F316665

General Info

Members Datasets Scaffolds Average Seq Length
207 139 414 350

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10034182|Ga0307405_100341822
Length 383
Sequence VTFQLEAAVAARSFDVSLTVGPMETVAVMGPNGAGKSTLLAVIAGLLRPDTGMAHLDGRSLFDLGAGRSAWTAPHHRGTALLAQEPMLFPHLTALENVAFGPRSRGLSRSRARDAGRHWLRAVDAAELESRRPAELSGGQAQRVAVARALAADPGLLLLDEPMAALDIHAAPLLRRLLKRVLEGRRAIIITHDVLDALMLADRVVVLENGKISEAGATRDVLQRPKSRFAAGLAGLNLVAGTLTEHGIRTADGQDIAGLHDPQLDVPHPHIPXXEAATASAAGNGVQERSAAGNAGLLAPGRDGVAVFPPSAVSVFLTEAHGSPRNSFPVTITDLEPHGDQIRVRAGGLSADVTPAASADLGLAPGMKVFFVIKAGAVSVYPA

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
5 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
6 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
7 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
8 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
9 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
10 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
11 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
12 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
13 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
14 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
15 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
16 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
17 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
27 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
28 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
29 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
30 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
31 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
32 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
33 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
34 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
35 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
36 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
37 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
38 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
41 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
42 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
43 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
44 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
45 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
46 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
47 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
48 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
49 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
50 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
51 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
52 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
53 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
54 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
55 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
56 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
57 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
58 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
59 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
64 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
65 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
66 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
67 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
68 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
69 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
70 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
71 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
72 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
73 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
74 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
75 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
76 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
77 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
78 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
79 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
80 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
81 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
82 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
85 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
86 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
87 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
99 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
100 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
101 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
102 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
103 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
104 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
105 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
106 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
107 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
108 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
109 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
110 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
111 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
112 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
113 2808606394 Promicromonospora sp. C35 Isolate Unclassified
114 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
115 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
116 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
117 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
118 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
119 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
120 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
121 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
122 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
123 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
124 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
125 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
126 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
127 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
128 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
129 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
130 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
131 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
132 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
133 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
134 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
135 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
136 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
137 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
138 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
139 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.16
Metatranscriptomes 0
Isolates 18.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.31
Nodule 0
Rhizoplane 7.73
Rhizosphere 77.29
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10034182 3300031731 Bacteria 3022
2 JGI25152J39213_1000068 3300002773 Bacteria 68180
3 Ga0070714_100000022 3300005435 Bacteria 158523
4 Ga0075365_10051334 3300006038 Bacteria 2723
5 Ga0075364_10006261 3300006051 Bacteria 6982
6 Ga0105245_10160295 3300009098 Bacteria 2134
7 Ga0105243_10036999 3300009148 Bacteria 3791
8 Ga0105249_10636681 3300009553 Bacteria 1123
9 Ga0105246_10008141 3300011119 Bacteria 6436
10 Ga0105246_10048936 3300011119 Bacteria 2892
11 Ga0105246_10064813 3300011119 Bacteria 2553
12 Ga0157369_10041013 3300013105 Bacteria 5053
13 Ga0157369_10306089 3300013105 Bacteria 1653
14 Ga0163162_10015277 3300013306 Bacteria 7499
15 Ga0157375_10093850 3300013308 Bacteria 3067
16 Ga0207425_1002555 3300025245 Bacteria 6333
17 Ga0209129_1000052 3300025258 Bacteria 265251
18 Ga0209025_1000895 3300025294 Bacteria 46371
19 Ga0209051_1021240 3300025303 Bacteria 2770
20 Ga0209051_1036459 3300025303 Bacteria 1815
21 Ga0207697_10001900 3300025315 Bacteria 11135
22 Ga0207655_1007475 3300025728 Bacteria 7082
23 Ga0207682_10006471 3300025893 Bacteria 4714
24 Ga0207688_10105302 3300025901 Bacteria 1633
25 Ga0207645_10012883 3300025907 Bacteria 5660
26 Ga0207643_10064393 3300025908 Bacteria 2098
27 Ga0207664_10000015 3300025929 Bacteria 246475
28 Ga0207691_10002435 3300025940 Bacteria 18208
29 Ga0207683_10053827 3300026121 Bacteria 3529
30 Ga0207428_10012975 3300027907 Bacteria 7300
31 Ga0307408_100014294 3300031548 Bacteria 5273
32 Ga0307408_100021191 3300031548 Bacteria 4395
33 Ga0307408_100022583 3300031548 Bacteria 4277
34 Ga0307408_100082869 3300031548 Bacteria 2401
35 Ga0307408_100102447 3300031548 Bacteria 2183
36 Ga0307408_100169673 3300031548 Bacteria 1741
37 Ga0307405_10007323 3300031731 Bacteria 5505
38 Ga0307405_10019056 3300031731 Bacteria 3801
39 Ga0307405_10103527 3300031731 Bacteria 1914
40 Ga0307413_10022420 3300031824 Bacteria 3403
41 Ga0307413_10105570 3300031824 Bacteria 1873
42 Ga0307413_10112130 3300031824 Bacteria 1828
43 Ga0307413_10129553 3300031824 Bacteria 1724
44 Ga0307410_10012696 3300031852 Bacteria 4881
45 Ga0307410_10036626 3300031852 Bacteria 3196
46 Ga0307410_10124012 3300031852 Bacteria 1888
47 Ga0307410_10166649 3300031852 Bacteria 1656
48 Ga0307406_10121802 3300031901 Bacteria 1815
49 Ga0307407_10030075 3300031903 Bacteria 2926
50 Ga0307412_10003767 3300031911 Bacteria 8425
51 Ga0307412_10022172 3300031911 Bacteria 3889
52 Ga0307412_10024338 3300031911 Bacteria 3738
53 Ga0307412_10052150 3300031911 Bacteria 2707
54 Ga0307412_10092888 3300031911 Bacteria 2115
55 Ga0307409_100047551 3300031995 Bacteria 3257
56 Ga0307409_100135760 3300031995 Bacteria 2111
57 Ga0307416_100069796 3300032002 Bacteria 2910
58 Ga0307416_100140744 3300032002 Bacteria 2192
59 Ga0307416_100174870 3300032002 Bacteria 2004
60 Ga0307416_100190742 3300032002 Bacteria 1932
61 Ga0307416_100257736 3300032002 Bacteria 1702
62 Ga0307416_100380300 3300032002 Bacteria 1442
63 Ga0307411_10244788 3300032005 Bacteria 1406
64 Ga0307415_100007158 3300032126 Bacteria 6080
65 Ga0307415_100091270 3300032126 Bacteria 2206
66 Ga0395899_0021081 3300037312 Bacteria 4942
67 Ga0395899_0156028 3300037312 Bacteria 1615
68 Ga0395900_0074941 3300037418 Bacteria 3478
69 Ga0395900_0078405 3300037418 Bacteria 3394
70 Ga0395898_0077082 3300037466 Bacteria 3218
71 Ga0395898_0258938 3300037466 Bacteria 1659
72 Ga0395905_0179992 3300037471 Bacteria 1985
73 Ga0395905_0352090 3300037471 Bacteria 1365
74 Ga0395901_0012873 3300038443 Bacteria 8483
75 Ga0395901_0065508 3300038443 Bacteria 3783
76 Ga0395901_0276891 3300038443 Bacteria 1744
77 Ga0439436_0018716 3300041404 Bacteria 2070
78 Ga0439436_0019614 3300041404 Bacteria 2017
79 Ga0439438_024373 3300041405 Bacteria 1657
80 Ga0439439_0006237 3300041406 Bacteria 2754
81 Ga0439447_010642 3300041407 Bacteria 2721
82 Ga0439466_0004392 3300041411 Bacteria 5430
83 Ga0439466_0017970 3300041411 Bacteria 2541
84 Ga0439465_0005069 3300041413 Bacteria 4227
85 Ga0439431_0017134 3300041997 Bacteria 1701
86 Ga0439433_0000437 3300041999 Bacteria 7631
87 Ga0439433_0005557 3300041999 Bacteria 2705
88 Ga0439442_000215 3300042002 Bacteria 14384
89 Ga0439442_000843 3300042002 Bacteria 6305
90 Ga0439442_003271 3300042002 Bacteria 3203
91 Ga0439442_023025 3300042002 Bacteria 1294
92 Ga0439449_0011183 3300042007 Bacteria 3379
93 Ga0439449_0026571 3300042007 Bacteria 2160
94 Ga0439452_011371 3300042010 Bacteria 2560
95 Ga0439457_009614 3300042014 Bacteria 2247
96 Ga0450919_001993 3300042121 Bacteria 2651
97 Ga0450919_008550 3300042121 Bacteria 1182
98 Ga0450920_003454 3300042122 Bacteria 2737
99 Ga0450920_003837 3300042122 Bacteria 2616
100 Ga0450920_004400 3300042122 Bacteria 2475
101 Ga0450907_000277 3300042146 Bacteria 17239
102 Ga0450907_002618 3300042146 Bacteria 3370
103 Ga0450907_005999 3300042146 Bacteria 2037
104 Ga0450908_000450 3300042184 Bacteria 7949
105 Ga0450908_017381 3300042184 Bacteria 1277
106 Ga0439434_0010562 3300042435 Bacteria 2722
107 Ga0450918_000176 3300042531 Bacteria 14255
108 Ga0450918_013255 3300042531 Bacteria 1434
109 Ga0466965_0065694 3300044683 Bacteria 1818
110 Ga0466960_0136290 3300044901 Bacteria 1300
111 Ga0466967_0177199 3300045976 Bacteria 2009
112 Ga0495629_0058619 3300046459 Bacteria 2692
113 Ga0495653_0011758 3300046463 Bacteria 7148
114 Ga0495580_0009727 3300046472 Bacteria 7542
115 Ga0495639_0001277 3300046475 Bacteria 11312
116 Ga0495664_0018746 3300046477 Bacteria 3970
117 Ga0495610_0124514 3300046512 Bacteria 1126
118 Ga0495665_0000223 3300046531 Bacteria 28631
119 Ga0495587_0019049 3300046536 Bacteria 4252
120 Ga0495645_0026586 3300046543 Bacteria 4201
121 Ga0495645_0043703 3300046543 Bacteria 3269
122 Ga0495633_0044429 3300046558 Bacteria 2106
123 Ga0495667_0012135 3300046559 Bacteria 5838
124 Ga0495656_0035100 3300046615 Bacteria 2058
125 Ga0495670_0009205 3300046691 Bacteria 4857
126 Ga0495670_0012481 3300046691 Bacteria 4180
127 Ga0495670_0100354 3300046691 Bacteria 1490
128 Ga0495671_0090706 3300046692 Bacteria 1496
129 Ga0495600_0029186 3300046809 Bacteria 3570
130 Ga0495581_0101615 3300047315 Bacteria 1670
131 Ga0495636_0010799 3300047318 Bacteria 3611
132 Ga0495680_0013925 3300047322 Bacteria 6996
133 Ga0496100_0032145 3300048903 Bacteria 3268
134 Ga0496101_0003726 3300048904 Bacteria 9506
135 Ga0496102_0015125 3300048905 Bacteria 6719
136 Ga0496102_0016668 3300048905 Bacteria 6426
137 Ga0496102_0035536 3300048905 Bacteria 4485
138 Ga0496102_0039568 3300048905 Bacteria 4260
139 Ga0496102_0109210 3300048905 Bacteria 2577
140 Ga0496102_0190084 3300048905 Bacteria 1934
141 Ga0496103_0025185 3300048906 Bacteria 3594
142 Ga0496106_0005978 3300048909 Bacteria 8994
143 Ga0496107_0002897 3300048910 Bacteria 11335
144 Ga0496108_0137482 3300048911 Bacteria 2103
145 Ga0496108_0216959 3300048911 Bacteria 1661
146 Ga0496109_0195049 3300048912 Bacteria 1903
147 Ga0496110_0096262 3300048913 Bacteria 2652
148 Ga0496113_0257659 3300048916 Bacteria 1393
149 Ga0496125_0097541 3300048928 Bacteria 2178
150 Ga0501032_0001966 3300049569 Bacteria 16169
151 Ga0501032_0005591 3300049569 Bacteria 9314
152 Ga0501032_0182051 3300049569 Bacteria 1375
153 Ga0501034_0000066 3300049571 Bacteria 184727
154 Ga0501037_0176071 3300049573 Bacteria 1519
155 Ga0501038_0014785 3300049574 Bacteria 7109
156 Ga0501038_0038482 3300049574 Bacteria 4188
157 Ga0501038_0050484 3300049574 Bacteria 3593
158 Ga0501038_0164716 3300049574 Bacteria 1799
159 Ga0501038_0200228 3300049574 Bacteria 1603
160 Ga0501038_0256034 3300049574 Bacteria 1385
161 Ga0501038_0262324 3300049574 Bacteria 1365
162 Ga0501039_0024485 3300049575 Bacteria 4636
163 Ga0501039_0060881 3300049575 Bacteria 2923
164 Ga0501039_0120635 3300049575 Bacteria 2055
165 Ga0501043_0120473 3300049579 Bacteria 2057
166 nmdc:mga03n38_127544_c1 3300050490 Bacteria 1257
167 nmdc:mga0sz30_16936_c1 3300050516 Bacteria 2900
168 Ga0500568_0013561 3300053139 Bacteria 3711
169 2645722670 2643221961 Bacteria 3919167
170 2645725630 2643221962 Bacteria 3874254
171 2691515595 2690315906 Bacteria 4517044
172 2739608278 2739367654 Bacteria 6049412
173 2760305629 2758568522 Bacteria 5953541
174 2760625871 2758568621 Bacteria 5967089
175 2775657509 2775506735 Bacteria 4556596
176 2808828730 2808606357 Bacteria 4466944
177 2808849995 2808606360 Bacteria 4404006
178 2808877442 2808606366 Bacteria 4415912
179 2808892981 2808606370 Bacteria 4942454
180 2808898922 2808606371 Bacteria 4251511
181 2809030890 2808606394 Bacteria 6248540
182 2812319543 2811994871 Bacteria 4497550
183 2844850924 2844849076 Bacteria 4091819
184 2857742963 2857740372 Bacteria 4782044
185 2904500880 2904497146 Bacteria 4731781
186 2904779167 2904776348 Bacteria 4658726
187 2910813750 2910809715 Bacteria 4982797
188 2919037291 2919034639 Bacteria 4763403
189 2919052886 2919051321 Bacteria 4210889
190 2919061405 2919059106 Bacteria 4991624
191 2919394350 2919391150 Bacteria 4884741
192 2919542833 2919538618 Bacteria 4677069
193 2932429903 2932426870 Bacteria 4547726
194 2933419344 2933418574 Bacteria 4476724
195 2939602329 2939598168 Bacteria 4687164
196 2939650739 2939647034 Bacteria 4681660
197 2939675813 2939674588 Bacteria 4844420
198 2945917288 2945916053 Bacteria 4555517
199 2945922465 2945920336 Bacteria 4501603
200 2945941334 2945941187 Bacteria 4682474
201 2945960778 2945956166 Bacteria 5110334
202 2946037253 2946037020 Bacteria 4900426
203 2946061129 2946059875 Bacteria 4386623
204 2953998499 2953998280 Bacteria 4812144
205 2974305275 2974302888 Bacteria 4369871
206 8054109262 8054107350 Bacteria 5022511
207 8057349372 8057345674 Bacteria 4160394
208 Ga0307405_10034182
209 JGI25152J39213_1000068
210 Ga0070714_100000022
211 Ga0075365_10051334
212 Ga0075364_10006261
213 Ga0105245_10160295
214 Ga0105243_10036999
215 Ga0105249_10636681
216 Ga0105246_10008141
217 Ga0105246_10048936
218 Ga0105246_10064813
219 Ga0157369_10041013
220 Ga0157369_10306089
221 Ga0163162_10015277
222 Ga0157375_10093850
223 Ga0207425_1002555
224 Ga0209129_1000052
225 Ga0209025_1000895
226 Ga0209051_1021240
227 Ga0209051_1036459
228 Ga0207697_10001900
229 Ga0207655_1007475
230 Ga0207682_10006471
231 Ga0207688_10105302
232 Ga0207645_10012883
233 Ga0207643_10064393
234 Ga0207664_10000015
235 Ga0207691_10002435
236 Ga0207683_10053827
237 Ga0207428_10012975
238 Ga0307408_100014294
239 Ga0307408_100021191
240 Ga0307408_100022583
241 Ga0307408_100082869
242 Ga0307408_100102447
243 Ga0307408_100169673
244 Ga0307405_10007323
245 Ga0307405_10019056
246 Ga0307405_10103527
247 Ga0307413_10022420
248 Ga0307413_10105570
249 Ga0307413_10112130
250 Ga0307413_10129553
251 Ga0307410_10012696
252 Ga0307410_10036626
253 Ga0307410_10124012
254 Ga0307410_10166649
255 Ga0307406_10121802
256 Ga0307407_10030075
257 Ga0307412_10003767
258 Ga0307412_10022172
259 Ga0307412_10024338
260 Ga0307412_10052150
261 Ga0307412_10092888
262 Ga0307409_100047551
263 Ga0307409_100135760
264 Ga0307416_100069796
265 Ga0307416_100140744
266 Ga0307416_100174870
267 Ga0307416_100190742
268 Ga0307416_100257736
269 Ga0307416_100380300
270 Ga0307411_10244788
271 Ga0307415_100007158
272 Ga0307415_100091270
273 Ga0395899_0021081
274 Ga0395899_0156028
275 Ga0395900_0074941
276 Ga0395900_0078405
277 Ga0395898_0077082
278 Ga0395898_0258938
279 Ga0395905_0179992
280 Ga0395905_0352090
281 Ga0395901_0012873
282 Ga0395901_0065508
283 Ga0395901_0276891
284 Ga0439436_0018716
285 Ga0439436_0019614
286 Ga0439438_024373
287 Ga0439439_0006237
288 Ga0439447_010642
289 Ga0439466_0004392
290 Ga0439466_0017970
291 Ga0439465_0005069
292 Ga0439431_0017134
293 Ga0439433_0000437
294 Ga0439433_0005557
295 Ga0439442_000215
296 Ga0439442_000843
297 Ga0439442_003271
298 Ga0439442_023025
299 Ga0439449_0011183
300 Ga0439449_0026571
301 Ga0439452_011371
302 Ga0439457_009614
303 Ga0450919_001993
304 Ga0450919_008550
305 Ga0450920_003454
306 Ga0450920_003837
307 Ga0450920_004400
308 Ga0450907_000277
309 Ga0450907_002618
310 Ga0450907_005999
311 Ga0450908_000450
312 Ga0450908_017381
313 Ga0439434_0010562
314 Ga0450918_000176
315 Ga0450918_013255
316 Ga0466965_0065694
317 Ga0466960_0136290
318 Ga0466967_0177199
319 Ga0495629_0058619
320 Ga0495653_0011758
321 Ga0495580_0009727
322 Ga0495639_0001277
323 Ga0495664_0018746
324 Ga0495610_0124514
325 Ga0495665_0000223
326 Ga0495587_0019049
327 Ga0495645_0026586
328 Ga0495645_0043703
329 Ga0495633_0044429
330 Ga0495667_0012135
331 Ga0495656_0035100
332 Ga0495670_0009205
333 Ga0495670_0012481
334 Ga0495670_0100354
335 Ga0495671_0090706
336 Ga0495600_0029186
337 Ga0495581_0101615
338 Ga0495636_0010799
339 Ga0495680_0013925
340 Ga0496100_0032145
341 Ga0496101_0003726
342 Ga0496102_0015125
343 Ga0496102_0016668
344 Ga0496102_0035536
345 Ga0496102_0039568
346 Ga0496102_0109210
347 Ga0496102_0190084
348 Ga0496103_0025185
349 Ga0496106_0005978
350 Ga0496107_0002897
351 Ga0496108_0137482
352 Ga0496108_0216959
353 Ga0496109_0195049
354 Ga0496110_0096262
355 Ga0496113_0257659
356 Ga0496125_0097541
357 Ga0501032_0001966
358 Ga0501032_0005591
359 Ga0501032_0182051
360 Ga0501034_0000066
361 Ga0501037_0176071
362 Ga0501038_0014785
363 Ga0501038_0038482
364 Ga0501038_0050484
365 Ga0501038_0164716
366 Ga0501038_0200228
367 Ga0501038_0256034
368 Ga0501038_0262324
369 Ga0501039_0024485
370 Ga0501039_0060881
371 Ga0501039_0120635
372 Ga0501043_0120473
373 nmdc:mga03n38_127544_c1
374 nmdc:mga0sz30_16936_c1
375 Ga0500568_0013561
376 2645722670
377 2645725630
378 2691515595
379 2739608278
380 2760305629
381 2760625871
382 2775657509
383 2808828730
384 2808849995
385 2808877442
386 2808892981
387 2808898922
388 2809030890
389 2812319543
390 2844850924
391 2857742963
392 2904500880
393 2904779167
394 2910813750
395 2919037291
396 2919052886
397 2919061405
398 2919394350
399 2919542833
400 2932429903
401 2933419344
402 2939602329
403 2939650739
404 2939675813
405 2945917288
406 2945922465
407 2945941334
408 2945960778
409 2946037253
410 2946061129
411 2953998499
412 2974305275
413 8054109262
414 8057349372

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

14

164

0.91

PF03459

TOBE

TOBE domain

322

380

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9134 3 231
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9057 1 233
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.903 3 233
7z19-assembly1.cif.gz_I e. coli c-p lyase bound to a single phnk abc domain 0.9014 3 233
1b0u-assembly1.cif.gz_A-2 atp-binding subunit of the histidine permease from salmonella typhimurium 0.901 2 232
ID Description Score Start End Superfamily
af_P9WQL3_14_245_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9389 12 238 3.40.50.300
af_P31548_12_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.935 10 229 3.40.50.300
af_P09833_10_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9236 10 224 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9223 3 236 3.40.50.300
af_P31548_12_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9184 10 229 3.40.50.300
ID Description Score Start End GO Terms
AF-K1XRC7-F1-model_v4 ABC transporter domain-containing protein 0.96 78 198 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-U3BNP7-F1-model_v4 Putative ABC transporter ATP-binding protein 0.9315 79 216 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705
AF-A0A7H4SIF3-F1-model_v4 deleted 0.9245 1 153
AF-A0A382Y6E1-F1-model_v4 Uncharacterized protein 0.9238 86 233 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A6I1NNV7-F1-model_v4 ATP-binding cassette domain-containing protein 0.923 29 180 GO:0005524
GO:0016887

Map