F315348

General Info

Members Datasets Scaffolds Average Seq Length
206 143 412 178

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0007514|Ga0373956_0007514_984_1562
Length 192
Sequence VGLICLEDAQKETVTMVYNPYEYLPQVASFHVTSTDIRDGEKLSLPQASGIFGAGGEDISPQLAWSGFPDGTKSFVVTMYDPDAPTASGFWHWAVVDIPGEMTGLARGAGDKEDGSSLPAGAFQLRHDGGVARFIGAAPPVGHGRHRYFTVVHAVDVASLGIGREVTPAFLGFNLFFHTLGRAILVPWYERT

Samples

Sample ID Description Type Environment
1 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
96 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
102 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
134 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
135 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
136 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
139 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
140 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
141 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
142 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
143 2928142448 Prescottella equi DPS 2018 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.63
Metatranscriptomes 1.94
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.22
Nodule 0
Rhizoplane 4.37
Rhizosphere 83.98
Stem 0
Stem Tuber 0
Unclassified 1.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373956_0007514 3300035119 Bacteria 4390
2 Ga0055540_1001465 3300003792 Bacteria 14068
3 Ga0070683_100102847 3300005329 Bacteria 2691
4 Ga0070683_100203023 3300005329 Bacteria 1883
5 Ga0070682_100060638 3300005337 Bacteria 2393
6 Ga0070682_100220412 3300005337 Bacteria 1350
7 Ga0070660_100002831 3300005339 Bacteria 11936
8 Ga0070660_100061804 3300005339 Bacteria 2909
9 Ga0070661_100009102 3300005344 Bacteria 6866
10 Ga0070661_100114888 3300005344 Bacteria 2012
11 Ga0070659_100003810 3300005366 Bacteria 10756
12 Ga0070659_100287735 3300005366 Bacteria 1368
13 Ga0070714_100236802 3300005435 Bacteria 1684
14 Ga0070714_100603052 3300005435 Bacteria 1055
15 Ga0070711_100214688 3300005439 Bacteria 1492
16 Ga0070708_100030798 3300005445 Bacteria 4640
17 Ga0070708_100630762 3300005445 Bacteria 1010
18 Ga0070663_100052738 3300005455 Bacteria 2902
19 Ga0070678_100398333 3300005456 Bacteria 1195
20 Ga0070681_10053282 3300005458 Bacteria 4031
21 Ga0070681_10183668 3300005458 Bacteria 2012
22 Ga0070685_10102239 3300005466 Bacteria 1752
23 Ga0070706_100007814 3300005467 Bacteria 9996
24 Ga0070706_101279478 3300005467 Bacteria 673
25 Ga0070707_100003005 3300005468 Bacteria 16001
26 Ga0070707_100054129 3300005468 Bacteria 3847
27 Ga0070707_100572636 3300005468 Bacteria 1091
28 Ga0070679_100246657 3300005530 Bacteria 1743
29 Ga0070679_100256077 3300005530 Bacteria 1706
30 Ga0070684_100035944 3300005535 Bacteria 4243
31 Ga0070684_100459099 3300005535 Bacteria 1178
32 Ga0070697_100455974 3300005536 Bacteria 1114
33 Ga0068853_100109719 3300005539 Bacteria 2450
34 Ga0070665_100016344 3300005548 Bacteria 7441
35 Ga0068855_100052530 3300005563 Bacteria 4797
36 Ga0068855_100186794 3300005563 Bacteria 2340
37 Ga0068855_100653699 3300005563 Bacteria 1129
38 Ga0068857_100018939 3300005577 Bacteria 6039
39 Ga0068854_100314998 3300005578 Bacteria 1270
40 Ga0068856_100040748 3300005614 Bacteria 4562
41 Ga0068856_100049064 3300005614 Bacteria 4161
42 Ga0068852_100035193 3300005616 Bacteria 4174
43 Ga0068863_100127845 3300005841 Bacteria 2425
44 Ga0068858_100187569 3300005842 Bacteria 1953
45 Ga0075365_10007894 3300006038 Bacteria 5996
46 Ga0075364_10222520 3300006051 Bacteria 1281
47 Ga0075369_10013480 3300006186 Bacteria 3247
48 Ga0075369_10024153 3300006186 Bacteria 2517
49 Ga0075370_10079299 3300006353 Bacteria 1886
50 Ga0105240_10369753 3300009093 Bacteria 1621
51 Ga0105247_10116608 3300009101 Bacteria 1725
52 Ga0105241_10097063 3300009174 Bacteria 2335
53 Ga0105248_10039044 3300009177 Bacteria 5315
54 Ga0105237_10037858 3300009545 Bacteria 4873
55 Ga0105237_10699840 3300009545 Bacteria 1020
56 Ga0105238_10005537 3300009551 Bacteria 12469
57 Ga0105239_10028691 3300010375 Bacteria 6119
58 Ga0105239_10066148 3300010375 Bacteria 3971
59 Ga0157373_10598197 3300013100 Bacteria 803
60 Ga0157371_10034231 3300013102 Bacteria 3644
61 Ga0157370_10007249 3300013104 Bacteria 12097
62 Ga0157370_10044769 3300013104 Bacteria 4250
63 Ga0157370_10110568 3300013104 Bacteria 2569
64 Ga0157369_10013678 3300013105 Bacteria 9176
65 Ga0157369_10057072 3300013105 Bacteria 4213
66 Ga0157369_10357616 3300013105 Bacteria 1516
67 Ga0157374_10571136 3300013296 Bacteria 1139
68 Ga0157374_10665295 3300013296 Bacteria 1054
69 Ga0157372_10071398 3300013307 Bacteria 3910
70 Ga0157372_10503250 3300013307 Bacteria 1413
71 Ga0157375_10212505 3300013308 Bacteria 2092
72 Ga0206356_10572456 3300020070 Bacteria 4568
73 Ga0206354_10565872 3300020081 Bacteria 2449
74 Ga0206353_11331156 3300020082 Bacteria 1717
75 Ga0224712_10372353 3300022467 Bacteria 678
76 Ga0209673_1012097 3300025273 Bacteria 3504
77 Ga0209673_1022031 3300025273 Bacteria 2210
78 Ga0209051_1004935 3300025303 Bacteria 7981
79 Ga0209051_1007611 3300025303 Bacteria 5896
80 Ga0207710_10111485 3300025900 Bacteria 1299
81 Ga0207705_10096691 3300025909 Bacteria 2168
82 Ga0207684_10049367 3300025910 Bacteria 3570
83 Ga0207684_10085435 3300025910 Bacteria 2688
84 Ga0207684_10160045 3300025910 Bacteria 1939
85 Ga0207707_10012103 3300025912 Bacteria 7503
86 Ga0207707_10319257 3300025912 Bacteria 1341
87 Ga0207671_10108540 3300025914 Bacteria 2109
88 Ga0207663_10137061 3300025916 Bacteria 1700
89 Ga0207660_10309183 3300025917 Bacteria 1260
90 Ga0207657_10001017 3300025919 Bacteria 29789
91 Ga0207657_10002341 3300025919 Bacteria 20536
92 Ga0207657_10057884 3300025919 Bacteria 3338
93 Ga0207657_10103633 3300025919 Bacteria 2358
94 Ga0207649_10573883 3300025920 Bacteria 865
95 Ga0207646_10031121 3300025922 Bacteria 4832
96 Ga0207646_10037147 3300025922 Bacteria 4392
97 Ga0207646_10631532 3300025922 Bacteria 960
98 Ga0207646_11182951 3300025922 Bacteria 671
99 Ga0207646_11443733 3300025922 Bacteria 597
100 Ga0207690_10221934 3300025932 Bacteria 1446
101 Ga0207690_10290769 3300025932 Bacteria 1275
102 Ga0207661_10073717 3300025944 Bacteria 2797
103 Ga0207667_10049347 3300025949 Bacteria 4445
104 Ga0207667_10112784 3300025949 Bacteria 2803
105 Ga0207667_10402720 3300025949 Bacteria 1393
106 Ga0207640_10222430 3300025981 Bacteria 1446
107 Ga0207703_10613918 3300026035 Bacteria 1029
108 Ga0207639_10023572 3300026041 Bacteria 4445
109 Ga0207678_10351507 3300026067 Bacteria 1271
110 Ga0207678_10584452 3300026067 Bacteria 978
111 Ga0207702_10155632 3300026078 Bacteria 2083
112 Ga0207641_10474221 3300026088 Bacteria 1212
113 Ga0207674_10021591 3300026116 Bacteria 6931
114 Ga0207683_10178374 3300026121 Bacteria 1926
115 Ga0207698_10235620 3300026142 Bacteria 1664
116 Ga0268266_10030889 3300028379 Bacteria 4549
117 Ga0265334_10001625 3300028573 Bacteria 10806
118 Ga0265338_10040560 3300028800 Bacteria 4371
119 Ga0265338_10506583 3300028800 Bacteria 849
120 Ga0307405_10026391 3300031731 Bacteria 3350
121 Ga0307410_10441126 3300031852 Bacteria 1060
122 Ga0307410_10517530 3300031852 Bacteria 984
123 Ga0307410_11224796 3300031852 Bacteria 654
124 Ga0307406_10185848 3300031901 Bacteria 1517
125 Ga0307406_10506277 3300031901 Bacteria 980
126 Ga0307406_11048209 3300031901 Bacteria 702
127 Ga0307407_10188238 3300031903 Bacteria 1373
128 Ga0307412_10393108 3300031911 Bacteria 1126
129 Ga0307409_100022327 3300031995 Bacteria 4361
130 Ga0307409_100023243 3300031995 Bacteria 4291
131 Ga0307409_100375652 3300031995 Bacteria 1349
132 Ga0307409_100495735 3300031995 Bacteria 1188
133 Ga0307409_100654008 3300031995 Bacteria 1045
134 Ga0307409_101017790 3300031995 Bacteria 847
135 Ga0307416_100023921 3300032002 Bacteria 4445
136 Ga0307416_100208552 3300032002 Bacteria 1862
137 Ga0307416_100213525 3300032002 Bacteria 1843
138 Ga0307416_100408553 3300032002 Bacteria 1398
139 Ga0307416_101148805 3300032002 Bacteria 882
140 Ga0307416_101251589 3300032002 Bacteria 848
141 Ga0307414_10052244 3300032004 Bacteria 2843
142 Ga0307414_10614727 3300032004 Bacteria 976
143 Ga0307411_10366069 3300032005 Bacteria 1181
144 Ga0307415_100026892 3300032126 Bacteria 3637
145 Ga0307415_100598050 3300032126 Bacteria 981
146 Ga0373927_0000924 3300035695 Bacteria 22246
147 Ga0373933_0030888 3300035724 Bacteria 3104
148 Ga0373937_0239069 3300036401 Bacteria 1711
149 Ga0373925_0459547 3300037068 Bacteria 1043
150 Ga0395905_0048486 3300037471 Bacteria 3981
151 Ga0436364_0031238 3300037853 Bacteria 1309
152 Ga0436364_0611162 3300037853 Unclassified 2235
153 Ga0466961_0360933 3300044693 Bacteria 884
154 Ga0466964_0069675 3300044706 Bacteria 1484
155 Ga0466960_0463300 3300044901 Bacteria 738
156 Ga0466967_0003480 3300045976 Bacteria 10281
157 Ga0466967_1185552 3300045976 Bacteria 761
158 Ga0466967_1287510 3300045976 Bacteria 728
159 Ga0495638_0005869 3300046460 Bacteria 9028
160 Ga0495653_0421927 3300046463 Unclassified 844
161 Ga0495586_0062074 3300046535 Bacteria 2034
162 Ga0495658_0047109 3300046683 Archaea 2426
163 Ga0495613_0125939 3300046689 Archaea 1837
164 Ga0495649_0242031 3300046694 Bacteria 929
165 Ga0495589_0252792 3300046794 Bacteria 823
166 Ga0496100_0002057 3300048903 Bacteria 10098
167 Ga0496101_0045425 3300048904 Bacteria 3146
168 Ga0496102_0581113 3300048905 Bacteria 1043
169 Ga0496104_0002493 3300048907 Bacteria 15843
170 Ga0496105_0016194 3300048908 Bacteria 5948
171 Ga0496107_0034730 3300048910 Bacteria 3612
172 Ga0496112_1362593 3300048915 Bacteria 624
173 Ga0496114_0004176 3300048917 Bacteria 11183
174 Ga0496115_0845026 3300048918 Bacteria 709
175 Ga0501031_0046362 3300049568 Bacteria 2834
176 Ga0501032_0008332 3300049569 Bacteria 7554
177 Ga0501033_0019750 3300049570 Bacteria 5092
178 Ga0501034_0009321 3300049571 Bacteria 10286
179 Ga0501036_0036559 3300049572 Bacteria 4155
180 Ga0501037_0002676 3300049573 Bacteria 12848
181 Ga0501038_0006637 3300049574 Bacteria 10705
182 Ga0501039_0005343 3300049575 Bacteria 9714
183 Ga0501043_0005234 3300049579 Bacteria 10488
184 Ga0501046_0001917 3300049580 Bacteria 19745
185 Ga0501047_0014166 3300049581 Bacteria 7576
186 Ga0501048_0021681 3300049582 Bacteria 4701
187 Ga0501070_0004616 3300049586 Bacteria 11811
188 Ga0501073_0067714 3300049589 Bacteria 2489
189 Ga0501073_0548106 3300049589 Unclassified 799
190 Ga0501035_0028236 3300049822 Bacteria 5121
191 Ga0501044_0155357 3300049823 Bacteria 2267
192 Ga0501045_0015089 3300049824 Bacteria 5483
193 nmdc:mga00v17_624643_c1 3300050491 Bacteria 694
194 nmdc:mga0yw44_124211_c1 3300050492 Bacteria 1665
195 nmdc:mga07m45_15143_c1 3300050496 Bacteria 2585
196 nmdc:mga0sz30_20918_c1 3300050516 Bacteria 2643
197 nmdc:mga0sz30_50390_c1 3300050516 Bacteria 1765
198 Ga0500556_0134088 3300053104 Bacteria 971
199 Ga0500559_0242378 3300053136 Bacteria 849
200 Ga0500616_0032288 3300053153 Bacteria 2862
201 Ga0500627_0420159 3300053158 Bacteria 567
202 2515850861 2515154155 Bacteria 7985436
203 2523386790 2523231044 Bacteria 6434991
204 2739205092 2738543005 Bacteria 5278128
205 2857713177 2857710386 Bacteria 3186771
206 2928144490 2928142448 Bacteria 5288925
207 Ga0373956_0007514
208 Ga0055540_1001465
209 Ga0070683_100102847
210 Ga0070683_100203023
211 Ga0070682_100060638
212 Ga0070682_100220412
213 Ga0070660_100002831
214 Ga0070660_100061804
215 Ga0070661_100009102
216 Ga0070661_100114888
217 Ga0070659_100003810
218 Ga0070659_100287735
219 Ga0070714_100236802
220 Ga0070714_100603052
221 Ga0070711_100214688
222 Ga0070708_100030798
223 Ga0070708_100630762
224 Ga0070663_100052738
225 Ga0070678_100398333
226 Ga0070681_10053282
227 Ga0070681_10183668
228 Ga0070685_10102239
229 Ga0070706_100007814
230 Ga0070706_101279478
231 Ga0070707_100003005
232 Ga0070707_100054129
233 Ga0070707_100572636
234 Ga0070679_100246657
235 Ga0070679_100256077
236 Ga0070684_100035944
237 Ga0070684_100459099
238 Ga0070697_100455974
239 Ga0068853_100109719
240 Ga0070665_100016344
241 Ga0068855_100052530
242 Ga0068855_100186794
243 Ga0068855_100653699
244 Ga0068857_100018939
245 Ga0068854_100314998
246 Ga0068856_100040748
247 Ga0068856_100049064
248 Ga0068852_100035193
249 Ga0068863_100127845
250 Ga0068858_100187569
251 Ga0075365_10007894
252 Ga0075364_10222520
253 Ga0075369_10013480
254 Ga0075369_10024153
255 Ga0075370_10079299
256 Ga0105240_10369753
257 Ga0105247_10116608
258 Ga0105241_10097063
259 Ga0105248_10039044
260 Ga0105237_10037858
261 Ga0105237_10699840
262 Ga0105238_10005537
263 Ga0105239_10028691
264 Ga0105239_10066148
265 Ga0157373_10598197
266 Ga0157371_10034231
267 Ga0157370_10007249
268 Ga0157370_10044769
269 Ga0157370_10110568
270 Ga0157369_10013678
271 Ga0157369_10057072
272 Ga0157369_10357616
273 Ga0157374_10571136
274 Ga0157374_10665295
275 Ga0157372_10071398
276 Ga0157372_10503250
277 Ga0157375_10212505
278 Ga0206356_10572456
279 Ga0206354_10565872
280 Ga0206353_11331156
281 Ga0224712_10372353
282 Ga0209673_1012097
283 Ga0209673_1022031
284 Ga0209051_1004935
285 Ga0209051_1007611
286 Ga0207710_10111485
287 Ga0207705_10096691
288 Ga0207684_10049367
289 Ga0207684_10085435
290 Ga0207684_10160045
291 Ga0207707_10012103
292 Ga0207707_10319257
293 Ga0207671_10108540
294 Ga0207663_10137061
295 Ga0207660_10309183
296 Ga0207657_10001017
297 Ga0207657_10002341
298 Ga0207657_10057884
299 Ga0207657_10103633
300 Ga0207649_10573883
301 Ga0207646_10031121
302 Ga0207646_10037147
303 Ga0207646_10631532
304 Ga0207646_11182951
305 Ga0207646_11443733
306 Ga0207690_10221934
307 Ga0207690_10290769
308 Ga0207661_10073717
309 Ga0207667_10049347
310 Ga0207667_10112784
311 Ga0207667_10402720
312 Ga0207640_10222430
313 Ga0207703_10613918
314 Ga0207639_10023572
315 Ga0207678_10351507
316 Ga0207678_10584452
317 Ga0207702_10155632
318 Ga0207641_10474221
319 Ga0207674_10021591
320 Ga0207683_10178374
321 Ga0207698_10235620
322 Ga0268266_10030889
323 Ga0265334_10001625
324 Ga0265338_10040560
325 Ga0265338_10506583
326 Ga0307405_10026391
327 Ga0307410_10441126
328 Ga0307410_10517530
329 Ga0307410_11224796
330 Ga0307406_10185848
331 Ga0307406_10506277
332 Ga0307406_11048209
333 Ga0307407_10188238
334 Ga0307412_10393108
335 Ga0307409_100022327
336 Ga0307409_100023243
337 Ga0307409_100375652
338 Ga0307409_100495735
339 Ga0307409_100654008
340 Ga0307409_101017790
341 Ga0307416_100023921
342 Ga0307416_100208552
343 Ga0307416_100213525
344 Ga0307416_100408553
345 Ga0307416_101148805
346 Ga0307416_101251589
347 Ga0307414_10052244
348 Ga0307414_10614727
349 Ga0307411_10366069
350 Ga0307415_100026892
351 Ga0307415_100598050
352 Ga0373927_0000924
353 Ga0373933_0030888
354 Ga0373937_0239069
355 Ga0373925_0459547
356 Ga0395905_0048486
357 Ga0436364_0031238
358 Ga0436364_0611162
359 Ga0466961_0360933
360 Ga0466964_0069675
361 Ga0466960_0463300
362 Ga0466967_0003480
363 Ga0466967_1185552
364 Ga0466967_1287510
365 Ga0495638_0005869
366 Ga0495653_0421927
367 Ga0495586_0062074
368 Ga0495658_0047109
369 Ga0495613_0125939
370 Ga0495649_0242031
371 Ga0495589_0252792
372 Ga0496100_0002057
373 Ga0496101_0045425
374 Ga0496102_0581113
375 Ga0496104_0002493
376 Ga0496105_0016194
377 Ga0496107_0034730
378 Ga0496112_1362593
379 Ga0496114_0004176
380 Ga0496115_0845026
381 Ga0501031_0046362
382 Ga0501032_0008332
383 Ga0501033_0019750
384 Ga0501034_0009321
385 Ga0501036_0036559
386 Ga0501037_0002676
387 Ga0501038_0006637
388 Ga0501039_0005343
389 Ga0501043_0005234
390 Ga0501046_0001917
391 Ga0501047_0014166
392 Ga0501048_0021681
393 Ga0501070_0004616
394 Ga0501073_0067714
395 Ga0501073_0548106
396 Ga0501035_0028236
397 Ga0501044_0155357
398 Ga0501045_0015089
399 nmdc:mga00v17_624643_c1
400 nmdc:mga0yw44_124211_c1
401 nmdc:mga07m45_15143_c1
402 nmdc:mga0sz30_20918_c1
403 nmdc:mga0sz30_50390_c1
404 Ga0500556_0134088
405 Ga0500559_0242378
406 Ga0500616_0032288
407 Ga0500627_0420159
408 2515850861
409 2523386790
410 2739205092
411 2857713177
412 2928144490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01161

PBP

Phosphatidylethanolamine-binding protein

44

189

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4beg-assembly1.cif.gz_A structure of rv2140c, a phosphatidyl-ethanolamine binding protein from mycobacterium tuberculosis in complex with sulphate 0.9895 1 174
1fux-assembly1.cif.gz_B crystal structure of e.coli ybcl, a new member of the mammalian pebp family 0.9734 14 175
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.968 13 173
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.9671 13 173
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.9611 13 173
ID Description Score Start End Superfamily
4begB00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9919 1 174 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.979 13 175 3.90.280.10
4begB00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9694 1 174 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9673 13 175 3.90.280.10
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9627 15 170 3.90.280.10
ID Description Score Start End GO Terms
AF-A0A101B2H0-F1-model_v4 deleted 0.9996 2 174
AF-A0A7I7RRC2-F1-model_v4 Uncharacterized protein 0.9986 1 176
AF-A0A4Q3BVP3-F1-model_v4 deleted 0.9984 15 173
AF-A0A554V8K6-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9981 2 173
AF-S4ZF41-F1-model_v4 deleted 0.9977 27 175

Map