F315129

General Info

Members Datasets Scaffolds Average Seq Length
206 140 412 112

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10422574|Ga0157372_104225742
Length 135
Sequence LKGYDVIAKGLVHKIYHSNNHIRAVPITWSDFEKIDIRVGTIVQATVFPKAKKPAYQLTIDFGETIGIKKSSAQITAHYTPEQLTGQQVIAVINFPPKQIATFISECLVLGIYDEKEEVVLLQPQRPVTNGLKIG

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
105 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
108 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
109 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
110 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
111 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
112 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
124 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
125 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
126 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
127 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
128 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
129 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
132 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
133 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 2818991444 Filimonas endophytica 3197 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.43
Rhizosphere 89.81
Stem 0
Stem Tuber 0
Unclassified 19.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10422574 3300013307 Bacteria 1553
2 JGI24751J29686_10042517 3300002459 Bacteria 939
3 rootH1_10156458 3300003316 Bacteria 1557
4 Ga0070658_10060857 3300005327 Bacteria 3076
5 Ga0070658_10539252 3300005327 Bacteria 1009
6 Ga0070658_11402245 3300005327 Unclassified 606
7 Ga0070658_11644941 3300005327 Bacteria 556
8 Ga0070683_100651431 3300005329 Bacteria 1008
9 Ga0070683_101310743 3300005329 Unclassified 696
10 Ga0070683_101447860 3300005329 Bacteria 660
11 Ga0070670_100007311 3300005331 Bacteria 9368
12 Ga0070670_100118802 3300005331 Bacteria 2280
13 Ga0070682_100000107 3300005337 Bacteria 73993
14 Ga0068868_100223770 3300005338 Bacteria 1576
15 Ga0070660_100301644 3300005339 Bacteria 1313
16 Ga0070660_100512631 3300005339 Unclassified 998
17 Ga0070660_101517223 3300005339 Unclassified 570
18 Ga0070661_100286204 3300005344 Bacteria 1280
19 Ga0070668_100030165 3300005347 Bacteria 4123
20 Ga0070675_100187570 3300005354 Bacteria 1790
21 Ga0070675_100932441 3300005354 Bacteria 796
22 Ga0070671_100020468 3300005355 Bacteria 5396
23 Ga0070673_100525697 3300005364 Bacteria 1073
24 Ga0070673_100659628 3300005364 Bacteria 958
25 Ga0070659_100043626 3300005366 Bacteria 3507
26 Ga0070659_100256819 3300005366 Bacteria 1449
27 Ga0070659_100592680 3300005366 Bacteria 952
28 Ga0070667_100034712 3300005367 Unclassified 4222
29 Ga0070713_100211466 3300005436 Bacteria 1756
30 Ga0070678_100495321 3300005456 Bacteria 1077
31 Ga0068867_100233402 3300005459 Unclassified 1488
32 Ga0070685_10590089 3300005466 Unclassified 798
33 Ga0070679_101800378 3300005530 Bacteria 561
34 Ga0068853_100087623 3300005539 Bacteria 2732
35 Ga0070672_100265609 3300005543 Bacteria 1448
36 Ga0070686_100216901 3300005544 Bacteria 1381
37 Ga0070664_100002220 3300005564 Bacteria 15607
38 Ga0070664_100611865 3300005564 Bacteria 1011
39 Ga0068857_100679431 3300005577 Bacteria 977
40 Ga0068857_102481614 3300005577 Bacteria 509
41 Ga0068854_100282616 3300005578 Bacteria 1337
42 Ga0068854_101079591 3300005578 Unclassified 714
43 Ga0068852_100003759 3300005616 Bacteria 10643
44 Ga0068852_100013106 3300005616 Bacteria 6332
45 Ga0068859_100000757 3300005617 Bacteria 32578
46 Ga0068859_101265038 3300005617 Bacteria 813
47 Ga0068866_10507185 3300005718 Bacteria 799
48 Ga0068851_10145795 3300005834 Unclassified 1291
49 Ga0068863_100077886 3300005841 Unclassified 3138
50 Ga0097621_100001025 3300006237 Bacteria 19666
51 Ga0097621_100350948 3300006237 Unclassified 1312
52 Ga0068871_100000029 3300006358 Bacteria 77924
53 Ga0075431_100006879 3300006847 Bacteria 11300
54 Ga0075433_10014951 3300006852 Bacteria 6353
55 Ga0075434_100004669 3300006871 Bacteria 12383
56 Ga0097620_100000757 3300006931 Bacteria 32578
57 Ga0097620_101264976 3300006931 Bacteria 813
58 Ga0105247_11778244 3300009101 Bacteria 512
59 Ga0114129_10004118 3300009147 Bacteria 20546
60 Ga0105242_10092361 3300009176 Unclassified 2550
61 Ga0105242_13312877 3300009176 Bacteria 501
62 Ga0105237_10143254 3300009545 Unclassified 2384
63 Ga0105238_12894288 3300009551 Bacteria 516
64 Ga0105249_10004964 3300009553 Bacteria 11473
65 Ga0157371_10059145 3300013102 Bacteria 2717
66 Ga0157371_10095947 3300013102 Unclassified 2101
67 Ga0157371_10689172 3300013102 Bacteria 764
68 Ga0157369_10034744 3300013105 Bacteria 5529
69 Ga0157369_11775301 3300013105 Bacteria 627
70 Ga0157374_10311027 3300013296 Bacteria 1560
71 Ga0157374_12150956 3300013296 Bacteria 585
72 Ga0157378_10030862 3300013297 Unclassified 4732
73 Ga0163162_10000195 3300013306 Bacteria 55910
74 Ga0163162_10014322 3300013306 Bacteria 7747
75 Ga0157372_10031295 3300013307 Bacteria 5826
76 Ga0157372_10124585 3300013307 Unclassified 2962
77 Ga0157372_10204580 3300013307 Bacteria 2287
78 Ga0157372_10366200 3300013307 Unclassified 1680
79 Ga0157372_10393178 3300013307 Bacteria 1616
80 Ga0157372_10597904 3300013307 Bacteria 1286
81 Ga0157372_10817833 3300013307 Bacteria 1082
82 Ga0157372_11137392 3300013307 Bacteria 903
83 Ga0157372_11173988 3300013307 Bacteria 887
84 Ga0157372_11449936 3300013307 Unclassified 791
85 Ga0157372_11647580 3300013307 Bacteria 738
86 Ga0157372_12749149 3300013307 Unclassified 564
87 Ga0157372_13467343 3300013307 Bacteria 501
88 Ga0157375_10003192 3300013308 Bacteria 14233
89 Ga0163163_10008447 3300014325 Bacteria 9150
90 Ga0157377_10045504 3300014745 Bacteria 2452
91 Ga0157379_10022356 3300014968 Bacteria 5602
92 Ga0157379_10046647 3300014968 Unclassified 3866
93 Ga0157376_10002542 3300014969 Bacteria 12367
94 Ga0157376_10974776 3300014969 Bacteria 869
95 Ga0182007_10164000 3300015262 Unclassified 761
96 Ga0163161_10001632 3300017792 Bacteria 16487
97 Ga0163161_10049584 3300017792 Bacteria 3035
98 Ga0163161_11602851 3300017792 Unclassified 574
99 Ga0213876_10006254 3300021384 Bacteria 6494
100 Ga0213876_10100555 3300021384 Bacteria 1532
101 Ga0213876_10101363 3300021384 Bacteria 1526
102 Ga0213876_10330756 3300021384 Bacteria 810
103 Ga0213875_10004605 3300021388 Bacteria 7520
104 Ga0207656_10287925 3300025321 Unclassified 811
105 Ga0207682_10153082 3300025893 Bacteria 1041
106 Ga0207642_10441284 3300025899 Bacteria 787
107 Ga0207647_10000334 3300025904 Bacteria 38696
108 Ga0207671_10116639 3300025914 Unclassified 2037
109 Ga0207660_10178105 3300025917 Bacteria 1650
110 Ga0207657_10491943 3300025919 Unclassified 961
111 Ga0207649_10235630 3300025920 Bacteria 1311
112 Ga0207652_10391818 3300025921 Bacteria 1253
113 Ga0207652_11292768 3300025921 Bacteria 632
114 Ga0207650_10001994 3300025925 Bacteria 14309
115 Ga0207650_10862377 3300025925 Bacteria 768
116 Ga0207650_11333103 3300025925 Bacteria 611
117 Ga0207659_10391585 3300025926 Bacteria 1160
118 Ga0207700_10602784 3300025928 Bacteria 977
119 Ga0207644_10025847 3300025931 Bacteria 4040
120 Ga0207644_10179036 3300025931 Bacteria 1660
121 Ga0207690_10024001 3300025932 Bacteria 3814
122 Ga0207686_10351443 3300025934 Bacteria 1110
123 Ga0207691_10344759 3300025940 Bacteria 1275
124 Ga0207661_10011767 3300025944 Bacteria 6353
125 Ga0207661_11262390 3300025944 Bacteria 679
126 Ga0207679_10007190 3300025945 Bacteria 7053
127 Ga0207679_10166275 3300025945 Bacteria 1811
128 Ga0207679_10693729 3300025945 Bacteria 923
129 Ga0207651_10372671 3300025960 Bacteria 1208
130 Ga0207712_10145056 3300025961 Bacteria 1826
131 Ga0207640_10481065 3300025981 Bacteria 1030
132 Ga0207658_10095606 3300025986 Unclassified 2315
133 Ga0207677_10127969 3300026023 Bacteria 1923
134 Ga0207639_10148366 3300026041 Bacteria 1962
135 Ga0207641_10106239 3300026088 Unclassified 2481
136 Ga0207641_10237345 3300026088 Bacteria 1697
137 Ga0207648_10271581 3300026089 Bacteria 1515
138 Ga0207683_10080315 3300026121 Unclassified 2893
139 Ga0207698_10043343 3300026142 Bacteria 3370
140 Ga0207698_11217483 3300026142 Bacteria 767
141 Ga0207698_11542099 3300026142 Bacteria 680
142 Ga0209969_1038183 3300027360 Bacteria 743
143 Ga0209982_1060181 3300027552 Unclassified 618
144 Ga0209983_1053678 3300027665 Bacteria 884
145 Ga0209971_1078205 3300027682 Bacteria 805
146 Ga0265338_10229672 3300028800 Unclassified 1381
147 Ga0265327_10000743 3300031251 Bacteria 50644
148 Ga0307405_10461470 3300031731 Bacteria 1010
149 Ga0395899_0310043 3300037312 Bacteria 1066
150 Ga0395900_0311797 3300037418 Bacteria 1556
151 Ga0395898_0955917 3300037466 Bacteria 794
152 Ga0395905_0000527 3300037471 Bacteria 52435
153 Ga0395905_0283166 3300037471 Bacteria 1544
154 Ga0395905_0323887 3300037471 Bacteria 1431
155 Ga0395905_0623055 3300037471 Bacteria 981
156 Ga0395905_0968562 3300037471 Unclassified 754
157 Ga0436364_0025013 3300037853 Bacteria 12292
158 Ga0436364_0300709 3300037853 Bacteria 798
159 Ga0436365_0508219 3300039437 Bacteria 27053
160 Ga0436365_0825939 3300039437 Bacteria 1440
161 Ga0436365_1244276 3300039437 Bacteria 1311
162 Ga0436363_0063461 3300039450 Bacteria 1954
163 Ga0436362_0269239 3300039453 Unclassified 543
164 Ga0436362_1298899 3300039453 Bacteria 3713
165 Ga0451802_2102074 3300041460 Bacteria 670
166 Ga0451853_3486725 3300041512 Unclassified 681
167 Ga0450922_007442 3300042124 Bacteria 1028
168 Ga0450894_013411 3300042131 Unclassified 1076
169 Ga0439434_0086619 3300042435 Bacteria 999
170 Ga0451577_0218146 3300042876 Bacteria 1724
171 Ga0453683_0202159 3300044673 Unclassified 1261
172 Ga0453684_0029389 3300044712 Bacteria 7805
173 Ga0453684_0029538 3300044712 Bacteria 7780
174 Ga0453684_1774604 3300044712 Unclassified 628
175 Ga0466959_0196957 3300045049 Unclassified 1404
176 Ga0451576_0391866 3300045051 Unclassified 1456
177 Ga0495686_0229581 3300047472 Bacteria 1051
178 Ga0496100_0154242 3300048903 Bacteria 1641
179 Ga0496101_0131060 3300048904 Bacteria 1904
180 Ga0496109_1587530 3300048912 Unclassified 589
181 Ga0496114_0237987 3300048917 Bacteria 1600
182 Ga0496123_0425422 3300048926 Bacteria 598
183 Ga0496124_0080021 3300048927 Bacteria 2690
184 Ga0501034_0352680 3300049571 Bacteria 1399
185 Ga0501043_0378433 3300049579 Bacteria 1072
186 Ga0501070_0038295 3300049586 Bacteria 4001
187 Ga0501073_0023204 3300049589 Bacteria 4458
188 Ga0501073_0051426 3300049589 Bacteria 2886
189 Ga0501201_036071 3300049651 Bacteria 580
190 Ga0501249_035998 3300049679 Bacteria 1114
191 Ga0501251_010570 3300049681 Bacteria 1085
192 Ga0501256_053097 3300049685 Bacteria 503
193 Ga0501259_002227 3300049688 Bacteria 3183
194 Ga0501261_099871 3300049690 Bacteria 550
195 Ga0501234_011932 3300049707 Bacteria 1360
196 Ga0501083_0071921 3300049744 Bacteria 2299
197 Ga0501232_002726 3300049757 Bacteria 1555
198 Ga0501263_023431 3300049760 Bacteria 841
199 Ga0501266_002982 3300049763 Unclassified 2108
200 Ga0501035_0076901 3300049822 Bacteria 2951
201 Ga0501212_005285 3300049851 Bacteria 1699
202 nmdc:mga05p37_21393_c1 3300050507 Bacteria 7834
203 nmdc:mga06r32_34710_c1 3300050510 Bacteria 4757
204 nmdc:mga0n895_58652_c1 3300050512 Bacteria 3795
205 nmdc:mga0a205_71089_c1 3300050515 Unclassified 3361
206 2819588803 2818991444 Bacteria 6968812
207 Ga0157372_10422574
208 JGI24751J29686_10042517
209 rootH1_10156458
210 Ga0070658_10060857
211 Ga0070658_10539252
212 Ga0070658_11402245
213 Ga0070658_11644941
214 Ga0070683_100651431
215 Ga0070683_101310743
216 Ga0070683_101447860
217 Ga0070670_100007311
218 Ga0070670_100118802
219 Ga0070682_100000107
220 Ga0068868_100223770
221 Ga0070660_100301644
222 Ga0070660_100512631
223 Ga0070660_101517223
224 Ga0070661_100286204
225 Ga0070668_100030165
226 Ga0070675_100187570
227 Ga0070675_100932441
228 Ga0070671_100020468
229 Ga0070673_100525697
230 Ga0070673_100659628
231 Ga0070659_100043626
232 Ga0070659_100256819
233 Ga0070659_100592680
234 Ga0070667_100034712
235 Ga0070713_100211466
236 Ga0070678_100495321
237 Ga0068867_100233402
238 Ga0070685_10590089
239 Ga0070679_101800378
240 Ga0068853_100087623
241 Ga0070672_100265609
242 Ga0070686_100216901
243 Ga0070664_100002220
244 Ga0070664_100611865
245 Ga0068857_100679431
246 Ga0068857_102481614
247 Ga0068854_100282616
248 Ga0068854_101079591
249 Ga0068852_100003759
250 Ga0068852_100013106
251 Ga0068859_100000757
252 Ga0068859_101265038
253 Ga0068866_10507185
254 Ga0068851_10145795
255 Ga0068863_100077886
256 Ga0097621_100001025
257 Ga0097621_100350948
258 Ga0068871_100000029
259 Ga0075431_100006879
260 Ga0075433_10014951
261 Ga0075434_100004669
262 Ga0097620_100000757
263 Ga0097620_101264976
264 Ga0105247_11778244
265 Ga0114129_10004118
266 Ga0105242_10092361
267 Ga0105242_13312877
268 Ga0105237_10143254
269 Ga0105238_12894288
270 Ga0105249_10004964
271 Ga0157371_10059145
272 Ga0157371_10095947
273 Ga0157371_10689172
274 Ga0157369_10034744
275 Ga0157369_11775301
276 Ga0157374_10311027
277 Ga0157374_12150956
278 Ga0157378_10030862
279 Ga0163162_10000195
280 Ga0163162_10014322
281 Ga0157372_10031295
282 Ga0157372_10124585
283 Ga0157372_10204580
284 Ga0157372_10366200
285 Ga0157372_10393178
286 Ga0157372_10597904
287 Ga0157372_10817833
288 Ga0157372_11137392
289 Ga0157372_11173988
290 Ga0157372_11449936
291 Ga0157372_11647580
292 Ga0157372_12749149
293 Ga0157372_13467343
294 Ga0157375_10003192
295 Ga0163163_10008447
296 Ga0157377_10045504
297 Ga0157379_10022356
298 Ga0157379_10046647
299 Ga0157376_10002542
300 Ga0157376_10974776
301 Ga0182007_10164000
302 Ga0163161_10001632
303 Ga0163161_10049584
304 Ga0163161_11602851
305 Ga0213876_10006254
306 Ga0213876_10100555
307 Ga0213876_10101363
308 Ga0213876_10330756
309 Ga0213875_10004605
310 Ga0207656_10287925
311 Ga0207682_10153082
312 Ga0207642_10441284
313 Ga0207647_10000334
314 Ga0207671_10116639
315 Ga0207660_10178105
316 Ga0207657_10491943
317 Ga0207649_10235630
318 Ga0207652_10391818
319 Ga0207652_11292768
320 Ga0207650_10001994
321 Ga0207650_10862377
322 Ga0207650_11333103
323 Ga0207659_10391585
324 Ga0207700_10602784
325 Ga0207644_10025847
326 Ga0207644_10179036
327 Ga0207690_10024001
328 Ga0207686_10351443
329 Ga0207691_10344759
330 Ga0207661_10011767
331 Ga0207661_11262390
332 Ga0207679_10007190
333 Ga0207679_10166275
334 Ga0207679_10693729
335 Ga0207651_10372671
336 Ga0207712_10145056
337 Ga0207640_10481065
338 Ga0207658_10095606
339 Ga0207677_10127969
340 Ga0207639_10148366
341 Ga0207641_10106239
342 Ga0207641_10237345
343 Ga0207648_10271581
344 Ga0207683_10080315
345 Ga0207698_10043343
346 Ga0207698_11217483
347 Ga0207698_11542099
348 Ga0209969_1038183
349 Ga0209982_1060181
350 Ga0209983_1053678
351 Ga0209971_1078205
352 Ga0265338_10229672
353 Ga0265327_10000743
354 Ga0307405_10461470
355 Ga0395899_0310043
356 Ga0395900_0311797
357 Ga0395898_0955917
358 Ga0395905_0000527
359 Ga0395905_0283166
360 Ga0395905_0323887
361 Ga0395905_0623055
362 Ga0395905_0968562
363 Ga0436364_0025013
364 Ga0436364_0300709
365 Ga0436365_0508219
366 Ga0436365_0825939
367 Ga0436365_1244276
368 Ga0436363_0063461
369 Ga0436362_0269239
370 Ga0436362_1298899
371 Ga0451802_2102074
372 Ga0451853_3486725
373 Ga0450922_007442
374 Ga0450894_013411
375 Ga0439434_0086619
376 Ga0451577_0218146
377 Ga0453683_0202159
378 Ga0453684_0029389
379 Ga0453684_0029538
380 Ga0453684_1774604
381 Ga0466959_0196957
382 Ga0451576_0391866
383 Ga0495686_0229581
384 Ga0496100_0154242
385 Ga0496101_0131060
386 Ga0496109_1587530
387 Ga0496114_0237987
388 Ga0496123_0425422
389 Ga0496124_0080021
390 Ga0501034_0352680
391 Ga0501043_0378433
392 Ga0501070_0038295
393 Ga0501073_0023204
394 Ga0501073_0051426
395 Ga0501201_036071
396 Ga0501249_035998
397 Ga0501251_010570
398 Ga0501256_053097
399 Ga0501259_002227
400 Ga0501261_099871
401 Ga0501234_011932
402 Ga0501083_0071921
403 Ga0501232_002726
404 Ga0501263_023431
405 Ga0501266_002982
406 Ga0501035_0076901
407 Ga0501212_005285
408 nmdc:mga05p37_21393_c1
409 nmdc:mga06r32_34710_c1
410 nmdc:mga0n895_58652_c1
411 nmdc:mga0a205_71089_c1
412 2819588803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01588

tRNA_bind

Putative tRNA binding domain

37

133

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q2i-assembly1.cif.gz_A crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.9744 1 111
1gd7-assembly1.cif.gz_B crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities. 0.974 3 111
2q2h-assembly1.cif.gz_A crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens with a genetically fused phage-display derived peptide substrate at the n-terminus. 0.9688 1 111
2q2i-assembly1.cif.gz_A crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.9659 1 111
1gd7-assembly1.cif.gz_B crystal structure of a bifunctional protein (csaa) with export-related chaperone and trna-binding activities. 0.9653 3 111
ID Description Score Start End Superfamily
af_Q54B13_2_117_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9763 3 111 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9725 3 111 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9639 3 111 2.40.50.140
2q2iB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9573 1 111 2.40.50.140
af_Q54B13_2_117_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9505 3 111 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A538R6C9-F1-model_v4 tRNA-binding protein 1 15 111 GO:0000049
AF-A0A7Y3RYP3-F1-model_v4 deleted 0.9962 17 111
AF-A0A356U280-F1-model_v4 tRNA-binding protein 0.9956 17 111 GO:0000049
AF-A0A4Q3C3U4-F1-model_v4 tRNA-binding protein 0.9946 19 110 GO:0000049
AF-A0A356R983-F1-model_v4 tRNA-binding protein 0.9935 12 110 GO:0000049

Map