F315415

General Info

Members Datasets Scaffolds Average Seq Length
206 139 412 388

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0909022|Ga0436361_0909022_871_2145
Length 418
Sequence VGRLLSTVPPSRAIRTAAFGKEEVMDDIWLASALWIGLALAASVLSVWVAVSVALTEIVVGAIAGNVIGLPLAPWVNFLAGFGAILLTFLAGAEIDPLVVRKHFRSSISIGVVGFLAPYAGVLLFARYGAGWPAGISLSTTSVAVVYAVMVETGFNRTEIGKIILAACFVNDLGTVLALGLVFARYDVWLALFAGVTAGTLWLLGKFAPRLLEALGDRVSEPQTKFVALVLLFLGGLASVAGSEAVLPAYLVGMVLAPTFLKDRELPNRMHIVAFTILTPFYFLKAGSLVEAHAVAASAGLIATYLAIKMITKFVGILPLTRVFAFDPREGMYTTLLMSTGLTFGSISALFGLTNHIIDQRQYTILVTAVIGSAVVPTLIAQRWFQPAFKLMEGIDAAPAPVPSSASSPVTGLPNQQR

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
29 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
30 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
34 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
42 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
43 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
44 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
45 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
46 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
49 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
51 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
52 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
57 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
58 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
61 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
62 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
63 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
64 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
65 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
66 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
70 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
74 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
75 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
76 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
89 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
90 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
91 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
115 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
116 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
117 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
118 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
119 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
120 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
121 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
130 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
137 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
138 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
139 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0.49
Isolates 1.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 1.46
Rhizoplane 0.97
Rhizosphere 94.17
Stem 0
Stem Tuber 0
Unclassified 9.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0909022 3300039447 Bacteria 2363
2 JGI26145J50221_1000275 3300003371 Bacteria 4417
3 Ga0070680_100094757 3300005336 Bacteria 2474
4 Ga0070687_100112678 3300005343 Unclassified 1542
5 Ga0070668_100164880 3300005347 Bacteria 1800
6 Ga0070667_100023595 3300005367 Bacteria 5106
7 Ga0070714_100117529 3300005435 Bacteria 2362
8 Ga0070700_100042973 3300005441 Bacteria 2778
9 Ga0070708_100024360 3300005445 Bacteria 5162
10 Ga0070708_100054909 3300005445 Bacteria 3541
11 Ga0070663_100141830 3300005455 Bacteria 1835
12 Ga0070681_10016732 3300005458 Bacteria 7320
13 Ga0070681_10021126 3300005458 Bacteria 6523
14 Ga0070706_100002218 3300005467 Bacteria 19735
15 Ga0070706_100009864 3300005467 Bacteria 8875
16 Ga0070706_100016923 3300005467 Bacteria 6736
17 Ga0070706_100197359 3300005467 Bacteria 1880
18 Ga0070707_100005748 3300005468 Bacteria 11568
19 Ga0070707_100052710 3300005468 Bacteria 3901
20 Ga0070707_100061402 3300005468 Bacteria 3604
21 Ga0070707_100132179 3300005468 Bacteria 2427
22 Ga0070707_100176359 3300005468 Bacteria 2083
23 Ga0070698_100008508 3300005471 Bacteria 11077
24 Ga0070698_100208012 3300005471 Unclassified 1892
25 Ga0070699_100007996 3300005518 Bacteria 9183
26 Ga0070699_100025817 3300005518 Bacteria 5063
27 Ga0070699_100160765 3300005518 Unclassified 1988
28 Ga0070679_100026756 3300005530 Bacteria 5672
29 Ga0070697_100001766 3300005536 Bacteria 16508
30 Ga0070697_100043212 3300005536 Bacteria 3648
31 Ga0070697_100058548 3300005536 Bacteria 3136
32 Ga0070695_100000447 3300005545 Bacteria 21465
33 Ga0070696_100013015 3300005546 Bacteria 5582
34 Ga0068861_100071990 3300005719 Bacteria 2681
35 Ga0070712_100046483 3300006175 Bacteria 3001
36 Ga0075428_100106575 3300006844 Plasmid 3055
37 Ga0075433_10196548 3300006852 Bacteria 1794
38 Ga0075434_100184637 3300006871 Unclassified 2106
39 Ga0099794_10018590 3300007265 Bacteria 3118
40 Ga0111539_10161723 3300009094 Plasmid 2618
41 Ga0114129_10004595 3300009147 Bacteria 19485
42 Ga0114129_10089602 3300009147 Bacteria 4265
43 Ga0114129_10208777 3300009147 Plasmid 2641
44 Ga0114129_10370723 3300009147 Bacteria 1892
45 Ga0123340_1000026 3300009763 Bacteria 46465
46 Ga0123341_1000042 3300009765 Bacteria 58276
47 Ga0157370_10017939 3300013104 Bacteria 7127
48 Ga0157372_10232089 3300013307 Bacteria 2139
49 Ga0163161_10055905 3300017792 Bacteria 2866
50 Ga0213875_10004683 3300021388 Bacteria 7452
51 Ga0207684_10000810 3300025910 Bacteria 36160
52 Ga0207684_10003735 3300025910 Bacteria 14717
53 Ga0207684_10070472 3300025910 Bacteria 2971
54 Ga0207684_10081302 3300025910 Bacteria 2757
55 Ga0207707_10078542 3300025912 Bacteria 2882
56 Ga0207660_10062877 3300025917 Unclassified 2675
57 Ga0207652_10014609 3300025921 Bacteria 6367
58 Ga0207646_10000699 3300025922 Bacteria 43480
59 Ga0207646_10026579 3300025922 Bacteria 5281
60 Ga0207646_10179466 3300025922 Bacteria 1912
61 Ga0207678_10233007 3300026067 Bacteria 1577
62 Ga0207708_10022740 3300026075 Bacteria 4735
63 Ga0265356_1003502 3300028017 Bacteria 1978
64 Ga0265356_1007098 3300028017 Bacteria 1298
65 Ga0265326_10004896 3300028558 Bacteria 4243
66 Ga0265334_10014345 3300028573 Bacteria 3304
67 Ga0265318_10024659 3300028577 Bacteria 2383
68 Ga0265323_10002139 3300028653 Bacteria 9208
69 Ga0265323_10005987 3300028653 Bacteria 5143
70 Ga0265322_10003218 3300028654 Unclassified 4956
71 Ga0265338_10000033 3300028800 Bacteria 251901
72 Ga0265338_10128783 3300028800 Bacteria 2003
73 Ga0265324_10054510 3300029957 Bacteria 1372
74 Ga0265760_10000263 3300031090 Bacteria 14190
75 Ga0265330_10044097 3300031235 Bacteria 1971
76 Ga0265328_10012538 3300031239 Bacteria 3371
77 Ga0265325_10012352 3300031241 Bacteria 4887
78 Ga0265325_10038898 3300031241 Bacteria 2507
79 Ga0265340_10075920 3300031247 Unclassified 1587
80 Ga0265339_10013281 3300031249 Bacteria 4996
81 Ga0265331_10042170 3300031250 Unclassified 2214
82 Ga0265316_10006776 3300031344 Bacteria 10906
83 Ga0265316_10022858 3300031344 Bacteria 5261
84 Ga0265316_10052269 3300031344 Bacteria 3206
85 Ga0265316_10063029 3300031344 Bacteria 2876
86 Ga0307408_100046999 3300031548 Bacteria 3089
87 Ga0265313_10039744 3300031595 Unclassified 2332
88 Ga0265314_10015842 3300031711 Bacteria 5971
89 Ga0265342_10026788 3300031712 Bacteria 3609
90 Ga0265342_10084756 3300031712 Unclassified 1824
91 Ga0373944_0003692 3300035089 Bacteria 3959
92 Ga0373923_0018409 3300035111 Bacteria 2688
93 Ga0373941_0006271 3300035115 Bacteria 2855
94 Ga0373943_0001580 3300035170 Bacteria 10312
95 Ga0373943_0020346 3300035170 Bacteria 3058
96 Ga0373955_0140905 3300035172 Bacteria 1414
97 Ga0373931_0011077 3300035691 Bacteria 4348
98 Ga0373931_0080493 3300035691 Bacteria 1796
99 Ga0373935_0057045 3300035692 Bacteria 2491
100 Ga0373927_0008950 3300035695 Bacteria 6723
101 Ga0373927_0011450 3300035695 Bacteria 5907
102 Ga0373933_0035870 3300035724 Bacteria 2900
103 Ga0373933_0184844 3300035724 Bacteria 1330
104 Ga0373947_0000372 3300035725 Bacteria 25344
105 Ga0373947_0057350 3300035725 Bacteria 2356
106 Ga0373937_0017306 3300036401 Bacteria 6419
107 Ga0373937_0028323 3300036401 Bacteria 5068
108 Ga0373925_0002858 3300037068 Bacteria 13624
109 Ga0373925_0089695 3300037068 Unclassified 2349
110 Ga0436364_0533917 3300037853 Bacteria 9986
111 Ga0436361_0091512 3300039447 Bacteria 1992
112 Ga0436363_0194616 3300039450 Bacteria 1514
113 Ga0439435_0001859 3300042436 Bacteria 4037
114 Ga0439460_0000736 3300042461 Bacteria 7332
115 Ga0495629_0002804 3300046459 Bacteria 13292
116 Ga0495629_0006077 3300046459 Bacteria 8970
117 Ga0495580_0112541 3300046472 Bacteria 1890
118 Ga0495582_0000987 3300046473 Bacteria 15918
119 Ga0495582_0008469 3300046473 Bacteria 5676
120 Ga0495639_0012844 3300046475 Bacteria 3613
121 Ga0495662_0006986 3300046476 Bacteria 5607
122 Ga0495664_0000144 3300046477 Bacteria 35748
123 Ga0495610_0000749 3300046512 Bacteria 30647
124 Ga0495618_0003392 3300046514 Bacteria 9914
125 Ga0495620_0001040 3300046515 Bacteria 17034
126 Ga0495630_0009233 3300046517 Bacteria 7089
127 Ga0495630_0049600 3300046517 Bacteria 3141
128 Ga0495652_0028917 3300046529 Bacteria 4871
129 Ga0495665_0006053 3300046531 Bacteria 6525
130 Ga0495665_0022800 3300046531 Bacteria 3363
131 Ga0495640_0027521 3300046533 Bacteria 4099
132 Ga0495640_0077604 3300046533 Bacteria 2214
133 Ga0495645_0002881 3300046543 Bacteria 11681
134 Ga0495667_0191420 3300046559 Bacteria 1311
135 Ga0495634_0002694 3300046642 Bacteria 14601
136 Ga0495634_0004110 3300046642 Bacteria 11526
137 Ga0495634_0050255 3300046642 Bacteria 2801
138 Ga0495635_0001658 3300046663 Bacteria 14993
139 Ga0495635_0021489 3300046663 Bacteria 4499
140 Ga0495658_0002002 3300046683 Bacteria 10378
141 Ga0495658_0027653 3300046683 Bacteria 3054
142 Ga0495658_0066823 3300046683 Bacteria 2078
143 Ga0495613_0004124 3300046689 Bacteria 10870
144 Ga0495613_0139079 3300046689 Bacteria 1736
145 Ga0495624_0004176 3300046690 Bacteria 10614
146 Ga0495624_0018362 3300046690 Bacteria 4677
147 Ga0495581_0009267 3300047315 Bacteria 5697
148 Ga0495581_0016504 3300047315 Bacteria 4291
149 Ga0495636_0036257 3300047318 Bacteria 2033
150 Ga0495674_0000899 3300047319 Bacteria 28421
151 Ga0495676_0025323 3300047321 Bacteria 5125
152 Ga0495676_0133049 3300047321 Bacteria 1792
153 Ga0495684_0002131 3300047471 Bacteria 15891
154 Ga0495684_0003351 3300047471 Bacteria 12580
155 Ga0495684_0005336 3300047471 Bacteria 10006
156 Ga0495593_0055533 3300047673 Bacteria 2084
157 Ga0495602_0099686 3300048088 Bacteria 2388
158 Ga0496102_0227017 3300048905 Bacteria 1761
159 Ga0496112_0133424 3300048915 Bacteria 2454
160 Ga0501031_0204657 3300049568 Unclassified 1287
161 Ga0501036_0060331 3300049572 Bacteria 3213
162 Ga0501036_0115110 3300049572 Bacteria 2272
163 Ga0501037_0173818 3300049573 Bacteria 1530
164 Ga0501039_0033687 3300049575 Bacteria 3951
165 Ga0501039_0092880 3300049575 Bacteria 2352
166 Ga0501039_0110819 3300049575 Bacteria 2145
167 Ga0501039_0140795 3300049575 Bacteria 1895
168 Ga0501041_0023056 3300049577 Bacteria 3731
169 Ga0501041_0086335 3300049577 Unclassified 1936
170 Ga0501046_0089843 3300049580 Unclassified 2364
171 Ga0501046_0161852 3300049580 Unclassified 1683
172 Ga0501047_0171627 3300049581 Bacteria 2037
173 Ga0501048_0067029 3300049582 Unclassified 2538
174 Ga0501068_0129973 3300049584 Unclassified 1575
175 Ga0501072_0003089 3300049588 Bacteria 12553
176 Ga0501072_0093686 3300049588 Bacteria 2386
177 Ga0501074_0193640 3300049590 Bacteria 1449
178 Ga0501075_0013718 3300049591 Bacteria 5791
179 Ga0501075_0099597 3300049591 Bacteria 2207
180 Ga0501076_0026870 3300049592 Bacteria 4461
181 Ga0501076_0104785 3300049592 Bacteria 2282
182 Ga0501077_0018200 3300049593 Bacteria 4443
183 Ga0501079_0010357 3300049741 Bacteria 7086
184 Ga0501081_0001526 3300049743 Bacteria 14211
185 Ga0501081_0031851 3300049743 Bacteria 3574
186 Ga0501083_0022405 3300049744 Bacteria 4385
187 Ga0501044_0220168 3300049823 Bacteria 1849
188 Ga0501045_0061918 3300049824 Bacteria 2746
189 nmdc:mga05p37_12241_c1 3300050507 Bacteria 10243
190 nmdc:mga05p37_262413_c1 3300050507 Unclassified 2067
191 nmdc:mga08x19_42795_c1 3300050514 Bacteria 2888
192 nmdc:mga0a205_213820_c1 3300050515 Bacteria 1815
193 Ga0495601_0001757 3300053077 Bacteria 11999
194 Ga0495601_0080726 3300053077 Unclassified 2087
195 Ga0495601_0221847 3300053077 Bacteria 1235
196 Ga0495612_0001985 3300053078 Bacteria 8424
197 Ga0495595_0035338 3300053084 Unclassified 2264
198 Ga0495619_0000587 3300053085 Bacteria 24241
199 Ga0500568_0021837 3300053139 Bacteria 2748
200 Ga0500616_0030190 3300053153 Bacteria 2978
201 Ga0501084_0012661 3300054114 Bacteria 6990
202 Ga0501082_0013058 3300060353 Bacteria 7138
203 Ga0530510_0000436 3300061734 Bacteria 26911
204 2852394601 2852387548 Bacteria 8025568
205 2881163486 2881161766 Bacteria 7127907
206 2923561604 2923556063 Bacteria 6793593
207 Ga0436361_0909022
208 JGI26145J50221_1000275
209 Ga0070680_100094757
210 Ga0070687_100112678
211 Ga0070668_100164880
212 Ga0070667_100023595
213 Ga0070714_100117529
214 Ga0070700_100042973
215 Ga0070708_100024360
216 Ga0070708_100054909
217 Ga0070663_100141830
218 Ga0070681_10016732
219 Ga0070681_10021126
220 Ga0070706_100002218
221 Ga0070706_100009864
222 Ga0070706_100016923
223 Ga0070706_100197359
224 Ga0070707_100005748
225 Ga0070707_100052710
226 Ga0070707_100061402
227 Ga0070707_100132179
228 Ga0070707_100176359
229 Ga0070698_100008508
230 Ga0070698_100208012
231 Ga0070699_100007996
232 Ga0070699_100025817
233 Ga0070699_100160765
234 Ga0070679_100026756
235 Ga0070697_100001766
236 Ga0070697_100043212
237 Ga0070697_100058548
238 Ga0070695_100000447
239 Ga0070696_100013015
240 Ga0068861_100071990
241 Ga0070712_100046483
242 Ga0075428_100106575
243 Ga0075433_10196548
244 Ga0075434_100184637
245 Ga0099794_10018590
246 Ga0111539_10161723
247 Ga0114129_10004595
248 Ga0114129_10089602
249 Ga0114129_10208777
250 Ga0114129_10370723
251 Ga0123340_1000026
252 Ga0123341_1000042
253 Ga0157370_10017939
254 Ga0157372_10232089
255 Ga0163161_10055905
256 Ga0213875_10004683
257 Ga0207684_10000810
258 Ga0207684_10003735
259 Ga0207684_10070472
260 Ga0207684_10081302
261 Ga0207707_10078542
262 Ga0207660_10062877
263 Ga0207652_10014609
264 Ga0207646_10000699
265 Ga0207646_10026579
266 Ga0207646_10179466
267 Ga0207678_10233007
268 Ga0207708_10022740
269 Ga0265356_1003502
270 Ga0265356_1007098
271 Ga0265326_10004896
272 Ga0265334_10014345
273 Ga0265318_10024659
274 Ga0265323_10002139
275 Ga0265323_10005987
276 Ga0265322_10003218
277 Ga0265338_10000033
278 Ga0265338_10128783
279 Ga0265324_10054510
280 Ga0265760_10000263
281 Ga0265330_10044097
282 Ga0265328_10012538
283 Ga0265325_10012352
284 Ga0265325_10038898
285 Ga0265340_10075920
286 Ga0265339_10013281
287 Ga0265331_10042170
288 Ga0265316_10006776
289 Ga0265316_10022858
290 Ga0265316_10052269
291 Ga0265316_10063029
292 Ga0307408_100046999
293 Ga0265313_10039744
294 Ga0265314_10015842
295 Ga0265342_10026788
296 Ga0265342_10084756
297 Ga0373944_0003692
298 Ga0373923_0018409
299 Ga0373941_0006271
300 Ga0373943_0001580
301 Ga0373943_0020346
302 Ga0373955_0140905
303 Ga0373931_0011077
304 Ga0373931_0080493
305 Ga0373935_0057045
306 Ga0373927_0008950
307 Ga0373927_0011450
308 Ga0373933_0035870
309 Ga0373933_0184844
310 Ga0373947_0000372
311 Ga0373947_0057350
312 Ga0373937_0017306
313 Ga0373937_0028323
314 Ga0373925_0002858
315 Ga0373925_0089695
316 Ga0436364_0533917
317 Ga0436361_0091512
318 Ga0436363_0194616
319 Ga0439435_0001859
320 Ga0439460_0000736
321 Ga0495629_0002804
322 Ga0495629_0006077
323 Ga0495580_0112541
324 Ga0495582_0000987
325 Ga0495582_0008469
326 Ga0495639_0012844
327 Ga0495662_0006986
328 Ga0495664_0000144
329 Ga0495610_0000749
330 Ga0495618_0003392
331 Ga0495620_0001040
332 Ga0495630_0009233
333 Ga0495630_0049600
334 Ga0495652_0028917
335 Ga0495665_0006053
336 Ga0495665_0022800
337 Ga0495640_0027521
338 Ga0495640_0077604
339 Ga0495645_0002881
340 Ga0495667_0191420
341 Ga0495634_0002694
342 Ga0495634_0004110
343 Ga0495634_0050255
344 Ga0495635_0001658
345 Ga0495635_0021489
346 Ga0495658_0002002
347 Ga0495658_0027653
348 Ga0495658_0066823
349 Ga0495613_0004124
350 Ga0495613_0139079
351 Ga0495624_0004176
352 Ga0495624_0018362
353 Ga0495581_0009267
354 Ga0495581_0016504
355 Ga0495636_0036257
356 Ga0495674_0000899
357 Ga0495676_0025323
358 Ga0495676_0133049
359 Ga0495684_0002131
360 Ga0495684_0003351
361 Ga0495684_0005336
362 Ga0495593_0055533
363 Ga0495602_0099686
364 Ga0496102_0227017
365 Ga0496112_0133424
366 Ga0501031_0204657
367 Ga0501036_0060331
368 Ga0501036_0115110
369 Ga0501037_0173818
370 Ga0501039_0033687
371 Ga0501039_0092880
372 Ga0501039_0110819
373 Ga0501039_0140795
374 Ga0501041_0023056
375 Ga0501041_0086335
376 Ga0501046_0089843
377 Ga0501046_0161852
378 Ga0501047_0171627
379 Ga0501048_0067029
380 Ga0501068_0129973
381 Ga0501072_0003089
382 Ga0501072_0093686
383 Ga0501074_0193640
384 Ga0501075_0013718
385 Ga0501075_0099597
386 Ga0501076_0026870
387 Ga0501076_0104785
388 Ga0501077_0018200
389 Ga0501079_0010357
390 Ga0501081_0001526
391 Ga0501081_0031851
392 Ga0501083_0022405
393 Ga0501044_0220168
394 Ga0501045_0061918
395 nmdc:mga05p37_12241_c1
396 nmdc:mga05p37_262413_c1
397 nmdc:mga08x19_42795_c1
398 nmdc:mga0a205_213820_c1
399 Ga0495601_0001757
400 Ga0495601_0080726
401 Ga0495601_0221847
402 Ga0495612_0001985
403 Ga0495595_0035338
404 Ga0495619_0000587
405 Ga0500568_0021837
406 Ga0500616_0030190
407 Ga0501084_0012661
408 Ga0501082_0013058
409 Ga0530510_0000436
410 2852394601
411 2881163486
412 2923561604

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

30

386

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bz2-assembly1.cif.gz_A-2 crystal structure of the sodium proton antiporter napa in inward-facing conformation 0.8045 1 379
8hya-assembly1.cif.gz_A cryo-em structure of arabidopsis thaliana sos1 in an occluded state, with expanded tmd 0.801 7 371
8jd9-assembly1.cif.gz_A cyro-em structure of the na+/h+ antipoter sos1 from arabidopsis thaliana,class1 0.7989 7 381
8pd3-assembly1.cif.gz_A ligand-free spslc9c1 in lipid nanodiscs, protomer state 2 0.7888 1 372
8pd5-assembly1.cif.gz_A ligand-free spslc9c1 in lipid nanodiscs, protomer state 3 0.7877 2 372
ID Description Score Start End Superfamily
af_Q9P7I1_23_428_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8742 5 372 1.20.1530.20
af_Q54GC7_13_418_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.874 5 372 1.20.1530.20
af_Q9SA37_20_418_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8598 5 371 1.20.1530.20
af_I1LYU2_28_437_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8556 5 371 1.20.1530.20
af_Q58671_3_387_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.8525 5 381 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A7C1IE06-F1-model_v4 Cation:proton antiporter 0.9912 1 384 GO:0006814
GO:0015297
GO:0016020
GO:1902600
AF-A0A7V0YGG6-F1-model_v4 Cation:proton antiporter 0.9906 1 384 GO:0006814
GO:0015297
GO:0016020
GO:1902600
AF-A0A1G3QLS2-F1-model_v4 Potassium transporter Kef 0.9887 1 379 GO:0006814
GO:0015297
GO:0016020
GO:1902600
AF-A0A430R2V0-F1-model_v4 Potassium transporter Kef 0.9882 4 381 GO:0006814
GO:0015297
GO:0016020
GO:1902600
AF-A0A7V3RY27-F1-model_v4 Cation:proton antiporter 0.987 1 349 GO:0006814
GO:0015297
GO:0016020
GO:1902600

Map