495596_0052500
393 Ga0495621_0018920
394 Ga0495588_0249261
395 Ga0495623_0059321
396 Ga0495669_0220128
397 Ga0495600_0014471
398 Ga0495600_0150532
399 Ga0495672_0006369
400 Ga0496109_0430793
401 Ga0496111_0362109
402 Ga0496112_0182804
403 Ga0496113_0118412
404 Ga0501033_0039008
405 Ga0501034_0037983
406 Ga0501038_0290723
407 Ga0501043_0179027
408 Ga0501047_0050344
409 Ga0501070_0455045
410 Ga0501035_0035365
411 Ga0501035_0102539
412 nmdc:mga05p37_837716_c1
413 nmdc:mga08y16_48545_c1
414 nmdc:mga0n895_35342_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13645

YkuD_2

L,D-transpeptidase catalytic domain

114

288

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a1i-assembly1.cif.gz_A ykud from b.subtilis 0.8079 81 227
4qrb-assembly1.cif.gz_A structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation 0.7374 83 227
5bmq-assembly1.cif.gz_A crystal structure of l,d-transpeptidase (yku) from stackebrandtia nassauensis 0.7287 77 231
2pig-assembly1.cif.gz_A crystal structure of ydck from salmonella cholerae at 2.38 a resolution. northeast structural genomics target scr6 0.7196 144 168
4k73-assembly1.cif.gz_A x-ray crystal structure of an l,d-transpeptidase from mycobacterium tuberculosis h37rv 0.716 82 227
ID Description Score Start End Superfamily
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.7764 81 227 2.40.440.10
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.7601 81 227 2.40.440.10
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.7143 81 227 2.40.440.10
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.6957 81 227 2.40.440.10
6d5aA03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.6921 81 227 2.40.440.10
ID Description Score Start End GO Terms
AF-A0A7X5WEQ0-F1-model_v4 deleted 0.9821 117 242
AF-A0A3D4YLI4-F1-model_v4 Uncharacterized protein 0.9797 126 222
AF-A0A7X5WEQ0-F1-model_v4 deleted 0.9311 117 242
AF-A0A3D4YLI4-F1-model_v4 Uncharacterized protein 0.9236 126 222
AF-A0A350UNS3-F1-model_v4 Uncharacterized protein 0.9029 89 231

Map