F315463

General Info

Members Datasets Scaffolds Average Seq Length
206 132 205 222

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0096538|Ga0466966_0096538_30_833
Length 267
Sequence LAYLISRTRIKPSVPPARGHGVAAQRPPCYAKSPLRRAPVTRPLIIAPSILSADFAKLGDEVRAVDQAGADWIHVDVMDGHFVPNISIGPDVVKAIRPYTAKPLDVHLMIAPCDPYLEAFAKAGADIITVHVEAGPHIHRSLQAIRALGKKAGVTMNPGTPESSVAHVIDIVDLILVMSVNPGFGGQKFIAGALDKVRNLRAMAGGRPIDIEIDGGITPQIAPDAARAGANAFVAGSAVFKDRTPDAYRSNIAAIRNAAALARGEAA

Samples

Sample ID Description Type Environment
1 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
11 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
12 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
15 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
16 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
17 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
18 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
27 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
28 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
46 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
47 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
48 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
49 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
56 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
61 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
64 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
65 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
66 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
67 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
68 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
69 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
70 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
71 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
72 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
73 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
88 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
93 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
94 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
112 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
113 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
114 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
121 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
122 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
123 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
124 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
125 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
126 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
127 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
128 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
129 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
131 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
132 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 1.46
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.37
Nodule 0
Rhizoplane 0.97
Rhizosphere 90.78
Stem 0
Stem Tuber 0.49
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10020170 3300001990 Bacteria 2129
2 Ga0070659_100636302 3300005366 Bacteria 919
3 Ga0070713_100071568 3300005436 Bacteria 2931
4 Ga0070681_10000001 3300005458 Bacteria 946857
5 Ga0070679_100000577 3300005530 Bacteria 31104
6 Ga0068853_100004348 3300005539 Bacteria 10962
7 Ga0068853_100009279 3300005539 Bacteria 7933
8 Ga0068853_100143958 3300005539 Bacteria 2141
9 Ga0070686_100000228 3300005544 Bacteria 38437
10 Ga0068855_100000307 3300005563 Bacteria 60715
11 Ga0068852_100005186 3300005616 Bacteria 9291
12 Ga0068852_100064362 3300005616 Bacteria 3196
13 Ga0068851_10134379 3300005834 Bacteria 1340
14 Ga0068862_100168419 3300005844 Bacteria 1960
15 Ga0081455_10000170 3300005937 Bacteria 80847
16 Ga0081455_10023665 3300005937 Bacteria 5710
17 Ga0075428_100029057 3300006844 Bacteria 6118
18 Ga0075434_100025283 3300006871 Bacteria 5809
19 Ga0075436_100029488 3300006914 Bacteria 3773
20 Ga0075435_100104238 3300007076 Bacteria 2353
21 Ga0105240_10000641 3300009093 Bacteria 64500
22 Ga0111539_10433175 3300009094 Bacteria 1531
23 Ga0105247_10163289 3300009101 Bacteria 1476
24 Ga0114129_10105178 3300009147 Bacteria 3901
25 Ga0105241_10042633 3300009174 Bacteria 3434
26 Ga0105238_10014381 3300009551 Bacteria 7998
27 Ga0099796_10106492 3300010159 Bacteria 1062
28 Ga0105239_10012397 3300010375 Bacteria 9492
29 Ga0105239_10016465 3300010375 Bacteria 8176
30 Ga0157369_10016071 3300013105 Bacteria 8421
31 Ga0157369_10070562 3300013105 Bacteria 3753
32 Ga0157369_10430348 3300013105 Bacteria 1368
33 Ga0157378_10510572 3300013297 Bacteria 1202
34 Ga0157378_10837297 3300013297 Bacteria 948
35 Ga0206356_10796141 3300020070 Bacteria 3969
36 Ga0206354_11627301 3300020081 Bacteria 6859
37 Ga0206353_10226904 3300020082 Bacteria 16427
38 Ga0207656_10304153 3300025321 Bacteria 790
39 Ga0207710_10218372 3300025900 Bacteria 946
40 Ga0207647_10000184 3300025904 Bacteria 50339
41 Ga0207654_10092068 3300025911 Bacteria 1851
42 Ga0207654_10223276 3300025911 Bacteria 1251
43 Ga0207695_10000018 3300025913 Bacteria 766611
44 Ga0207695_10481362 3300025913 Bacteria 1123
45 Ga0207649_10045982 3300025920 Bacteria 2679
46 Ga0207694_10000018 3300025924 Bacteria 331281
47 Ga0207690_10262373 3300025932 Bacteria 1339
48 Ga0207711_10000002 3300025941 Bacteria 1228676
49 Ga0207667_10000052 3300025949 Bacteria 232415
50 Ga0207651_10049311 3300025960 Bacteria 2852
51 Ga0207639_10070837 3300026041 Bacteria 2725
52 Ga0207678_10078889 3300026067 Bacteria 2820
53 Ga0207698_10003639 3300026142 Bacteria 9305
54 Ga0207698_10357197 3300026142 Bacteria 1382
55 Ga0265326_10098220 3300028558 Bacteria 830
56 Ga0265334_10021237 3300028573 Bacteria 2652
57 Ga0265318_10000094 3300028577 Bacteria 82007
58 Ga0265338_10000005 3300028800 Bacteria 571137
59 Ga0265338_10007838 3300028800 Bacteria 13118
60 Ga0265338_10058245 3300028800 Bacteria 3411
61 Ga0265330_10071687 3300031235 Bacteria 1499
62 Ga0265332_10016164 3300031238 Bacteria 3292
63 Ga0265332_10102700 3300031238 Bacteria 1205
64 Ga0265320_10050896 3300031240 Bacteria 2012
65 Ga0265320_10129131 3300031240 Bacteria 1149
66 Ga0265325_10000005 3300031241 Bacteria 321343
67 Ga0265325_10000619 3300031241 Bacteria 25931
68 Ga0265325_10003183 3300031241 Bacteria 10797
69 Ga0265325_10073812 3300031241 Bacteria 1707
70 Ga0265325_10077299 3300031241 Bacteria 1659
71 Ga0265329_10013969 3300031242 Bacteria 2847
72 Ga0265329_10024306 3300031242 Bacteria 2012
73 Ga0265340_10010051 3300031247 Bacteria 5068
74 Ga0265340_10107327 3300031247 Bacteria 1293
75 Ga0265339_10000071 3300031249 Bacteria 88416
76 Ga0265339_10004038 3300031249 Bacteria 10137
77 Ga0265339_10006679 3300031249 Bacteria 7542
78 Ga0265339_10011571 3300031249 Bacteria 5423
79 Ga0265339_10019109 3300031249 Bacteria 4026
80 Ga0265339_10033230 3300031249 Bacteria 2906
81 Ga0265339_10082643 3300031249 Bacteria 1695
82 Ga0265339_10112614 3300031249 Bacteria 1406
83 Ga0265331_10002961 3300031250 Bacteria 11179
84 Ga0265331_10028898 3300031250 Bacteria 2771
85 Ga0265331_10108295 3300031250 Bacteria 1275
86 Ga0265316_10051602 3300031344 Bacteria 3230
87 Ga0265316_10097089 3300031344 Bacteria 2243
88 Ga0265316_10136052 3300031344 Bacteria 1848
89 Ga0265316_10186593 3300031344 Bacteria 1542
90 Ga0265313_10000123 3300031595 Bacteria 77230
91 Ga0265313_10011992 3300031595 Bacteria 5342
92 Ga0265313_10014245 3300031595 Bacteria 4712
93 Ga0265313_10056252 3300031595 Bacteria 1860
94 Ga0265313_10110360 3300031595 Bacteria 1210
95 Ga0265314_10001910 3300031711 Bacteria 22264
96 Ga0265314_10030570 3300031711 Bacteria 3984
97 Ga0265314_10133637 3300031711 Bacteria 1544
98 Ga0265314_10344701 3300031711 Bacteria 821
99 Ga0265342_10026178 3300031712 Bacteria 3658
100 Ga0265342_10029030 3300031712 Bacteria 3438
101 Ga0265342_10056988 3300031712 Bacteria 2314
102 Ga0265342_10107498 3300031712 Bacteria 1582
103 Ga0265342_10157078 3300031712 Bacteria 1259
104 Ga0307516_10097461 3300031730 Bacteria 2760
105 Ga0307413_10061179 3300031824 Bacteria 2322
106 Ga0373938_0023295 3300034957 Bacteria 1272
107 Ga0373928_0036255 3300035084 Bacteria 1114
108 Ga0373929_0041386 3300035085 Bacteria 1024
109 Ga0373940_0007370 3300035088 Bacteria 2480
110 Ga0373949_0024092 3300035090 Bacteria 1413
111 Ga0373949_0055835 3300035090 Bacteria 1005
112 Ga0373952_0002174 3300035092 Bacteria 3526
113 Ga0373939_0001620 3300035114 Bacteria 5436
114 Ga0373939_0005070 3300035114 Bacteria 3128
115 Ga0373941_0040394 3300035115 Bacteria 1438
116 Ga0373960_0041987 3300035121 Bacteria 1326
117 Ga0373961_0006943 3300035241 Bacteria 2726
118 Ga0373961_0026417 3300035241 Bacteria 1586
119 Ga0373962_0068908 3300035242 Bacteria 1053
120 Ga0373931_0007139 3300035691 Bacteria 5255
121 Ga0373937_0070637 3300036401 Bacteria 3221
122 Ga0373937_0327349 3300036401 Bacteria 1450
123 Ga0395899_0035992 3300037312 Bacteria 3715
124 Ga0395905_0060414 3300037471 Bacteria 3544
125 Ga0436364_0281895 3300037853 Bacteria 867
126 Ga0436364_0430154 3300037853 Bacteria 16915
127 Ga0436365_0524207 3300039437 Bacteria 5916
128 Ga0436365_1195613 3300039437 Bacteria 824
129 Ga0436363_0522961 3300039450 Bacteria 1229
130 Ga0436363_1609899 3300039450 Bacteria 8154
131 Ga0451797_0695961 3300041453 Bacteria 751
132 Ga0466966_0096538 3300044684 Bacteria 1831
133 Ga0466963_0095832 3300044694 Bacteria 2026
134 Ga0466957_0122764 3300044842 Bacteria 1657
135 Ga0451576_0001683 3300045051 Bacteria 36623
136 Ga0495651_0124512 3300046462 Bacteria 1889
137 Ga0495664_0088996 3300046477 Bacteria 1856
138 Ga0495628_0227935 3300046516 Bacteria 1397
139 Ga0495648_0229334 3300046524 Bacteria 910
140 Ga0495652_0066793 3300046529 Bacteria 3016
141 Ga0495652_0177139 3300046529 Bacteria 1640
142 Ga0495587_0373061 3300046536 Bacteria 794
143 Ga0495645_0215518 3300046543 Bacteria 1294
144 Ga0495622_0183655 3300046557 Bacteria 937
145 Ga0495668_0007578 3300046616 Bacteria 6922
146 Ga0495623_0071210 3300046679 Bacteria 2164
147 Ga0495674_0020998 3300047319 Bacteria 6043
148 Ga0495684_0381018 3300047471 Bacteria 995
149 Ga0496110_0642489 3300048913 Bacteria 961
150 Ga0495682_0004468 3300049460 Bacteria 5975
151 Ga0501034_0313434 3300049571 Bacteria 1503
152 Ga0501040_0062034 3300049576 Bacteria 2572
153 Ga0501047_0007715 3300049581 Bacteria 10133
154 Ga0501047_0213044 3300049581 Bacteria 1790
155 Ga0501067_0001225 3300049583 Bacteria 13938
156 Ga0501067_0009639 3300049583 Bacteria 5347
157 Ga0501067_0049342 3300049583 Bacteria 2333
158 Ga0501069_0004079 3300049585 Bacteria 7537
159 Ga0501069_0054646 3300049585 Bacteria 2224
160 Ga0501070_0004201 3300049586 Bacteria 12382
161 Ga0501070_0004424 3300049586 Bacteria 12066
162 Ga0501072_0003961 3300049588 Bacteria 11203
163 Ga0501073_0002593 3300049589 Bacteria 13522
164 Ga0501073_0027310 3300049589 Bacteria 4082
165 Ga0501074_0012153 3300049590 Bacteria 6259
166 Ga0501074_0223201 3300049590 Bacteria 1341
167 Ga0501074_0397713 3300049590 Bacteria 977
168 Ga0501075_0008276 3300049591 Bacteria 7249
169 Ga0501076_0011263 3300049592 Bacteria 6657
170 Ga0501077_0009425 3300049593 Bacteria 6068
171 Ga0501079_0005090 3300049741 Bacteria 9764
172 Ga0501079_0031533 3300049741 Bacteria 4074
173 Ga0501080_0058754 3300049742 Bacteria 3580
174 Ga0501080_0429843 3300049742 Bacteria 1185
175 Ga0501081_0022150 3300049743 Bacteria 4249
176 Ga0501083_0190660 3300049744 Bacteria 1338
177 Ga0501035_0001573 3300049822 Bacteria 23232
178 Ga0501035_0016964 3300049822 Bacteria 6712
179 Ga0501044_0008815 3300049823 Bacteria 11032
180 nmdc:mga08y16_161911_c1 3300050511 Bacteria 2325
181 nmdc:mga08y16_345302_c1 3300050511 Bacteria 1530
182 nmdc:mga0n895_70322_c1 3300050512 Bacteria 3469
183 nmdc:mga08x19_23467_c1 3300050514 Bacteria 3826
184 Ga0495612_0013821 3300053078 Bacteria 3253
185 Ga0500643_000003 3300053087 Bacteria 876659
186 Ga0500646_0042049 3300053090 Bacteria 1290
187 Ga0500583_0307338 3300053092 Bacteria 775
188 Ga0500556_0000036 3300053104 Bacteria 144864
189 Ga0500556_0000274 3300053104 Bacteria 40355
190 Ga0500608_002508 3300053122 Bacteria 6693
191 Ga0500642_0000001 3300053130 Bacteria 1468402
192 Ga0500568_0023220 3300053139 Bacteria 2640
193 Ga0500619_014221 3300053154 Bacteria 2133
194 Ga0501084_0014670 3300054114 Bacteria 6498
195 Ga0501084_0036223 3300054114 Bacteria 4122
196 Ga0501084_0210765 3300054114 Bacteria 1639
197 Ga0501084_0862716 3300054114 Bacteria 762
198 Ga0501082_0009038 3300060353 Bacteria 8594
199 Ga0501082_0028360 3300060353 Bacteria 4824
200 Ga0501082_0084038 3300060353 Bacteria 2746
201 Ga0501082_0087903 3300060353 Bacteria 2682
202 Ga0501082_0295425 3300060353 Bacteria 1411
203 Ga0501082_0478680 3300060353 Bacteria 1088
204 Ga0530510_0021387 3300061734 Bacteria 4602
205 Ga0530510_0299463 3300061734 Bacteria 1203

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010159 Ga0099796_10106492 Ga0099796_101064922 191
2 3300049744 Ga0501083_0190660 Ga0501083_0190660_89_817 198
3 3300037853 Ga0436364_0281895 Ga0436364_0281895_152_838 205
4 3300037853 Ga0436364_0430154 Ga0436364_0430154_1236_1922 205
5 3300031250 Ga0265331_10028898 Ga0265331_100288982 209
6 iso_pu_bacteria 2885427238 2885429261 215
7 3300049571 Ga0501034_0313434 Ga0501034_0313434_313_987 216
8 3300049583 Ga0501067_0009639 Ga0501067_0009639_2722_3378 216
9 3300049585 Ga0501069_0054646 Ga0501069_0054646_549_1223 216
10 3300049586 Ga0501070_0004424 Ga0501070_0004424_599_1273 216
11 3300049590 Ga0501074_0397713 Ga0501074_0397713_100_774 216
12 3300049742 Ga0501080_0429843 Ga0501080_0429843_481_1155 216
13 3300049822 Ga0501035_0001573 Ga0501035_0001573_615_1289 216
14 3300054114 Ga0501084_0210765 Ga0501084_0210765_535_1191 216
15 3300060353 Ga0501082_0084038 Ga0501082_0084038_914_1570 216
16 3300060353 Ga0501082_0087903 Ga0501082_0087903_1029_1682 216
17 3300005937 Ga0081455_10000170 Ga0081455_1000017080 217
18 3300006844 Ga0075428_100029057 Ga0075428_1000290575 217
19 3300006914 Ga0075436_100029488 Ga0075436_1000294884 217
20 3300007076 Ga0075435_100104238 Ga0075435_1001042382 217
21 3300009094 Ga0111539_10433175 Ga0111539_104331752 217
22 3300009147 Ga0114129_10105178 Ga0114129_101051782 217
23 3300026067 Ga0207678_10078889 Ga0207678_100788893 217
24 3300031241 Ga0265325_10073812 Ga0265325_100738122 217
25 3300031242 Ga0265329_10024306 Ga0265329_100243062 217
26 3300031247 Ga0265340_10107327 Ga0265340_101073272 217
27 3300031249 Ga0265339_10033230 Ga0265339_100332302 217
28 3300031249 Ga0265339_10082643 Ga0265339_100826431 217
29 3300031344 Ga0265316_10097089 Ga0265316_100970892 217
30 3300031595 Ga0265313_10011992 Ga0265313_100119923 217
31 3300031595 Ga0265313_10056252 Ga0265313_100562522 217
32 3300031712 Ga0265342_10029030 Ga0265342_100290302 217
33 3300031712 Ga0265342_10107498 Ga0265342_101074982 217
34 3300031712 Ga0265342_10157078 Ga0265342_101570782 217
35 3300034957 Ga0373938_0023295 Ga0373938_0023295_216_881 217
36 3300035084 Ga0373928_0036255 Ga0373928_0036255_249_920 217
37 3300035085 Ga0373929_0041386 Ga0373929_0041386_325_996 217
38 3300035088 Ga0373940_0007370 Ga0373940_0007370_97_762 217
39 3300035090 Ga0373949_0024092 Ga0373949_0024092_252_917 217
40 3300035090 Ga0373949_0055835 Ga0373949_0055835_262_933 217
41 3300035092 Ga0373952_0002174 Ga0373952_0002174_956_1621 217
42 3300035114 Ga0373939_0001620 Ga0373939_0001620_3252_3917 217
43 3300035114 Ga0373939_0005070 Ga0373939_0005070_924_1595 217
44 3300035115 Ga0373941_0040394 Ga0373941_0040394_460_1125 217
45 3300035121 Ga0373960_0041987 Ga0373960_0041987_358_1029 217
46 3300035241 Ga0373961_0006943 Ga0373961_0006943_1806_2477 217
47 3300035241 Ga0373961_0026417 Ga0373961_0026417_93_758 217
48 3300035242 Ga0373962_0068908 Ga0373962_0068908_163_828 217
49 3300035691 Ga0373931_0007139 Ga0373931_0007139_553_1218 217
50 3300049576 Ga0501040_0062034 Ga0501040_0062034_143_814 217
51 3300050511 nmdc:mga08y16_161911_c1 nmdc:mga08y16_161911_c1_960_1631 217
52 3300050511 nmdc:mga08y16_345302_c1 nmdc:mga08y16_345302_c1_364_1029 217
53 3300050514 nmdc:mga08x19_23467_c1 nmdc:mga08x19_23467_c1_969_1631 217
54 3300054114 Ga0501084_0862716 Ga0501084_0862716_83_739 217
55 3300060353 Ga0501082_0478680 Ga0501082_0478680_370_1041 217
56 3300005436 Ga0070713_100071568 Ga0070713_1000715682 218
57 3300013105 Ga0157369_10016071 Ga0157369_100160716 218
58 3300025321 Ga0207656_10304153 Ga0207656_103041531 218
59 3300037312 Ga0395899_0035992 Ga0395899_0035992_67_723 218
60 3300037471 Ga0395905_0060414 Ga0395905_0060414_841_1497 218
61 3300005458 Ga0070681_10000001 Ga0070681_10000001570 219
62 3300005530 Ga0070679_100000577 Ga0070679_10000057713 219
63 3300005539 Ga0068853_100004348 Ga0068853_1000043485 219
64 3300005539 Ga0068853_100009279 Ga0068853_1000092793 219
65 3300005539 Ga0068853_100143958 Ga0068853_1001439582 219
66 3300005544 Ga0070686_100000228 Ga0070686_10000022839 219
67 3300005563 Ga0068855_100000307 Ga0068855_10000030744 219
68 3300005616 Ga0068852_100005186 Ga0068852_1000051868 219
69 3300005616 Ga0068852_100064362 Ga0068852_1000643622 219
70 3300005834 Ga0068851_10134379 Ga0068851_101343792 219
71 3300005844 Ga0068862_100168419 Ga0068862_1001684192 219
72 3300005937 Ga0081455_10023665 Ga0081455_100236657 219
73 3300006871 Ga0075434_100025283 Ga0075434_1000252833 219
74 3300009093 Ga0105240_10000641 Ga0105240_100006414 219
75 3300009101 Ga0105247_10163289 Ga0105247_101632892 219
76 3300009174 Ga0105241_10042633 Ga0105241_100426335 219
77 3300009551 Ga0105238_10014381 Ga0105238_100143816 219
78 3300010375 Ga0105239_10012397 Ga0105239_100123972 219
79 3300010375 Ga0105239_10016465 Ga0105239_100164655 219
80 3300013105 Ga0157369_10070562 Ga0157369_100705622 219
81 3300013105 Ga0157369_10430348 Ga0157369_104303481 219
82 3300013297 Ga0157378_10510572 Ga0157378_105105722 219
83 3300013297 Ga0157378_10837297 Ga0157378_108372972 219
84 3300020070 Ga0206356_10796141 Ga0206356_107961412 219
85 3300020081 Ga0206354_11627301 Ga0206354_116273015 219
86 3300020082 Ga0206353_10226904 Ga0206353_1022690410 219
87 3300025900 Ga0207710_10218372 Ga0207710_102183722 219
88 3300025911 Ga0207654_10092068 Ga0207654_100920682 219
89 3300025911 Ga0207654_10223276 Ga0207654_102232762 219
90 3300025913 Ga0207695_10000018 Ga0207695_10000018375 219
91 3300025913 Ga0207695_10481362 Ga0207695_104813621 219
92 3300025920 Ga0207649_10045982 Ga0207649_100459822 219
93 3300025924 Ga0207694_10000018 Ga0207694_10000018165 219
94 3300025941 Ga0207711_10000002 Ga0207711_10000002708 219
95 3300025949 Ga0207667_10000052 Ga0207667_10000052189 219
96 3300025960 Ga0207651_10049311 Ga0207651_100493113 219
97 3300026041 Ga0207639_10070837 Ga0207639_100708372 219
98 3300026142 Ga0207698_10003639 Ga0207698_100036392 219
99 3300028558 Ga0265326_10098220 Ga0265326_100982202 219
100 3300028573 Ga0265334_10021237 Ga0265334_100212372 219
101 3300028577 Ga0265318_10000094 Ga0265318_1000009452 219
102 3300028800 Ga0265338_10000005 Ga0265338_10000005197 219
103 3300028800 Ga0265338_10007838 Ga0265338_100078389 219
104 3300028800 Ga0265338_10058245 Ga0265338_100582452 219
105 3300031235 Ga0265330_10071687 Ga0265330_100716872 219
106 3300031238 Ga0265332_10016164 Ga0265332_100161643 219
107 3300031238 Ga0265332_10102700 Ga0265332_101027002 219
108 3300031240 Ga0265320_10050896 Ga0265320_100508962 219
109 3300031240 Ga0265320_10129131 Ga0265320_101291312 219
110 3300031241 Ga0265325_10000005 Ga0265325_10000005320 219
111 3300031241 Ga0265325_10000619 Ga0265325_1000061920 219
112 3300031241 Ga0265325_10003183 Ga0265325_100031835 219
113 3300031241 Ga0265325_10077299 Ga0265325_100772992 219
114 3300031242 Ga0265329_10013969 Ga0265329_100139692 219
115 3300031247 Ga0265340_10010051 Ga0265340_100100515 219
116 3300031249 Ga0265339_10000071 Ga0265339_1000007127 219
117 3300031249 Ga0265339_10004038 Ga0265339_1000403810 219
118 3300031249 Ga0265339_10006679 Ga0265339_100066799 219
119 3300031249 Ga0265339_10011571 Ga0265339_100115715 219
120 3300031249 Ga0265339_10019109 Ga0265339_100191093 219
121 3300031249 Ga0265339_10112614 Ga0265339_101126142 219
122 3300031250 Ga0265331_10002961 Ga0265331_1000296110 219
123 3300031250 Ga0265331_10108295 Ga0265331_101082952 219
124 3300031344 Ga0265316_10051602 Ga0265316_100516023 219
125 3300031344 Ga0265316_10136052 Ga0265316_101360522 219
126 3300031344 Ga0265316_10186593 Ga0265316_101865932 219
127 3300031595 Ga0265313_10000123 Ga0265313_1000012314 219
128 3300031595 Ga0265313_10014245 Ga0265313_100142453 219
129 3300031595 Ga0265313_10110360 Ga0265313_101103602 219
130 3300031711 Ga0265314_10001910 Ga0265314_100019104 219
131 3300031711 Ga0265314_10030570 Ga0265314_100305702 219
132 3300031711 Ga0265314_10133637 Ga0265314_101336372 219
133 3300031711 Ga0265314_10344701 Ga0265314_103447011 219
134 3300031712 Ga0265342_10026178 Ga0265342_100261782 219
135 3300031712 Ga0265342_10056988 Ga0265342_100569883 219
136 3300031730 Ga0307516_10097461 Ga0307516_100974612 219
137 3300036401 Ga0373937_0070637 Ga0373937_0070637_139_798 219
138 3300036401 Ga0373937_0327349 Ga0373937_0327349_306_992 219
139 3300039437 Ga0436365_0524207 Ga0436365_0524207_3966_4625 219
140 3300039437 Ga0436365_1195613 Ga0436365_1195613_15_701 219
141 3300039450 Ga0436363_0522961 Ga0436363_0522961_145_804 219
142 3300039450 Ga0436363_1609899 Ga0436363_1609899_5659_6318 219
143 3300041453 Ga0451797_0695961 Ga0451797_0695961_72_731 219
144 3300044684 Ga0466966_0096538 Ga0466966_0096538_30_833 219
145 3300044694 Ga0466963_0095832 Ga0466963_0095832_790_1476 219
146 3300044842 Ga0466957_0122764 Ga0466957_0122764_366_1085 219
147 3300045051 Ga0451576_0001683 Ga0451576_0001683_5332_6006 219
148 3300046462 Ga0495651_0124512 Ga0495651_0124512_542_1201 219
149 3300046477 Ga0495664_0088996 Ga0495664_0088996_42_701 219
150 3300046516 Ga0495628_0227935 Ga0495628_0227935_583_1242 219
151 3300046529 Ga0495652_0066793 Ga0495652_0066793_1153_1812 219
152 3300046529 Ga0495652_0177139 Ga0495652_0177139_263_922 219
153 3300046536 Ga0495587_0373061 Ga0495587_0373061_89_748 219
154 3300046557 Ga0495622_0183655 Ga0495622_0183655_186_845 219
155 3300046679 Ga0495623_0071210 Ga0495623_0071210_990_1649 219
156 3300047319 Ga0495674_0020998 Ga0495674_0020998_4372_5031 219
157 3300047471 Ga0495684_0381018 Ga0495684_0381018_79_765 219
158 3300048913 Ga0496110_0642489 Ga0496110_0642489_106_789 219
159 3300049460 Ga0495682_0004468 Ga0495682_0004468_2978_3637 219
160 3300049581 Ga0501047_0007715 Ga0501047_0007715_8343_9002 219
161 3300049581 Ga0501047_0213044 Ga0501047_0213044_348_1007 219
162 3300049583 Ga0501067_0001225 Ga0501067_0001225_1411_2070 219
163 3300049583 Ga0501067_0049342 Ga0501067_0049342_1442_2101 219
164 3300049585 Ga0501069_0004079 Ga0501069_0004079_2062_2721 219
165 3300049586 Ga0501070_0004201 Ga0501070_0004201_3142_3801 219
166 3300049588 Ga0501072_0003961 Ga0501072_0003961_8367_9026 219
167 3300049589 Ga0501073_0002593 Ga0501073_0002593_11948_12607 219
168 3300049589 Ga0501073_0027310 Ga0501073_0027310_1339_1998 219
169 3300049590 Ga0501074_0012153 Ga0501074_0012153_166_825 219
170 3300049590 Ga0501074_0223201 Ga0501074_0223201_108_767 219
171 3300049591 Ga0501075_0008276 Ga0501075_0008276_2429_3148 219
172 3300049592 Ga0501076_0011263 Ga0501076_0011263_1261_1980 219
173 3300049593 Ga0501077_0009425 Ga0501077_0009425_4876_5595 219
174 3300049741 Ga0501079_0005090 Ga0501079_0005090_8650_9309 219
175 3300049741 Ga0501079_0031533 Ga0501079_0031533_2200_2919 219
176 3300049742 Ga0501080_0058754 Ga0501080_0058754_1230_1949 219
177 3300049743 Ga0501081_0022150 Ga0501081_0022150_1366_2085 219
178 3300049822 Ga0501035_0016964 Ga0501035_0016964_3128_3787 219
179 3300049823 Ga0501044_0008815 Ga0501044_0008815_2085_2744 219
180 3300050512 nmdc:mga0n895_70322_c1 nmdc:mga0n895_70322_c1_1848_2507 219
181 3300053078 Ga0495612_0013821 Ga0495612_0013821_430_1116 219
182 3300053087 Ga0500643_000003 Ga0500643_000003_140096_140755 219
183 3300053090 Ga0500646_0042049 Ga0500646_0042049_527_1186 219
184 3300053104 Ga0500556_0000036 Ga0500556_0000036_115699_116448 219
185 3300053139 Ga0500568_0023220 Ga0500568_0023220_1066_1725 219
186 3300053154 Ga0500619_014221 Ga0500619_014221_1420_2079 219
187 3300054114 Ga0501084_0014670 Ga0501084_0014670_3907_4626 219
188 3300054114 Ga0501084_0036223 Ga0501084_0036223_2830_3489 219
189 3300060353 Ga0501082_0009038 Ga0501082_0009038_3250_3969 219
190 3300060353 Ga0501082_0028360 Ga0501082_0028360_3059_3718 219
191 3300060353 Ga0501082_0295425 Ga0501082_0295425_596_1309 219
192 3300061734 Ga0530510_0021387 Ga0530510_0021387_258_1007 219
193 3300061734 Ga0530510_0299463 Ga0530510_0299463_380_1099 219
194 3300026142 Ga0207698_10357197 Ga0207698_103571972 220
195 3300031824 Ga0307413_10061179 Ga0307413_100611792 220
196 3300046524 Ga0495648_0229334 Ga0495648_0229334_227_889 220
197 3300046616 Ga0495668_0007578 Ga0495668_0007578_1077_1739 220
198 3300053092 Ga0500583_0307338 Ga0500583_0307338_98_760 220
199 3300053104 Ga0500556_0000274 Ga0500556_0000274_26289_26951 220
200 3300053122 Ga0500608_002508 Ga0500608_002508_2234_2896 220
201 3300053130 Ga0500642_0000001 Ga0500642_0000001_389107_389769 220
202 3300001990 JGI24737J22298_10020170 JGI24737J22298_100201702 221
203 3300005366 Ga0070659_100636302 Ga0070659_1006363022 221
204 3300025904 Ga0207647_10000184 Ga0207647_1000018429 221
205 3300025932 Ga0207690_10262373 Ga0207690_102623731 221
206 3300046543 Ga0495645_0215518 Ga0495645_0215518_577_1242 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

45

240

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9709 5 221
2fli-assembly1.cif.gz_E the crystal structure of d-ribulose 5-phosphate 3-epimerase from streptococus pyogenes complexed with d-xylitol 5-phosphate 0.9621 5 221
5umf-assembly1.cif.gz_C crystal structure of a ribulose-phosphate 3-epimerase from neisseria gonorrhoeae with bound phosphate 0.9541 5 220
1tqj-assembly1.cif.gz_E crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9517 3 221
1tqj-assembly1.cif.gz_B crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9504 3 221
ID Description Score Start End Superfamily
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9717 3 220 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.963 3 220 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9622 5 220 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9543 3 220 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9482 3 221 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1D7NHS1-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9814 24 218 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A7C6E0S9-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9784 24 220 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A7Z9XGJ5-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9773 30 220 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A3N5IL17-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9768 36 220 GO:0004750
GO:0005975
GO:0006098
GO:0046872
AF-A0A534JW75-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9767 21 220 GO:0004750
GO:0005975
GO:0006098
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.12 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map