F315672

General Info

Members Datasets Scaffolds Average Seq Length
206 162 410 136

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0006207|Ga0501034_0006207_3094_3558
Length 154
Sequence MSDDPRQTASLSRPAAPIRITGAIALDPAEIQESFVRAGGPGGQHVNTTSTAVQLRFDVRHSPSLPDDVRRRLERLAGSRLTRDGVLVLQAQGHRSQKRNREEALARLVALIRVAARPPVQRKATRPTRASKQRRLDSKKKHGARKALRRAPPD

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
57 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
92 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
93 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
94 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
95 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
96 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
97 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
98 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
99 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
100 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
104 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
109 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
113 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
114 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
115 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
139 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
140 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
141 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
144 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
148 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
156 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
157 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.17
Nodule 0
Rhizoplane 7.28
Rhizosphere 78.64
Stem 0
Stem Tuber 0
Unclassified 1.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0006207 3300049571 Bacteria 12869
2 Ga0070683_101220904 3300005329 Bacteria 722
3 Ga0070670_100246389 3300005331 Bacteria 1556
4 Ga0068869_100091876 3300005334 Bacteria 2284
5 Ga0070666_10243510 3300005335 Bacteria 1272
6 Ga0068868_100040824 3300005338 Bacteria 3613
7 Ga0070661_100010409 3300005344 Bacteria 6466
8 Ga0070668_101394403 3300005347 Bacteria 639
9 Ga0070673_101871363 3300005364 Bacteria 569
10 Ga0070710_10284664 3300005437 Bacteria 1074
11 Ga0070711_100067405 3300005439 Bacteria 2511
12 Ga0070711_100443736 3300005439 Bacteria 1061
13 Ga0070708_100395309 3300005445 Bacteria 1303
14 Ga0070662_100752845 3300005457 Bacteria 826
15 Ga0070681_10102681 3300005458 Bacteria 2804
16 Ga0070681_10264988 3300005458 Bacteria 1630
17 Ga0070706_100410036 3300005467 Bacteria 1261
18 Ga0070698_100007012 3300005471 Bacteria 12206
19 Ga0070699_100782613 3300005518 Bacteria 873
20 Ga0070679_100166782 3300005530 Bacteria 2175
21 Ga0070684_100837758 3300005535 Bacteria 860
22 Ga0070697_100052286 3300005536 Bacteria 3319
23 Ga0070686_100180800 3300005544 Bacteria 1498
24 Ga0070686_100362652 3300005544 Bacteria 1092
25 Ga0068855_100367746 3300005563 Bacteria 1581
26 Ga0070664_100015378 3300005564 Bacteria 6258
27 Ga0070664_100625974 3300005564 Bacteria 999
28 Ga0068857_100512734 3300005577 Bacteria 1126
29 Ga0068854_100437292 3300005578 Bacteria 1090
30 Ga0068854_101412052 3300005578 Bacteria 630
31 Ga0068856_100345500 3300005614 Bacteria 1506
32 Ga0068852_100011678 3300005616 Bacteria 6624
33 Ga0068864_101027409 3300005618 Bacteria 818
34 Ga0068866_10504200 3300005718 Bacteria 801
35 Ga0068858_100637885 3300005842 Bacteria 1035
36 Ga0068860_100656195 3300005843 Bacteria 1057
37 Ga0081455_10090484 3300005937 Bacteria 2481
38 Ga0081540_1086819 3300005983 Bacteria 1388
39 Ga0081539_10008850 3300005985 Bacteria 8608
40 Ga0075365_10102434 3300006038 Bacteria 1961
41 Ga0075365_10360136 3300006038 Bacteria 1025
42 Ga0070712_100051295 3300006175 Bacteria 2873
43 Ga0070712_100628626 3300006175 Bacteria 911
44 Ga0075362_10007506 3300006177 Bacteria 4132
45 Ga0075362_10083033 3300006177 Bacteria 1479
46 Ga0075362_10100884 3300006177 Bacteria 1349
47 Ga0075369_10015954 3300006186 Bacteria 3024
48 Ga0075369_10161343 3300006186 Bacteria 1027
49 Ga0075366_10460579 3300006195 Bacteria 785
50 Ga0097621_100673398 3300006237 Bacteria 951
51 Ga0097621_101141750 3300006237 Bacteria 732
52 Ga0075434_100106404 3300006871 Bacteria 2815
53 Ga0075434_100759339 3300006871 Bacteria 986
54 Ga0068865_101554567 3300006881 Bacteria 594
55 Ga0111539_11380087 3300009094 Bacteria 817
56 Ga0105245_10010184 3300009098 Bacteria 8186
57 Ga0105245_10328622 3300009098 Bacteria 1508
58 Ga0105242_10034178 3300009176 Bacteria 4075
59 Ga0105248_10261383 3300009177 Bacteria 1948
60 Ga0105238_10543408 3300009551 Bacteria 1166
61 Ga0105238_11311270 3300009551 Bacteria 750
62 Ga0105239_10442332 3300010375 Bacteria 1474
63 Ga0157378_10565849 3300013297 Bacteria 1144
64 Ga0157375_11385749 3300013308 Bacteria 828
65 Ga0182008_10132664 3300014497 Bacteria 1242
66 Ga0157379_10239932 3300014968 Bacteria 1644
67 Ga0157376_10575046 3300014969 Bacteria 1118
68 Ga0157376_12051951 3300014969 Bacteria 610
69 Ga0182007_10049522 3300015262 Bacteria 1388
70 Ga0213875_10000901 3300021388 Bacteria 21598
71 Ga0213875_10014174 3300021388 Bacteria 3896
72 Ga0228598_1045841 3300024227 Bacteria 865
73 Ga0207656_10370672 3300025321 Bacteria 717
74 Ga0207642_10083059 3300025899 Bacteria 1561
75 Ga0207680_10467749 3300025903 Bacteria 896
76 Ga0207705_10074108 3300025909 Bacteria 2470
77 Ga0207705_10112928 3300025909 Bacteria 2009
78 Ga0207684_10361356 3300025910 Bacteria 1249
79 Ga0207707_10049027 3300025912 Bacteria 3680
80 Ga0207707_10087174 3300025912 Bacteria 2727
81 Ga0207693_10002329 3300025915 Bacteria 16500
82 Ga0207663_10160168 3300025916 Bacteria 1588
83 Ga0207660_11379691 3300025917 Bacteria 571
84 Ga0207662_10154666 3300025918 Unclassified 1461
85 Ga0207652_10240396 3300025921 Bacteria 1632
86 Ga0207694_10489040 3300025924 Bacteria 1030
87 Ga0207687_10027794 3300025927 Bacteria 3797
88 Ga0207664_11076003 3300025929 Bacteria 719
89 Ga0207706_10500796 3300025933 Bacteria 1048
90 Ga0207706_10902015 3300025933 Bacteria 746
91 Ga0207670_10072067 3300025936 Bacteria 2391
92 Ga0207670_10466638 3300025936 Bacteria 1020
93 Ga0207669_10576166 3300025937 Bacteria 912
94 Ga0207711_10194619 3300025941 Bacteria 1849
95 Ga0207661_10192987 3300025944 Bacteria 1786
96 Ga0207651_11020333 3300025960 Bacteria 740
97 Ga0207651_11802519 3300025960 Bacteria 551
98 Ga0207640_11073463 3300025981 Bacteria 711
99 Ga0207640_11111862 3300025981 Bacteria 699
100 Ga0207677_10477429 3300026023 Bacteria 1074
101 Ga0207677_10521030 3300026023 Bacteria 1031
102 Ga0207703_10214222 3300026035 Bacteria 1719
103 Ga0207702_10080549 3300026078 Bacteria 2826
104 Ga0207641_10123751 3300026088 Bacteria 2312
105 Ga0207676_11272005 3300026095 Bacteria 730
106 Ga0207674_10184995 3300026116 Bacteria 2034
107 Ga0207674_10969871 3300026116 Bacteria 819
108 Ga0207674_11790798 3300026116 Bacteria 581
109 Ga0207698_10097765 3300026142 Bacteria 2423
110 Ga0209813_10325453 3300027866 Bacteria 603
111 Ga0207428_11014123 3300027907 Bacteria 583
112 Ga0268264_10763685 3300028381 Bacteria 964
113 Ga0265332_10218859 3300031238 Bacteria 790
114 Ga0265342_10139056 3300031712 Bacteria 1356
115 Ga0307416_100920113 3300032002 Bacteria 975
116 Ga0373930_0023790 3300034816 Bacteria 1220
117 Ga0373948_0058651 3300034817 Bacteria 841
118 Ga0373928_0016279 3300035084 Bacteria 1520
119 Ga0373952_0024889 3300035092 Bacteria 1289
120 Ga0373932_0023885 3300035112 Bacteria 1640
121 Ga0373932_0148845 3300035112 Bacteria 802
122 Ga0373939_0174405 3300035114 Bacteria 798
123 Ga0373941_0154024 3300035115 Bacteria 845
124 Ga0373942_0087116 3300035207 Bacteria 936
125 Ga0373961_0087681 3300035241 Bacteria 989
126 Ga0373962_0217457 3300035242 Bacteria 652
127 Ga0373931_0382837 3300035691 Bacteria 887
128 Ga0373931_0875857 3300035691 Bacteria 602
129 Ga0373935_0412840 3300035692 Bacteria 971
130 Ga0373927_0167087 3300035695 Bacteria 1442
131 Ga0373947_0048522 3300035725 Bacteria 2547
132 Ga0373947_0380463 3300035725 Bacteria 950
133 Ga0373925_0063011 3300037068 Bacteria 2789
134 Ga0395899_0095674 3300037312 Bacteria 2148
135 Ga0395900_0003342 3300037418 Bacteria 17329
136 Ga0436364_0197829 3300037853 Bacteria 17371
137 Ga0436364_0720854 3300037853 Bacteria 10590
138 Ga0395901_0006528 3300038443 Bacteria 11799
139 Ga0436365_0378023 3300039437 Bacteria 796
140 Ga0436360_0485932 3300039438 Bacteria 721
141 Ga0436360_1274537 3300039438 Bacteria 991
142 Ga0439466_0116972 3300041411 Bacteria 825
143 Ga0451798_1063724 3300041458 Unclassified 1166
144 Ga0451800_0543641 3300041459 Unclassified 745
145 Ga0451841_0769064 3300041498 Unclassified 753
146 Ga0466963_0195378 3300044694 Bacteria 1414
147 Ga0466957_0010087 3300044842 Bacteria 5406
148 Ga0466967_0007901 3300045976 Bacteria 7733
149 Ga0495664_0408351 3300046477 Bacteria 815
150 Ga0495640_0038347 3300046533 Bacteria 3371
151 Ga0495640_0240224 3300046533 Bacteria 1137
152 Ga0495609_0374253 3300046538 Bacteria 572
153 Ga0495634_0053997 3300046642 Bacteria 2690
154 Ga0495677_0203505 3300047445 Bacteria 770
155 Ga0496101_0157852 3300048904 Bacteria 1738
156 Ga0496103_0522458 3300048906 Bacteria 759
157 Ga0496104_0110927 3300048907 Bacteria 2630
158 Ga0496104_0766449 3300048907 Bacteria 871
159 Ga0496108_1353842 3300048911 Bacteria 597
160 Ga0496110_0196252 3300048913 Bacteria 1833
161 Ga0496110_0541699 3300048913 Bacteria 1058
162 Ga0496111_0403683 3300048914 Bacteria 1010
163 Ga0496112_0771641 3300048915 Bacteria 887
164 Ga0496112_1348004 3300048915 Bacteria 629
165 Ga0496114_0286885 3300048917 Bacteria 1452
166 Ga0496115_0102250 3300048918 Bacteria 2350
167 Ga0496115_1060352 3300048918 Bacteria 616
168 Ga0501032_0760603 3300049569 Bacteria 613
169 Ga0501034_0088201 3300049571 Bacteria 3101
170 Ga0501037_0590083 3300049573 Bacteria 747
171 Ga0501039_0970574 3300049575 Bacteria 661
172 Ga0501068_0012372 3300049584 Bacteria 4837
173 Ga0501070_1510570 3300049586 Bacteria 508
174 Ga0501071_0151744 3300049587 Bacteria 1729
175 Ga0501071_1065612 3300049587 Bacteria 625
176 Ga0501072_0243204 3300049588 Bacteria 1433
177 Ga0501073_0375781 3300049589 Bacteria 982
178 Ga0501080_0506176 3300049742 Bacteria 1079
179 Ga0501083_0856211 3300049744 Bacteria 591
180 Ga0501044_0035462 3300049823 Bacteria 5224
181 Ga0501044_0306984 3300049823 Bacteria 1514
182 nmdc:mga03683_138090_c1 3300050489 Bacteria 1094
183 nmdc:mga03683_72524_c1 3300050489 Bacteria 1475
184 nmdc:mga03683_75159_c1 3300050489 Bacteria 1450
185 nmdc:mga0yw44_20631_c1 3300050492 Bacteria 3661
186 nmdc:mga0k408_50012_c1 3300050493 Bacteria 2419
187 nmdc:mga06z11_396345_c1 3300050494 Bacteria 830
188 nmdc:mga04h51_340552_c1 3300050495 Bacteria 618
189 nmdc:mga08y16_174342_c1 3300050511 Bacteria 2233
190 nmdc:mga0n895_31712_c1 3300050512 Bacteria 5063
191 nmdc:mga0n895_44409_c1 3300050512 Bacteria 4333
192 nmdc:mga0rr50_50036_c1 3300050513 Bacteria 3095
193 nmdc:mga0a205_697077_c1 3300050515 Bacteria 865
194 nmdc:mga0sz30_101279_c1 3300050516 Bacteria 1258
195 nmdc:mga0sz30_3032_c1 3300050516 Bacteria 6020
196 Ga0495601_0293924 3300053077 Bacteria 1059
197 Ga0495655_0163429 3300053083 Bacteria 708
198 Ga0500641_0001245 3300053096 Bacteria 9048
199 Ga0500650_0230016 3300053098 Bacteria 837
200 Ga0500616_0001129 3300053153 Bacteria 27455
201 Ga0500552_004637 3300053733 Bacteria 1458
202 Ga0501084_0008003 3300054114 Bacteria 8703
203 Ga0501084_0573335 3300054114 Bacteria 954
204 Ga0501082_0134709 3300060353 Bacteria 2143
205 2884300257 2884298095 Bacteria 3823049
206 Ga0501034_0006207
207 Ga0070683_101220904
208 Ga0070670_100246389
209 Ga0068869_100091876
210 Ga0070666_10243510
211 Ga0068868_100040824
212 Ga0070661_100010409
213 Ga0070668_101394403
214 Ga0070673_101871363
215 Ga0070710_10284664
216 Ga0070711_100067405
217 Ga0070711_100443736
218 Ga0070708_100395309
219 Ga0070662_100752845
220 Ga0070681_10102681
221 Ga0070681_10264988
222 Ga0070706_100410036
223 Ga0070698_100007012
224 Ga0070699_100782613
225 Ga0070679_100166782
226 Ga0070684_100837758
227 Ga0070697_100052286
228 Ga0070686_100180800
229 Ga0070686_100362652
230 Ga0068855_100367746
231 Ga0070664_100015378
232 Ga0070664_100625974
233 Ga0068857_100512734
234 Ga0068854_100437292
235 Ga0068854_101412052
236 Ga0068856_100345500
237 Ga0068852_100011678
238 Ga0068864_101027409
239 Ga0068866_10504200
240 Ga0068858_100637885
241 Ga0068860_100656195
242 Ga0081455_10090484
243 Ga0081540_1086819
244 Ga0081539_10008850
245 Ga0075365_10102434
246 Ga0075365_10360136
247 Ga0070712_100051295
248 Ga0070712_100628626
249 Ga0075362_10007506
250 Ga0075362_10083033
251 Ga0075362_10100884
252 Ga0075369_10015954
253 Ga0075369_10161343
254 Ga0075366_10460579
255 Ga0097621_100673398
256 Ga0097621_101141750
257 Ga0075434_100106404
258 Ga0075434_100759339
259 Ga0068865_101554567
260 Ga0111539_11380087
261 Ga0105245_10010184
262 Ga0105245_10328622
263 Ga0105242_10034178
264 Ga0105248_10261383
265 Ga0105238_10543408
266 Ga0105238_11311270
267 Ga0105239_10442332
268 Ga0157378_10565849
269 Ga0157375_11385749
270 Ga0182008_10132664
271 Ga0157379_10239932
272 Ga0157376_10575046
273 Ga0157376_12051951
274 Ga0182007_10049522
275 Ga0213875_10000901
276 Ga0213875_10014174
277 Ga0228598_1045841
278 Ga0207656_10370672
279 Ga0207642_10083059
280 Ga0207680_10467749
281 Ga0207705_10074108
282 Ga0207705_10112928
283 Ga0207684_10361356
284 Ga0207707_10049027
285 Ga0207707_10087174
286 Ga0207693_10002329
287 Ga0207663_10160168
288 Ga0207660_11379691
289 Ga0207662_10154666
290 Ga0207652_10240396
291 Ga0207694_10489040
292 Ga0207687_10027794
293 Ga0207664_11076003
294 Ga0207706_10500796
295 Ga0207706_10902015
296 Ga0207670_10072067
297 Ga0207670_10466638
298 Ga0207669_10576166
299 Ga0207711_10194619
300 Ga0207661_10192987
301 Ga0207651_11020333
302 Ga0207651_11802519
303 Ga0207640_11073463
304 Ga0207640_11111862
305 Ga0207677_10477429
306 Ga0207677_10521030
307 Ga0207703_10214222
308 Ga0207702_10080549
309 Ga0207641_10123751
310 Ga0207676_11272005
311 Ga0207674_10184995
312 Ga0207674_10969871
313 Ga0207674_11790798
314 Ga0207698_10097765
315 Ga0209813_10325453
316 Ga0207428_11014123
317 Ga0268264_10763685
318 Ga0265332_10218859
319 Ga0265342_10139056
320 Ga0307416_100920113
321 Ga0373930_0023790
322 Ga0373948_0058651
323 Ga0373928_0016279
324 Ga0373952_0024889
325 Ga0373932_0023885
326 Ga0373932_0148845
327 Ga0373939_0174405
328 Ga0373941_0154024
329 Ga0373942_0087116
330 Ga0373961_0087681
331 Ga0373962_0217457
332 Ga0373931_0382837
333 Ga0373931_0875857
334 Ga0373935_0412840
335 Ga0373927_0167087
336 Ga0373947_0048522
337 Ga0373947_0380463
338 Ga0373925_0063011
339 Ga0395899_0095674
340 Ga0395900_0003342
341 Ga0436364_0197829
342 Ga0436364_0720854
343 Ga0395901_0006528
344 Ga0436365_0378023
345 Ga0436360_0485932
346 Ga0436360_1274537
347 Ga0439466_0116972
348 Ga0451798_1063724
349 Ga0451800_0543641
350 Ga0451841_0769064
351 Ga0466963_0195378
352 Ga0466957_0010087
353 Ga0466967_0007901
354 Ga0495664_0408351
355 Ga0495640_0038347
356 Ga0495640_0240224
357 Ga0495609_0374253
358 Ga0495634_0053997
359 Ga0495677_0203505
360 Ga0496101_0157852
361 Ga0496103_0522458
362 Ga0496104_0110927
363 Ga0496104_0766449
364 Ga0496108_1353842
365 Ga0496110_0196252
366 Ga0496110_0541699
367 Ga0496111_0403683
368 Ga0496112_0771641
369 Ga0496112_1348004
370 Ga0496114_0286885
371 Ga0496115_0102250
372 Ga0496115_1060352
373 Ga0501032_0760603
374 Ga0501034_0088201
375 Ga0501037_0590083
376 Ga0501039_0970574
377 Ga0501068_0012372
378 Ga0501070_1510570
379 Ga0501071_0151744
380 Ga0501071_1065612
381 Ga0501072_0243204
382 Ga0501073_0375781
383 Ga0501080_0506176
384 Ga0501083_0856211
385 Ga0501044_0035462
386 Ga0501044_0306984
387 nmdc:mga03683_138090_c1
388 nmdc:mga03683_72524_c1
389 nmdc:mga03683_75159_c1
390 nmdc:mga0yw44_20631_c1
391 nmdc:mga0k408_50012_c1
392 nmdc:mga06z11_396345_c1
393 nmdc:mga04h51_340552_c1
394 nmdc:mga08y16_174342_c1
395 nmdc:mga0n895_31712_c1
396 nmdc:mga0n895_44409_c1
397 nmdc:mga0rr50_50036_c1
398 nmdc:mga0a205_697077_c1
399 nmdc:mga0sz30_101279_c1
400 nmdc:mga0sz30_3032_c1
401 Ga0495601_0293924
402 Ga0495655_0163429
403 Ga0500641_0001245
404 Ga0500650_0230016
405 Ga0500616_0001129
406 Ga0500552_004637
407 Ga0501084_0008003
408 Ga0501084_0573335
409 Ga0501082_0134709
410 2884300257

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00472

RF-1

RF-1 domain

18

149

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qh7-assembly1.cif.gz_p cryo-em structure of the human mtlsu assembly intermediate upon mrm2 depletion - class 4 0.9214 27 114
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.9081 27 115
7oi6-assembly1.cif.gz_p cryo-em structure of late human 39s mitoribosome assembly intermediates, state 1 0.8696 27 115
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.8574 27 115
4ce4-assembly1.cif.gz_u 39s large subunit of the porcine mitochondrial ribosome 0.8565 27 116
ID Description Score Start End Superfamily
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9081 27 115 3.30.160.20
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8921 54 112 3.30.160.20
1j26A01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8673 30 114 3.30.160.20
af_Q8I1W0_39_148_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8637 24 112 3.30.160.20
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8574 27 115 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A3D2AY38-F1-model_v4 Aminoacyl-tRNA hydrolase 0.9566 16 120 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-B3SCX3-F1-model_v4 Prokaryotic-type class I peptide chain release factors domain-containing protein 0.9471 27 112 GO:0003747
AF-A0A3D2AY38-F1-model_v4 Aminoacyl-tRNA hydrolase 0.9391 16 120 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A7Z9QAV7-F1-model_v4 Aminoacyl-tRNA hydrolase (EC 3.1.1.29) 0.9277 16 100 GO:0003747
GO:0004045
GO:0043022
GO:0072344
AF-A0A7V5LKD2-F1-model_v4 deleted 0.9274 16 106

Map