F314941

General Info

Members Datasets Scaffolds Average Seq Length
206 140 206 216

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10132697|Ga0075364_101326972
Length 227
Sequence MTSDLKDLKKMRYSICISGAAAGQTVVDSRDKAIVLGEAIARTGHILTTGATVGLPYFSAYGAKKAGGTSIGFSPASSLRSHVRKYRLPHDVFDFINFTGMDYVGRDLYLVQSSDAVITVGGRFGSLHEFTSALEARKPCGVLLGSGGTADLIPQLMKTLSPPAGDIVIYDDDPERLVKRMVEILDDKYEDIRTQLERDEHWYLKEGLADPSLADPDATSRVSNRRG

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
49 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
79 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
80 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
83 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
92 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
93 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
99 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
100 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
113 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
120 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
121 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
122 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
123 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
126 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
127 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
128 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
129 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
130 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
131 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
132 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
133 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
134 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
135 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
136 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
139 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
140 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 31.55
Nodule 0
Rhizoplane 0
Rhizosphere 65.05
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1019229 3300001904 Unclassified 1079
2 JGI24741J21665_1000781 3300001915 Bacteria 9552
3 JGI24740J21852_10023517 3300001979 Bacteria 2103
4 JGI24737J22298_10000095 3300001990 Bacteria 26030
5 JGI24735J21928_10042103 3300002067 Unclassified 1330
6 JGI24742J22300_10000006 3300002244 Bacteria 41202
7 rootH2_10000244 3300003320 Bacteria 697651
8 rootH2_10089542 3300003320 Bacteria 3425
9 rootH2_10107295 3300003320 Unclassified 2367
10 rootL2_10109217 3300003322 Unclassified 2200
11 rootH1_10015736 3300003323 Bacteria 4219
12 rootH1_10219291 3300003323 Unclassified 1489
13 Ga0065704_10109593 3300005289 Bacteria 2000
14 Ga0070658_10004138 3300005327 Bacteria 11879
15 Ga0070658_10006099 3300005327 Bacteria 9774
16 Ga0070683_100000140 3300005329 Bacteria 46747
17 Ga0070683_100000657 3300005329 Bacteria 25014
18 Ga0070683_100183332 3300005329 Bacteria 1987
19 Ga0070680_100007503 3300005336 Bacteria 8317
20 Ga0070660_100000454 3300005339 Bacteria 27343
21 Ga0070692_10091115 3300005345 Bacteria 1657
22 Ga0070659_100000558 3300005366 Bacteria 27295
23 Ga0070667_100000001 3300005367 Bacteria 1108638
24 Ga0070663_100668140 3300005455 Bacteria 880
25 Ga0070678_100340006 3300005456 Bacteria 1287
26 Ga0068867_100314422 3300005459 Bacteria 1295
27 Ga0070679_100041151 3300005530 Bacteria 4600
28 Ga0070684_100001211 3300005535 Bacteria 18536
29 Ga0070684_100004041 3300005535 Bacteria 11104
30 Ga0070684_100018888 3300005535 Bacteria 5691
31 Ga0070684_100117569 3300005535 Bacteria 2389
32 Ga0068855_100000003 3300005563 Bacteria 589862
33 Ga0068855_100000211 3300005563 Bacteria 74558
34 Ga0068855_100093694 3300005563 Bacteria 3463
35 Ga0068855_100126687 3300005563 Bacteria 2919
36 Ga0068855_100814850 3300005563 Bacteria 991
37 Ga0068857_100000002 3300005577 Bacteria 241401
38 Ga0068857_100171667 3300005577 Bacteria 1971
39 Ga0068857_100917569 3300005577 Bacteria 840
40 Ga0068856_100000866 3300005614 Bacteria 32413
41 Ga0068852_100464400 3300005616 Bacteria 1255
42 Ga0068860_100025027 3300005843 Bacteria 5762
43 Ga0081539_10074073 3300005985 Unclassified 1814
44 Ga0070717_10299295 3300006028 Unclassified 1430
45 Ga0070717_10501526 3300006028 Unclassified 1097
46 Ga0075365_10000020 3300006038 Bacteria 64494
47 Ga0075368_10006658 3300006042 Bacteria 4051
48 Ga0075363_100000016 3300006048 Bacteria 38279
49 Ga0075364_10001546 3300006051 Bacteria 12566
50 Ga0075364_10001845 3300006051 Bacteria 11739
51 Ga0075364_10025265 3300006051 Bacteria 3780
52 Ga0075364_10032724 3300006051 Bacteria 3344
53 Ga0075364_10132697 3300006051 Bacteria 1672
54 Ga0075364_10194566 3300006051 Archaea 1374
55 Ga0075364_10212757 3300006051 Unclassified 1311
56 Ga0075364_10467594 3300006051 Unclassified 862
57 Ga0075362_10000073 3300006177 Bacteria 27914
58 Ga0075367_10000034 3300006178 Bacteria 29945
59 Ga0075367_10003897 3300006178 Bacteria 7196
60 Ga0075369_10000005 3300006186 Bacteria 147699
61 Ga0075369_10000051 3300006186 Bacteria 29832
62 Ga0075369_10110927 3300006186 Bacteria 1236
63 Ga0075366_10000001 3300006195 Bacteria 569172
64 Ga0075366_10000044 3300006195 Bacteria 45021
65 Ga0075366_10000083 3300006195 Bacteria 37001
66 Ga0075366_10000684 3300006195 Bacteria 16042
67 Ga0075366_10059650 3300006195 Bacteria 2266
68 Ga0097621_100003413 3300006237 Bacteria 10943
69 Ga0075370_10020582 3300006353 Bacteria 3609
70 Ga0068871_100000156 3300006358 Bacteria 45103
71 Ga0105240_10294250 3300009093 Bacteria 1860
72 Ga0111539_10013550 3300009094 Bacteria 10192
73 Ga0105245_10000002 3300009098 Bacteria 634374
74 Ga0105245_10672329 3300009098 Unclassified 1067
75 Ga0105243_10015378 3300009148 Bacteria 5787
76 Ga0105241_10000003 3300009174 Bacteria 839043
77 Ga0105248_11040035 3300009177 Unclassified 925
78 Ga0105249_10003576 3300009553 Bacteria 13450
79 Ga0105030_103307 3300009987 Unclassified 1392
80 Ga0105028_100187 3300009993 Bacteria 6678
81 Ga0157373_10000042 3300013100 Bacteria 113564
82 Ga0157371_10000937 3300013102 Bacteria 32624
83 Ga0157370_10029349 3300013104 Bacteria 5399
84 Ga0157370_10115012 3300013104 Bacteria 2513
85 Ga0157369_10000261 3300013105 Bacteria 71207
86 Ga0157374_10000031 3300013296 Bacteria 204840
87 Ga0157374_10089394 3300013296 Bacteria 2934
88 Ga0157374_10823501 3300013296 Unclassified 944
89 Ga0157377_10080312 3300014745 Bacteria 1905
90 Ga0157377_10193639 3300014745 Bacteria 1286
91 Ga0157377_10465983 3300014745 Bacteria 876
92 Ga0207647_10000458 3300025904 Bacteria 33136
93 Ga0207705_10001105 3300025909 Bacteria 21924
94 Ga0207705_10070393 3300025909 Bacteria 2535
95 Ga0207654_10000002 3300025911 Bacteria 1460142
96 Ga0207695_10209809 3300025913 Bacteria 1859
97 Ga0207660_10031569 3300025917 Bacteria 3650
98 Ga0207657_10001246 3300025919 Bacteria 27202
99 Ga0207652_10019309 3300025921 Bacteria 5604
100 Ga0207652_10117112 3300025921 Bacteria 2367
101 Ga0207694_10173984 3300025924 Bacteria 1744
102 Ga0207687_10000001 3300025927 Bacteria 1130810
103 Ga0207690_10002364 3300025932 Bacteria 11445
104 Ga0207709_10098338 3300025935 Bacteria 1929
105 Ga0207661_10000021 3300025944 Bacteria 205381
106 Ga0207661_10012888 3300025944 Bacteria 6096
107 Ga0207661_10153026 3300025944 Bacteria 1995
108 Ga0207667_10000008 3300025949 Bacteria 625138
109 Ga0207667_10000466 3300025949 Bacteria 54272
110 Ga0207667_10191363 3300025949 Bacteria 2099
111 Ga0207712_10002267 3300025961 Bacteria 12484
112 Ga0207668_10471455 3300025972 Unclassified 1075
113 Ga0207658_10000003 3300025986 Bacteria 1151934
114 Ga0207678_11022172 3300026067 Bacteria 732
115 Ga0207702_10001222 3300026078 Bacteria 25994
116 Ga0207648_10332566 3300026089 Bacteria 1367
117 Ga0207674_10000001 3300026116 Bacteria 616581
118 Ga0207674_10096983 3300026116 Bacteria 2933
119 Ga0207674_10185553 3300026116 Bacteria 2030
120 Ga0207674_10724855 3300026116 Bacteria 960
121 Ga0207675_100260392 3300026118 Bacteria 1681
122 Ga0207698_10432522 3300026142 Bacteria 1266
123 Ga0209813_10000004 3300027866 Bacteria 139340
124 Ga0207428_10015820 3300027907 Bacteria 6511
125 Ga0268265_10155749 3300028380 Bacteria 1933
126 Ga0268264_10057382 3300028381 Bacteria 3257
127 Ga0265338_10014462 3300028800 Bacteria 8784
128 Ga0265327_10000017 3300031251 Bacteria 445264
129 Ga0265327_10000961 3300031251 Bacteria 41308
130 Ga0373927_0500409 3300035695 Unclassified 803
131 Ga0395899_0004607 3300037312 Bacteria 10743
132 Ga0395900_0055305 3300037418 Bacteria 4087
133 Ga0395898_0043702 3300037466 Bacteria 4414
134 Ga0395905_0027294 3300037471 Bacteria 5384
135 Ga0395901_0014544 3300038443 Bacteria 8000
136 Ga0495629_0111267 3300046459 Unclassified 1909
137 Ga0495622_0000082 3300046557 Bacteria 85266
138 Ga0495588_0000116 3300046674 Bacteria 135919
139 Ga0495647_0156052 3300046681 Unclassified 981
140 Ga0495658_0010755 3300046683 Bacteria 4583
141 Ga0495649_0000284 3300046694 Bacteria 44736
142 Ga0495600_0016560 3300046809 Bacteria 4681
143 Ga0495672_0000129 3300047320 Bacteria 112879
144 Ga0495593_0037394 3300047673 Unclassified 2626
145 Ga0496126_0336623 3300048929 Bacteria 1237
146 Ga0501031_0000163 3300049568 Bacteria 38332
147 Ga0501032_0025266 3300049569 Bacteria 4096
148 Ga0501034_0060274 3300049571 Bacteria 3812
149 Ga0501034_0390869 3300049571 Bacteria 1315
150 Ga0501036_0004824 3300049572 Bacteria 10897
151 Ga0501037_0000121 3300049573 Bacteria 72862
152 Ga0501038_0005584 3300049574 Bacteria 11670
153 Ga0501042_0187113 3300049578 Bacteria 1494
154 Ga0501043_0002322 3300049579 Bacteria 16107
155 Ga0501046_0000138 3300049580 Bacteria 77052
156 Ga0501046_0226708 3300049580 Unclassified 1382
157 Ga0501047_0000681 3300049581 Bacteria 35407
158 Ga0501048_0000361 3300049582 Bacteria 31413
159 Ga0501070_0012332 3300049586 Bacteria 7211
160 Ga0501073_0022103 3300049589 Bacteria 4584
161 Ga0501074_0804095 3300049590 Bacteria 662
162 Ga0501035_0000801 3300049822 Bacteria 33495
163 Ga0501044_0008015 3300049823 Bacteria 11607
164 nmdc:mga03683_1412_c1 3300050489 Bacteria 7162
165 nmdc:mga03683_20_c3 3300050489 Bacteria 29488
166 nmdc:mga03n38_22_c1 3300050490 Bacteria 38225
167 nmdc:mga00v17_120353_c1 3300050491 Bacteria 1671
168 nmdc:mga00v17_140683_c1 3300050491 Bacteria 1547
169 nmdc:mga00v17_17254_c1 3300050491 Bacteria 2998
170 nmdc:mga00v17_177814_c1 3300050491 Archaea 1373
171 nmdc:mga00v17_189073_c1 3300050491 Bacteria 1329
172 nmdc:mga00v17_2773_c1 3300050491 Bacteria 2510
173 nmdc:mga00v17_894_c1 3300050491 Bacteria 16126
174 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
175 nmdc:mga0k408_114_c1 3300050493 Bacteria 39328
176 nmdc:mga0k408_12963_c1 3300050493 Bacteria 4564
177 nmdc:mga0k408_17_c2 3300050493 Bacteria 97852
178 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
179 nmdc:mga0k408_337_c1 3300050493 Bacteria 25651
180 nmdc:mga0k408_51728_c1 3300050493 Bacteria 2029
181 nmdc:mga06z11_44_c1 3300050494 Bacteria 47967
182 nmdc:mga06z11_6_c1 3300050494 Bacteria 124054
183 nmdc:mga04h51_4_c1 3300050495 Bacteria 139342
184 nmdc:mga07m45_3390_c1 3300050496 Bacteria 6453
185 nmdc:mga08y16_23051_c1 3300050511 Bacteria 6573
186 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
187 nmdc:mga0sz30_23_c1 3300050516 Bacteria 65683
188 nmdc:mga0sz30_98106_c1 3300050516 Bacteria 1278
189 Ga0500643_000010 3300053087 Bacteria 408084
190 Ga0500643_000038 3300053087 Bacteria 178974
191 Ga0500644_0000555 3300053088 Bacteria 14996
192 Ga0500583_0000137 3300053092 Bacteria 31497
193 Ga0500583_0168173 3300053092 Bacteria 1091
194 Ga0500651_0393360 3300053093 Bacteria 780
195 Ga0500566_0000001 3300053094 Bacteria 1101031
196 Ga0500555_000001 3300053103 Bacteria 1353713
197 Ga0500562_000002 3300053108 Bacteria 977234
198 Ga0500614_000001 3300053123 Bacteria 1274484
199 Ga0500614_002680 3300053123 Bacteria 3934
200 Ga0500561_0000001 3300053137 Bacteria 957685
201 Ga0500577_0007980 3300053142 Bacteria 2995
202 Ga0500589_000016 3300053147 Bacteria 107090
203 Ga0500616_0232489 3300053153 Bacteria 797
204 Ga0500649_000013 3300053722 Bacteria 73694
205 Ga0500611_000287 3300053727 Bacteria 5361
206 Ga0587094_038592 3300059513 Bacteria 769

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035695 Ga0373927_0500409 Ga0373927_0500409_90_674 193
2 3300053093 Ga0500651_0393360 Ga0500651_0393360_14_598 194
3 3300005455 Ga0070663_100668140 Ga0070663_1006681401 196
4 3300009148 Ga0105243_10015378 Ga0105243_100153783 196
5 3300013102 Ga0157371_10000937 Ga0157371_1000093720 196
6 3300025935 Ga0207709_10098338 Ga0207709_100983382 196
7 3300026067 Ga0207678_11022172 Ga0207678_110221721 196
8 3300031251 Ga0265327_10000961 Ga0265327_1000096128 200
9 3300009098 Ga0105245_10672329 Ga0105245_106723292 201
10 3300049590 Ga0501074_0804095 Ga0501074_0804095_27_632 201
11 3300053092 Ga0500583_0000137 Ga0500583_0000137_14694_15347 204
12 3300053147 Ga0500589_000016 Ga0500589_000016_32731_33384 204
13 3300005329 Ga0070683_100000657 Ga0070683_10000065720 207
14 3300005535 Ga0070684_100004041 Ga0070684_1000040417 207
15 3300025972 Ga0207668_10471455 Ga0207668_104714552 208
16 3300028380 Ga0268265_10155749 Ga0268265_101557492 208
17 3300028800 Ga0265338_10014462 Ga0265338_100144628 209
18 3300053153 Ga0500616_0232489 Ga0500616_0232489_123_755 209
19 3300037312 Ga0395899_0004607 Ga0395899_0004607_3065_3700 210
20 3300037466 Ga0395898_0043702 Ga0395898_0043702_1877_2512 210
21 3300037471 Ga0395905_0027294 Ga0395905_0027294_2000_2635 210
22 3300038443 Ga0395901_0014544 Ga0395901_0014544_7116_7751 210
23 3300005327 Ga0070658_10006099 Ga0070658_1000609911 211
24 3300005339 Ga0070660_100000454 Ga0070660_1000004548 211
25 3300005345 Ga0070692_10091115 Ga0070692_100911152 211
26 3300005366 Ga0070659_100000558 Ga0070659_10000055828 211
27 3300005530 Ga0070679_100041151 Ga0070679_1000411511 211
28 3300005563 Ga0068855_100000211 Ga0068855_10000021125 211
29 3300005577 Ga0068857_100000002 Ga0068857_10000000253 211
30 3300025909 Ga0207705_10001105 Ga0207705_1000110520 211
31 3300025919 Ga0207657_10001246 Ga0207657_100012469 211
32 3300025921 Ga0207652_10019309 Ga0207652_100193091 211
33 3300025924 Ga0207694_10173984 Ga0207694_101739842 211
34 3300025932 Ga0207690_10002364 Ga0207690_100023642 211
35 3300025949 Ga0207667_10000466 Ga0207667_1000046644 211
36 3300026116 Ga0207674_10000001 Ga0207674_10000001476 211
37 3300049571 Ga0501034_0390869 Ga0501034_0390869_547_1203 211
38 3300013104 Ga0157370_10029349 Ga0157370_100293494 212
39 3300005336 Ga0070680_100007503 Ga0070680_1000075037 213
40 3300005563 Ga0068855_100126687 Ga0068855_1001266873 213
41 3300025917 Ga0207660_10031569 Ga0207660_100315692 213
42 3300025921 Ga0207652_10117112 Ga0207652_101171122 213
43 3300047320 Ga0495672_0000129 Ga0495672_0000129_45226_45897 213
44 3300059513 Ga0587094_038592 Ga0587094_038592_54_701 213
45 3300005367 Ga0070667_100000001 Ga0070667_100000001729 214
46 3300005843 Ga0068860_100025027 Ga0068860_1000250274 214
47 3300005985 Ga0081539_10074073 Ga0081539_100740731 214
48 3300025986 Ga0207658_10000003 Ga0207658_10000003651 214
49 3300026118 Ga0207675_100260392 Ga0207675_1002603922 214
50 3300028381 Ga0268264_10057382 Ga0268264_100573823 214
51 3300031251 Ga0265327_10000017 Ga0265327_10000017117 214
52 3300009094 Ga0111539_10013550 Ga0111539_100135507 215
53 3300027907 Ga0207428_10015820 Ga0207428_100158203 215
54 3300050511 nmdc:mga08y16_23051_c1 nmdc:mga08y16_23051_c1_2014_2661 215
55 3300003320 rootH2_10089542 rootH2_100895423 216
56 3300003322 rootL2_10109217 rootL2_101092172 216
57 3300003323 rootH1_10015736 rootH1_100157365 216
58 3300005329 Ga0070683_100000140 Ga0070683_1000001408 216
59 3300005329 Ga0070683_100183332 Ga0070683_1001833322 216
60 3300005535 Ga0070684_100001211 Ga0070684_10000121114 216
61 3300005563 Ga0068855_100814850 Ga0068855_1008148502 216
62 3300006051 Ga0075364_10025265 Ga0075364_100252652 216
63 3300006051 Ga0075364_10467594 Ga0075364_104675942 216
64 3300006177 Ga0075362_10000073 Ga0075362_100000736 216
65 3300006186 Ga0075369_10000005 Ga0075369_1000000545 216
66 3300006186 Ga0075369_10000051 Ga0075369_1000005126 216
67 3300006195 Ga0075366_10000001 Ga0075366_10000001457 216
68 3300009553 Ga0105249_10003576 Ga0105249_100035767 216
69 3300009987 Ga0105030_103307 Ga0105030_1033072 216
70 3300014745 Ga0157377_10193639 Ga0157377_101936392 216
71 3300025944 Ga0207661_10000021 Ga0207661_1000002183 216
72 3300025944 Ga0207661_10153026 Ga0207661_101530262 216
73 3300025961 Ga0207712_10002267 Ga0207712_100022678 216
74 3300046459 Ga0495629_0111267 Ga0495629_0111267_693_1346 216
75 3300046557 Ga0495622_0000082 Ga0495622_0000082_39882_40535 216
76 3300046674 Ga0495588_0000116 Ga0495588_0000116_106965_107618 216
77 3300046681 Ga0495647_0156052 Ga0495647_0156052_230_883 216
78 3300046683 Ga0495658_0010755 Ga0495658_0010755_3025_3678 216
79 3300046809 Ga0495600_0016560 Ga0495600_0016560_1580_2233 216
80 3300047673 Ga0495593_0037394 Ga0495593_0037394_1322_1975 216
81 3300050489 nmdc:mga03683_20_c3 nmdc:mga03683_20_c3_6214_6867 216
82 3300050491 nmdc:mga00v17_17254_c1 nmdc:mga00v17_17254_c1_1564_2217 216
83 3300050491 nmdc:mga00v17_189073_c1 nmdc:mga00v17_189073_c1_139_792 216
84 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_654943_655596 216
85 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_190201_190854 216
86 3300050516 nmdc:mga0sz30_23_c1 nmdc:mga0sz30_23_c1_37734_38387 216
87 3300053087 Ga0500643_000038 Ga0500643_000038_61069_61725 216
88 3300053088 Ga0500644_0000555 Ga0500644_0000555_6909_7562 216
89 3300053092 Ga0500583_0168173 Ga0500583_0168173_401_1057 216
90 3300053094 Ga0500566_0000001 Ga0500566_0000001_605948_606601 216
91 3300053103 Ga0500555_000001 Ga0500555_000001_688443_689096 216
92 3300053123 Ga0500614_000001 Ga0500614_000001_305569_306222 216
93 3300053123 Ga0500614_002680 Ga0500614_002680_301_954 216
94 3300053142 Ga0500577_0007980 Ga0500577_0007980_1473_2126 216
95 3300053722 Ga0500649_000013 Ga0500649_000013_53575_54228 216
96 3300053727 Ga0500611_000287 Ga0500611_000287_349_1002 216
97 3300001904 JGI24736J21556_1019229 JGI24736J21556_10192292 217
98 3300001915 JGI24741J21665_1000781 JGI24741J21665_10007813 217
99 3300001979 JGI24740J21852_10023517 JGI24740J21852_100235172 217
100 3300001990 JGI24737J22298_10000095 JGI24737J22298_1000009521 217
101 3300002067 JGI24735J21928_10042103 JGI24735J21928_100421032 217
102 3300002244 JGI24742J22300_10000006 JGI24742J22300_100000063 217
103 3300003320 rootH2_10000244 rootH2_10000244424 217
104 3300003320 rootH2_10107295 rootH2_101072952 217
105 3300003323 rootH1_10219291 rootH1_102192912 217
106 3300005289 Ga0065704_10109593 Ga0065704_101095931 217
107 3300005327 Ga0070658_10004138 Ga0070658_1000413813 217
108 3300005456 Ga0070678_100340006 Ga0070678_1003400062 217
109 3300005459 Ga0068867_100314422 Ga0068867_1003144222 217
110 3300005535 Ga0070684_100018888 Ga0070684_1000188882 217
111 3300005535 Ga0070684_100117569 Ga0070684_1001175693 217
112 3300005563 Ga0068855_100000003 Ga0068855_10000000371 217
113 3300005563 Ga0068855_100093694 Ga0068855_1000936942 217
114 3300005577 Ga0068857_100171667 Ga0068857_1001716673 217
115 3300005577 Ga0068857_100917569 Ga0068857_1009175692 217
116 3300005614 Ga0068856_100000866 Ga0068856_10000086617 217
117 3300005616 Ga0068852_100464400 Ga0068852_1004644002 217
118 3300006028 Ga0070717_10299295 Ga0070717_102992952 217
119 3300006028 Ga0070717_10501526 Ga0070717_105015262 217
120 3300006038 Ga0075365_10000020 Ga0075365_100000206 217
121 3300006042 Ga0075368_10006658 Ga0075368_100066581 217
122 3300006048 Ga0075363_100000016 Ga0075363_10000001637 217
123 3300006051 Ga0075364_10001546 Ga0075364_100015468 217
124 3300006051 Ga0075364_10001845 Ga0075364_100018453 217
125 3300006051 Ga0075364_10032724 Ga0075364_100327244 217
126 3300006051 Ga0075364_10132697 Ga0075364_101326972 217
127 3300006051 Ga0075364_10194566 Ga0075364_101945662 217
128 3300006051 Ga0075364_10212757 Ga0075364_102127572 217
129 3300006178 Ga0075367_10000034 Ga0075367_1000003428 217
130 3300006178 Ga0075367_10003897 Ga0075367_100038976 217
131 3300006186 Ga0075369_10110927 Ga0075369_101109272 217
132 3300006195 Ga0075366_10000044 Ga0075366_1000004431 217
133 3300006195 Ga0075366_10000083 Ga0075366_100000833 217
134 3300006195 Ga0075366_10000684 Ga0075366_100006848 217
135 3300006195 Ga0075366_10059650 Ga0075366_100596502 217
136 3300006237 Ga0097621_100003413 Ga0097621_1000034132 217
137 3300006353 Ga0075370_10020582 Ga0075370_100205822 217
138 3300006358 Ga0068871_100000156 Ga0068871_10000015612 217
139 3300009093 Ga0105240_10294250 Ga0105240_102942502 217
140 3300009098 Ga0105245_10000002 Ga0105245_10000002188 217
141 3300009174 Ga0105241_10000003 Ga0105241_10000003231 217
142 3300009177 Ga0105248_11040035 Ga0105248_110400351 217
143 3300009993 Ga0105028_100187 Ga0105028_1001871 217
144 3300013100 Ga0157373_10000042 Ga0157373_1000004223 217
145 3300013104 Ga0157370_10115012 Ga0157370_101150122 217
146 3300013105 Ga0157369_10000261 Ga0157369_1000026170 217
147 3300013296 Ga0157374_10000031 Ga0157374_10000031185 217
148 3300013296 Ga0157374_10089394 Ga0157374_100893943 217
149 3300013296 Ga0157374_10823501 Ga0157374_108235012 217
150 3300014745 Ga0157377_10080312 Ga0157377_100803123 217
151 3300014745 Ga0157377_10465983 Ga0157377_104659832 217
152 3300025904 Ga0207647_10000458 Ga0207647_1000045835 217
153 3300025909 Ga0207705_10070393 Ga0207705_100703933 217
154 3300025911 Ga0207654_10000002 Ga0207654_10000002978 217
155 3300025913 Ga0207695_10209809 Ga0207695_102098092 217
156 3300025927 Ga0207687_10000001 Ga0207687_100000011023 217
157 3300025944 Ga0207661_10012888 Ga0207661_100128884 217
158 3300025949 Ga0207667_10000008 Ga0207667_1000000870 217
159 3300025949 Ga0207667_10191363 Ga0207667_101913632 217
160 3300026078 Ga0207702_10001222 Ga0207702_1000122216 217
161 3300026089 Ga0207648_10332566 Ga0207648_103325662 217
162 3300026116 Ga0207674_10096983 Ga0207674_100969834 217
163 3300026116 Ga0207674_10185553 Ga0207674_101855533 217
164 3300026116 Ga0207674_10724855 Ga0207674_107248551 217
165 3300026142 Ga0207698_10432522 Ga0207698_104325222 217
166 3300027866 Ga0209813_10000004 Ga0209813_10000004100 217
167 3300037418 Ga0395900_0055305 Ga0395900_0055305_1702_2355 217
168 3300046694 Ga0495649_0000284 Ga0495649_0000284_23193_23846 217
169 3300048929 Ga0496126_0336623 Ga0496126_0336623_98_751 217
170 3300049568 Ga0501031_0000163 Ga0501031_0000163_14145_14798 217
171 3300049569 Ga0501032_0025266 Ga0501032_0025266_2647_3300 217
172 3300049571 Ga0501034_0060274 Ga0501034_0060274_247_900 217
173 3300049572 Ga0501036_0004824 Ga0501036_0004824_4479_5132 217
174 3300049573 Ga0501037_0000121 Ga0501037_0000121_40756_41409 217
175 3300049574 Ga0501038_0005584 Ga0501038_0005584_6816_7469 217
176 3300049578 Ga0501042_0187113 Ga0501042_0187113_94_747 217
177 3300049579 Ga0501043_0002322 Ga0501043_0002322_8919_9572 217
178 3300049580 Ga0501046_0000138 Ga0501046_0000138_62357_63010 217
179 3300049580 Ga0501046_0226708 Ga0501046_0226708_619_1272 217
180 3300049581 Ga0501047_0000681 Ga0501047_0000681_11161_11814 217
181 3300049582 Ga0501048_0000361 Ga0501048_0000361_14909_15562 217
182 3300049586 Ga0501070_0012332 Ga0501070_0012332_4550_5203 217
183 3300049589 Ga0501073_0022103 Ga0501073_0022103_3595_4248 217
184 3300049822 Ga0501035_0000801 Ga0501035_0000801_130_783 217
185 3300049823 Ga0501044_0008015 Ga0501044_0008015_8014_8667 217
186 3300050489 nmdc:mga03683_1412_c1 nmdc:mga03683_1412_c1_5166_5822 217
187 3300050490 nmdc:mga03n38_22_c1 nmdc:mga03n38_22_c1_32708_33361 217
188 3300050491 nmdc:mga00v17_120353_c1 nmdc:mga00v17_120353_c1_401_1084 217
189 3300050491 nmdc:mga00v17_140683_c1 nmdc:mga00v17_140683_c1_419_1072 217
190 3300050491 nmdc:mga00v17_177814_c1 nmdc:mga00v17_177814_c1_548_1201 217
191 3300050491 nmdc:mga00v17_2773_c1 nmdc:mga00v17_2773_c1_1771_2442 217
192 3300050491 nmdc:mga00v17_894_c1 nmdc:mga00v17_894_c1_9276_9932 217
193 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_214141_214797 217
194 3300050493 nmdc:mga0k408_114_c1 nmdc:mga0k408_114_c1_21623_22276 217
195 3300050493 nmdc:mga0k408_12963_c1 nmdc:mga0k408_12963_c1_1869_2522 217
196 3300050493 nmdc:mga0k408_17_c2 nmdc:mga0k408_17_c2_21607_22263 217
197 3300050493 nmdc:mga0k408_337_c1 nmdc:mga0k408_337_c1_12172_12843 217
198 3300050493 nmdc:mga0k408_51728_c1 nmdc:mga0k408_51728_c1_922_1575 217
199 3300050494 nmdc:mga06z11_44_c1 nmdc:mga06z11_44_c1_45618_46289 217
200 3300050494 nmdc:mga06z11_6_c1 nmdc:mga06z11_6_c1_19019_19672 217
201 3300050495 nmdc:mga04h51_4_c1 nmdc:mga04h51_4_c1_48261_48914 217
202 3300050496 nmdc:mga07m45_3390_c1 nmdc:mga07m45_3390_c1_479_1132 217
203 3300050516 nmdc:mga0sz30_98106_c1 nmdc:mga0sz30_98106_c1_237_890 217
204 3300053087 Ga0500643_000010 Ga0500643_000010_406670_407323 217
205 3300053108 Ga0500562_000002 Ga0500562_000002_834406_835059 217
206 3300053137 Ga0500561_0000001 Ga0500561_0000001_610691_611344 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18306

LDcluster4

SLOG cluster4 family

12

178

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iz5-assembly1.cif.gz_A function and structure of the molybdenum cofactor carrier protein mcp from chlamydomonas reinhardtii 0.8956 11 185
2iz5-assembly1.cif.gz_C function and structure of the molybdenum cofactor carrier protein mcp from chlamydomonas reinhardtii 0.892 11 185
2iz5-assembly1.cif.gz_B function and structure of the molybdenum cofactor carrier protein mcp from chlamydomonas reinhardtii 0.8914 11 185
2iz6-assembly1.cif.gz_A-2 structure of the chlamydomonas rheinhardtii moco carrier protein 0.8882 10 185
2iz5-assembly1.cif.gz_A function and structure of the molybdenum cofactor carrier protein mcp from chlamydomonas reinhardtii 0.8801 11 185
ID Description Score Start End Superfamily
2iz7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8711 11 187 3.40.50.450
2iz7A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8612 11 187 3.40.50.450
af_I6XEF6_16_197_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8263 10 183 3.40.50.450
1rcuD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8254 14 184 3.40.50.450
af_Q2G0B7_1_186_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.814 13 182 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A832U3M6-F1-model_v4 TIGR00725 family protein 0.9615 10 186 GO:0005829
AF-A0A2H0TJ05-F1-model_v4 TIGR00725 family protein 0.9612 10 139 GO:0005829
AF-A0A0G0HSY1-F1-model_v4 Uncharacterized protein 0.9592 12 117
AF-A0A0G1Q589-F1-model_v4 TIGR00725 family protein 0.9586 29 188
AF-A0A7V3EV22-F1-model_v4 TIGR00725 family protein 0.9563 10 138 GO:0005829

Feature Viewer

pLDDT pTM Quality
87.94 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map