F317009

General Info

Members Datasets Scaffolds Average Seq Length
207 145 414 251

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0328033|Ga0501034_0328033_70_822
Length 250
Sequence MNRRSFVAALGGIAGLPAWAQKYVPKQSDRPQPLSGEEPGFRSIFDGKSLSGWEGDPKYWSVADGCMVGVITPETVIRSNTFIIWRGGTPADFELKVTYRITKNGNSGINYRSVVVPDKVTPANQFAMRGYQCDLDGQNRYTGNNYEEKGRLFLAVRGQMTRITGAAPPTILSTFGESQELGSKIHVEDWNDVHIVARGNTLLHMINGQLMVGVIDDDPAGRTASGLLGVQVHVGPPMKVEYKNWRIKTA

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
97 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
127 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
128 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
136 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
137 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
138 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
139 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
144 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.28
Nodule 0
Rhizoplane 1.93
Rhizosphere 91.3
Stem 0
Stem Tuber 0
Unclassified 25.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0328033 3300049571 Unclassified 1462
2 Ga0065712_10002529 3300005290 Bacteria 4692
3 Ga0065712_10085433 3300005290 Unclassified 2698
4 Ga0065712_10114005 3300005290 Unclassified 1762
5 Ga0065712_10115654 3300005290 Unclassified 1748
6 Ga0065715_10002871 3300005293 Bacteria 5068
7 Ga0065715_10161416 3300005293 Unclassified 1626
8 Ga0070676_10052720 3300005328 Bacteria 2393
9 Ga0070676_10396397 3300005328 Bacteria 959
10 Ga0070683_100126876 3300005329 Bacteria 2412
11 Ga0070670_100011995 3300005331 Bacteria 7412
12 Ga0070666_10095834 3300005335 Unclassified 2042
13 Ga0068868_100093103 3300005338 Unclassified 2430
14 Ga0070691_10006239 3300005341 Bacteria 5442
15 Ga0070692_10167787 3300005345 Bacteria 1263
16 Ga0070668_100141263 3300005347 Bacteria 1940
17 Ga0070668_100159202 3300005347 Bacteria 1831
18 Ga0070669_100006933 3300005353 Bacteria 8142
19 Ga0070669_100148135 3300005353 Unclassified 1815
20 Ga0070671_100038531 3300005355 Bacteria 3968
21 Ga0070674_100017454 3300005356 Bacteria 4515
22 Ga0070667_100074291 3300005367 Bacteria 2900
23 Ga0070667_100134884 3300005367 Unclassified 2158
24 Ga0070667_100310212 3300005367 Bacteria 1422
25 Ga0070714_100037759 3300005435 Bacteria 4060
26 Ga0070705_100040330 3300005440 Bacteria 2655
27 Ga0070694_100065379 3300005444 Bacteria 2491
28 Ga0070662_100306644 3300005457 Bacteria 1291
29 Ga0068867_100021688 3300005459 Bacteria 4584
30 Ga0070707_100015715 3300005468 Bacteria 7107
31 Ga0070699_100060395 3300005518 Bacteria 3285
32 Ga0070699_100309167 3300005518 Bacteria 1419
33 Ga0070684_100202298 3300005535 Unclassified 1809
34 Ga0070684_100232833 3300005535 Bacteria 1682
35 Ga0070695_100047360 3300005545 Bacteria 2745
36 Ga0070696_100015671 3300005546 Bacteria 5092
37 Ga0070704_100012390 3300005549 Bacteria 5267
38 Ga0070704_100044236 3300005549 Bacteria 3093
39 Ga0068855_100056926 3300005563 Bacteria 4584
40 Ga0070664_100018928 3300005564 Bacteria 5662
41 Ga0068854_100017503 3300005578 Bacteria 4795
42 Ga0068852_100026287 3300005616 Unclassified 4730
43 Ga0068859_100012288 3300005617 Bacteria 8614
44 Ga0068864_100262470 3300005618 Unclassified 1607
45 Ga0068864_100782200 3300005618 Unclassified 937
46 Ga0068861_100010682 3300005719 Bacteria 6378
47 Ga0068861_100068936 3300005719 Bacteria 2735
48 Ga0068861_100560634 3300005719 Unclassified 1042
49 Ga0068863_100068211 3300005841 Unclassified 3364
50 Ga0068862_100036244 3300005844 Bacteria 4181
51 Ga0068862_100276322 3300005844 Bacteria 1538
52 Ga0081539_10062025 3300005985 Bacteria 2045
53 Ga0075368_10004053 3300006042 Bacteria 4930
54 Ga0075364_10037202 3300006051 Bacteria 3150
55 Ga0075364_10081153 3300006051 Bacteria 2144
56 Ga0075367_10104283 3300006178 Unclassified 1736
57 Ga0075366_10003094 3300006195 Bacteria 8692
58 Ga0068871_100488179 3300006358 Viruses 1109
59 Ga0068871_100529735 3300006358 Unclassified 1065
60 Ga0075428_100000021 3300006844 Bacteria 133628
61 Ga0075430_100060152 3300006846 Bacteria 3193
62 Ga0075430_100250684 3300006846 Bacteria 1467
63 Ga0075430_100384962 3300006846 Bacteria 1157
64 Ga0075431_100417836 3300006847 Bacteria 1340
65 Ga0075433_10018649 3300006852 Bacteria 5771
66 Ga0075433_10390560 3300006852 Bacteria 1228
67 Ga0075434_100733775 3300006871 Bacteria 1005
68 Ga0097620_100012288 3300006931 Bacteria 8614
69 Ga0075435_100449233 3300007076 Bacteria 1111
70 Ga0105240_10001777 3300009093 Bacteria 36386
71 Ga0105240_10265670 3300009093 Unclassified 1978
72 Ga0105240_10362655 3300009093 Unclassified 1641
73 Ga0111539_10000002 3300009094 Bacteria 983359
74 Ga0111539_10442083 3300009094 Bacteria 1514
75 Ga0105245_10074018 3300009098 Unclassified 3099
76 Ga0114129_10065102 3300009147 Bacteria 5088
77 Ga0114129_10098902 3300009147 Bacteria 4038
78 Ga0114129_10474164 3300009147 Bacteria 1638
79 Ga0105243_10041453 3300009148 Unclassified 3600
80 Ga0105241_10150817 3300009174 Bacteria 1901
81 Ga0105242_10055504 3300009176 Bacteria 3240
82 Ga0105237_10100693 3300009545 Unclassified 2881
83 Ga0105249_10025526 3300009553 Bacteria 5320
84 Ga0105249_10429050 3300009553 Bacteria 1357
85 Ga0105239_10068058 3300010375 Bacteria 3913
86 Ga0105239_10624491 3300010375 Unclassified 1230
87 Ga0157370_10013865 3300013104 Bacteria 8277
88 Ga0157369_10022057 3300013105 Bacteria 7115
89 Ga0157369_10181024 3300013105 Bacteria 2217
90 Ga0157372_10221976 3300013307 Bacteria 2190
91 Ga0163163_10113679 3300014325 Unclassified 2738
92 Ga0163163_10879007 3300014325 Bacteria 960
93 Ga0157380_10010925 3300014326 Bacteria 6548
94 Ga0157380_10075269 3300014326 Bacteria 2743
95 Ga0207697_10001082 3300025315 Bacteria 15051
96 Ga0207688_10000582 3300025901 Bacteria 17953
97 Ga0207654_10124311 3300025911 Bacteria 1624
98 Ga0207695_10019030 3300025913 Bacteria 7920
99 Ga0207660_10099611 3300025917 Bacteria 2169
100 Ga0207646_10015900 3300025922 Bacteria 7077
101 Ga0207650_10025186 3300025925 Bacteria 4237
102 Ga0207664_10025059 3300025929 Bacteria 4487
103 Ga0207644_10101414 3300025931 Unclassified 2163
104 Ga0207706_10343068 3300025933 Bacteria 1299
105 Ga0207686_10055370 3300025934 Unclassified 2488
106 Ga0207709_10037504 3300025935 Bacteria 2881
107 Ga0207669_10152402 3300025937 Unclassified 1621
108 Ga0207669_10449917 3300025937 Bacteria 1020
109 Ga0207691_10132055 3300025940 Unclassified 2205
110 Ga0207691_10359276 3300025940 Bacteria 1245
111 Ga0207661_10093082 3300025944 Bacteria 2514
112 Ga0207679_10308046 3300025945 Unclassified 1367
113 Ga0207667_10018734 3300025949 Bacteria 7753
114 Ga0207712_10198003 3300025961 Bacteria 1591
115 Ga0207668_10386594 3300025972 Bacteria 1179
116 Ga0207658_10139826 3300025986 Unclassified 1958
117 Ga0207658_10283394 3300025986 Bacteria 1421
118 Ga0207708_10135553 3300026075 Bacteria 1928
119 Ga0207641_10115007 3300026088 Bacteria 2391
120 Ga0207676_10294268 3300026095 Unclassified 1480
121 Ga0207675_100100336 3300026118 Bacteria 2727
122 Ga0207675_100234865 3300026118 Bacteria 1770
123 Ga0207698_10017216 3300026142 Unclassified 4897
124 Ga0207428_10000026 3300027907 Bacteria 255539
125 Ga0207428_10013297 3300027907 Bacteria 7195
126 Ga0268265_10249522 3300028380 Bacteria 1571
127 Ga0307408_100088254 3300031548 Bacteria 2335
128 Ga0307408_100318548 3300031548 Unclassified 1309
129 Ga0307410_10232913 3300031852 Bacteria 1423
130 Ga0307409_100174579 3300031995 Bacteria 1895
131 Ga0307416_100075767 3300032002 Unclassified 2817
132 Ga0307416_100636949 3300032002 Bacteria 1149
133 Ga0436364_0534248 3300037853 Bacteria 1265
134 Ga0450923_022299 3300042125 Bacteria 1240
135 Ga0439435_0027570 3300042436 Unclassified 1521
136 Ga0451576_0517311 3300045051 Bacteria 1254
137 Ga0466958_0133690 3300045836 Unclassified 1559
138 Ga0495603_0065285 3300046455 Unclassified 2145
139 Ga0495638_0047565 3300046460 Bacteria 2689
140 Ga0496102_0102536 3300048905 Bacteria 2660
141 Ga0496106_0083840 3300048909 Bacteria 2452
142 Ga0496110_0020507 3300048913 Bacteria 5581
143 Ga0496112_0034809 3300048915 Bacteria 4902
144 Ga0501032_0234491 3300049569 Bacteria 1193
145 Ga0501036_0130499 3300049572 Bacteria 2122
146 Ga0501038_0089609 3300049574 Bacteria 2580
147 Ga0501039_0356360 3300049575 Unclassified 1149
148 Ga0501040_0097287 3300049576 Bacteria 2050
149 Ga0501040_0749141 3300049576 Bacteria 707
150 Ga0501041_0157370 3300049577 Bacteria 1420
151 Ga0501041_0350685 3300049577 Bacteria 933
152 Ga0501042_0228191 3300049578 Unclassified 1343
153 Ga0501042_0342775 3300049578 Unclassified 1080
154 Ga0501046_0040460 3300049580 Bacteria 3725
155 Ga0501048_0281674 3300049582 Unclassified 1182
156 Ga0501071_0064668 3300049587 Bacteria 2654
157 Ga0501071_0075591 3300049587 Bacteria 2459
158 Ga0501071_0327423 3300049587 Bacteria 1164
159 Ga0501071_0423925 3300049587 Bacteria 1017
160 Ga0501072_0022684 3300049588 Bacteria 4870
161 Ga0501072_0051680 3300049588 Bacteria 3236
162 Ga0501072_0405317 3300049588 Unclassified 1081
163 Ga0501072_0423692 3300049588 Unclassified 1055
164 Ga0501073_0055098 3300049589 Bacteria 2783
165 Ga0501074_0065154 3300049590 Bacteria 2623
166 Ga0501075_0039753 3300049591 Bacteria 3520
167 Ga0501075_0046264 3300049591 Bacteria 3269
168 Ga0501075_0271300 3300049591 Bacteria 1293
169 Ga0501076_0002357 3300049592 Bacteria 12930
170 Ga0501076_0145436 3300049592 Bacteria 1927
171 Ga0501076_0418493 3300049592 Unclassified 1102
172 Ga0501077_0269467 3300049593 Unclassified 1083
173 Ga0501079_0083375 3300049741 Bacteria 2473
174 Ga0501079_0330883 3300049741 Bacteria 1193
175 Ga0501080_0116491 3300049742 Bacteria 2477
176 Ga0501081_0119315 3300049743 Bacteria 1877
177 Ga0501081_0232148 3300049743 Bacteria 1344
178 Ga0501083_0067543 3300049744 Bacteria 2380
179 Ga0501045_0173283 3300049824 Unclassified 1607
180 nmdc:mga0k408_171333_c1 3300050493 Unclassified 1294
181 nmdc:mga0k408_271666_c1 3300050493 Bacteria 1012
182 nmdc:mga06z11_256168_c1 3300050494 Bacteria 1031
183 nmdc:mga05p37_792948_c1 3300050507 Unclassified 1038
184 nmdc:mga0qj67_174352_c1 3300050509 Unclassified 956
185 nmdc:mga0qj67_285353_c1 3300050509 Bacteria 1338
186 nmdc:mga0qj67_43890_c1 3300050509 Unclassified 3521
187 nmdc:mga0qj67_49889_c1 3300050509 Bacteria 3308
188 nmdc:mga06r32_394675_c1 3300050510 Unclassified 1366
189 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
190 nmdc:mga08y16_5963_c1 3300050511 Bacteria 12779
191 nmdc:mga0rr50_413597_c1 3300050513 Bacteria 1140
192 nmdc:mga0a205_390044_c1 3300050515 Bacteria 1257
193 nmdc:mga0a205_476468_c1 3300050515 Bacteria 1107
194 Ga0500651_0039085 3300053093 Bacteria 2989
195 Ga0500555_000434 3300053103 Bacteria 17306
196 Ga0500556_0005145 3300053104 Bacteria 3699
197 Ga0500568_0004631 3300053139 Bacteria 7313
198 Ga0500645_000271 3300053730 Bacteria 37062
199 Ga0501084_0107646 3300054114 Bacteria 2342
200 Ga0501084_0490292 3300054114 Unclassified 1038
201 Ga0590071_000135 3300059421 Bacteria 20700
202 Ga0590074_002078 3300059423 Bacteria 3275
203 Ga0590075_000575 3300059424 Bacteria 9951
204 Ga0590075_006000 3300059424 Viruses 2875
205 Ga0590077_000564 3300059426 Bacteria 10240
206 Ga0501082_0043267 3300060353 Bacteria 3883
207 Ga0501082_0322650 3300060353 Bacteria 1346
208 Ga0501034_0328033
209 Ga0065712_10002529
210 Ga0065712_10085433
211 Ga0065712_10114005
212 Ga0065712_10115654
213 Ga0065715_10002871
214 Ga0065715_10161416
215 Ga0070676_10052720
216 Ga0070676_10396397
217 Ga0070683_100126876
218 Ga0070670_100011995
219 Ga0070666_10095834
220 Ga0068868_100093103
221 Ga0070691_10006239
222 Ga0070692_10167787
223 Ga0070668_100141263
224 Ga0070668_100159202
225 Ga0070669_100006933
226 Ga0070669_100148135
227 Ga0070671_100038531
228 Ga0070674_100017454
229 Ga0070667_100074291
230 Ga0070667_100134884
231 Ga0070667_100310212
232 Ga0070714_100037759
233 Ga0070705_100040330
234 Ga0070694_100065379
235 Ga0070662_100306644
236 Ga0068867_100021688
237 Ga0070707_100015715
238 Ga0070699_100060395
239 Ga0070699_100309167
240 Ga0070684_100202298
241 Ga0070684_100232833
242 Ga0070695_100047360
243 Ga0070696_100015671
244 Ga0070704_100012390
245 Ga0070704_100044236
246 Ga0068855_100056926
247 Ga0070664_100018928
248 Ga0068854_100017503
249 Ga0068852_100026287
250 Ga0068859_100012288
251 Ga0068864_100262470
252 Ga0068864_100782200
253 Ga0068861_100010682
254 Ga0068861_100068936
255 Ga0068861_100560634
256 Ga0068863_100068211
257 Ga0068862_100036244
258 Ga0068862_100276322
259 Ga0081539_10062025
260 Ga0075368_10004053
261 Ga0075364_10037202
262 Ga0075364_10081153
263 Ga0075367_10104283
264 Ga0075366_10003094
265 Ga0068871_100488179
266 Ga0068871_100529735
267 Ga0075428_100000021
268 Ga0075430_100060152
269 Ga0075430_100250684
270 Ga0075430_100384962
271 Ga0075431_100417836
272 Ga0075433_10018649
273 Ga0075433_10390560
274 Ga0075434_100733775
275 Ga0097620_100012288
276 Ga0075435_100449233
277 Ga0105240_10001777
278 Ga0105240_10265670
279 Ga0105240_10362655
280 Ga0111539_10000002
281 Ga0111539_10442083
282 Ga0105245_10074018
283 Ga0114129_10065102
284 Ga0114129_10098902
285 Ga0114129_10474164
286 Ga0105243_10041453
287 Ga0105241_10150817
288 Ga0105242_10055504
289 Ga0105237_10100693
290 Ga0105249_10025526
291 Ga0105249_10429050
292 Ga0105239_10068058
293 Ga0105239_10624491
294 Ga0157370_10013865
295 Ga0157369_10022057
296 Ga0157369_10181024
297 Ga0157372_10221976
298 Ga0163163_10113679
299 Ga0163163_10879007
300 Ga0157380_10010925
301 Ga0157380_10075269
302 Ga0207697_10001082
303 Ga0207688_10000582
304 Ga0207654_10124311
305 Ga0207695_10019030
306 Ga0207660_10099611
307 Ga0207646_10015900
308 Ga0207650_10025186
309 Ga0207664_10025059
310 Ga0207644_10101414
311 Ga0207706_10343068
312 Ga0207686_10055370
313 Ga0207709_10037504
314 Ga0207669_10152402
315 Ga0207669_10449917
316 Ga0207691_10132055
317 Ga0207691_10359276
318 Ga0207661_10093082
319 Ga0207679_10308046
320 Ga0207667_10018734
321 Ga0207712_10198003
322 Ga0207668_10386594
323 Ga0207658_10139826
324 Ga0207658_10283394
325 Ga0207708_10135553
326 Ga0207641_10115007
327 Ga0207676_10294268
328 Ga0207675_100100336
329 Ga0207675_100234865
330 Ga0207698_10017216
331 Ga0207428_10000026
332 Ga0207428_10013297
333 Ga0268265_10249522
334 Ga0307408_100088254
335 Ga0307408_100318548
336 Ga0307410_10232913
337 Ga0307409_100174579
338 Ga0307416_100075767
339 Ga0307416_100636949
340 Ga0436364_0534248
341 Ga0450923_022299
342 Ga0439435_0027570
343 Ga0451576_0517311
344 Ga0466958_0133690
345 Ga0495603_0065285
346 Ga0495638_0047565
347 Ga0496102_0102536
348 Ga0496106_0083840
349 Ga0496110_0020507
350 Ga0496112_0034809
351 Ga0501032_0234491
352 Ga0501036_0130499
353 Ga0501038_0089609
354 Ga0501039_0356360
355 Ga0501040_0097287
356 Ga0501040_0749141
357 Ga0501041_0157370
358 Ga0501041_0350685
359 Ga0501042_0228191
360 Ga0501042_0342775
361 Ga0501046_0040460
362 Ga0501048_0281674
363 Ga0501071_0064668
364 Ga0501071_0075591
365 Ga0501071_0327423
366 Ga0501071_0423925
367 Ga0501072_0022684
368 Ga0501072_0051680
369 Ga0501072_0405317
370 Ga0501072_0423692
371 Ga0501073_0055098
372 Ga0501074_0065154
373 Ga0501075_0039753
374 Ga0501075_0046264
375 Ga0501075_0271300
376 Ga0501076_0002357
377 Ga0501076_0145436
378 Ga0501076_0418493
379 Ga0501077_0269467
380 Ga0501079_0083375
381 Ga0501079_0330883
382 Ga0501080_0116491
383 Ga0501081_0119315
384 Ga0501081_0232148
385 Ga0501083_0067543
386 Ga0501045_0173283
387 nmdc:mga0k408_171333_c1
388 nmdc:mga0k408_271666_c1
389 nmdc:mga06z11_256168_c1
390 nmdc:mga05p37_792948_c1
391 nmdc:mga0qj67_174352_c1
392 nmdc:mga0qj67_285353_c1
393 nmdc:mga0qj67_43890_c1
394 nmdc:mga0qj67_49889_c1
395 nmdc:mga06r32_394675_c1
396 nmdc:mga08y16_2_c1
397 nmdc:mga08y16_5963_c1
398 nmdc:mga0rr50_413597_c1
399 nmdc:mga0a205_390044_c1
400 nmdc:mga0a205_476468_c1
401 Ga0500651_0039085
402 Ga0500555_000434
403 Ga0500556_0005145
404 Ga0500568_0004631
405 Ga0500645_000271
406 Ga0501084_0107646
407 Ga0501084_0490292
408 Ga0590071_000135
409 Ga0590074_002078
410 Ga0590075_000575
411 Ga0590075_006000
412 Ga0590077_000564
413 Ga0501082_0043267
414 Ga0501082_0322650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

40

248

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jqt-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bt3469) from bacteroides thetaiotaomicron vpi-5482 at 2.49 a resolution 0.8569 40 246
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.6924 39 247
4uw5-assembly6.cif.gz_F human galectin-7 in complex with a galactose based dendron d2-2. 0.6683 90 245
3imm-assembly3.cif.gz_C crystal structure of putative glycosyl hydrolase (yp_001301887.1) from parabacteroides distasonis atcc 8503 at 2.00 a resolution 0.6677 40 248
5nxb-assembly1.cif.gz_B mouse galactocerebrosidase in complex with saposin a 0.6676 65 248
ID Description Score Start End Superfamily
4jqtB01 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8511 40 246 2.60.120.560
4jqtB01 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7862 40 246 2.60.120.560
af_Q8IK83_1050_1219_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7004 62 243 2.60.120.560
af_A0A5K1K8Q0_451_608_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.6998 47 243 2.60.120.560
af_A0A5K1K8Q0_451_608_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.6931 47 243 2.60.120.560
ID Description Score Start End GO Terms
AF-A0A290Q1I5-F1-model_v4 Glycosyl hydrolase 0.9902 16 248 GO:0016787
AF-A0A2N9N386-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9882 16 248 GO:0016787
AF-A0A2V8IZN3-F1-model_v4 DUF1080 domain-containing protein 0.9804 25 248 GO:0016787
AF-W6U2D1-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9757 37 248 GO:0016787
AF-A0A7Y4UAK2-F1-model_v4 DUF1080 domain-containing protein 0.9685 32 248 GO:0016787

Map