F314427

General Info

Members Datasets Scaffolds Average Seq Length
205 148 410 140

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_374787_c1|nmdc:mga09592_374787_c1_452_952
Length 166
Sequence VLCRSPAAPFDLGVRGSSSDPIARRSKMAKYMLIMRGTDESVAKMMETPFEQMLETVGRFNEELIRAGVLVAAEGLDDASQGVVVDFSGETPVVTDGPYGETKELFGGFYLIDVATKEEAVEWGKRLPAVAGTKCEIRRVPTIDEFPQDNEWIIRERAWRERTGQL

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
17 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
35 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
50 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
51 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
52 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
53 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
54 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
57 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
66 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
67 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
68 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
69 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
70 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
71 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
72 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
73 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
74 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
75 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
76 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
77 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
78 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
79 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
80 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
81 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
82 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
83 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
88 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
98 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
102 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
108 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
124 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
125 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
128 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
129 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
130 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
133 2619618881 Frankia sp. ACN1ag Isolate Unclassified
134 2619619003 Frankia sp. CpI1-P Isolate Nodule
135 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
136 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
137 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
138 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
139 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
140 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
141 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
142 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
143 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
144 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
145 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
146 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
147 8054920844 Frankia tisae Agncl-8 Isolate Nodule
148 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.71
Metatranscriptomes 0
Isolates 8.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 1.46
Rhizoplane 1.46
Rhizosphere 81.46
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_374787_c1 3300050508 Bacteria 1231
2 rootH1_10076955 3300003316 Bacteria 1749
3 Ga0065714_10438957 3300005288 Bacteria 562
4 Ga0070683_101064900 3300005329 Bacteria 777
5 Ga0070710_10000727 3300005437 Bacteria 15702
6 Ga0070710_10001069 3300005437 Bacteria 12979
7 Ga0070708_100840997 3300005445 Bacteria 862
8 Ga0070698_100038883 3300005471 Bacteria 4902
9 Ga0068853_101149343 3300005539 Bacteria 749
10 Ga0070665_100123887 3300005548 Bacteria 2587
11 Ga0070702_100230985 3300005615 Bacteria 1243
12 Ga0068859_100011447 3300005617 Bacteria 8916
13 Ga0068863_100001572 3300005841 Bacteria 22572
14 Ga0068858_100002112 3300005842 Bacteria 20192
15 Ga0068858_100026868 3300005842 Bacteria 5347
16 Ga0068862_101041484 3300005844 Bacteria 811
17 Ga0075365_10001280 3300006038 Bacteria 11177
18 Ga0075367_10460512 3300006178 Bacteria 806
19 Ga0068871_101453202 3300006358 Bacteria 647
20 Ga0075428_100854994 3300006844 Bacteria 966
21 Ga0075430_100002168 3300006846 Bacteria 16252
22 Ga0075429_100249695 3300006880 Bacteria 1554
23 Ga0097620_100011447 3300006931 Bacteria 8916
24 Ga0105244_10191134 3300009036 Bacteria 968
25 Ga0105245_10549844 3300009098 Bacteria 1176
26 Ga0114129_10082107 3300009147 Bacteria 4479
27 Ga0105242_11658436 3300009176 Bacteria 674
28 Ga0105242_11910766 3300009176 Bacteria 634
29 Ga0105249_12089578 3300009553 Bacteria 639
30 Ga0105239_11695648 3300010375 Bacteria 731
31 Ga0157371_10083665 3300013102 Bacteria 2259
32 Ga0157370_10001157 3300013104 Bacteria 32907
33 Ga0163162_11420607 3300013306 Bacteria 790
34 Ga0163162_11483607 3300013306 Bacteria 772
35 Ga0163163_12513304 3300014325 Bacteria 573
36 Ga0157380_10754467 3300014326 Bacteria 985
37 Ga0157379_11010958 3300014968 Bacteria 793
38 Ga0157379_11962816 3300014968 Bacteria 578
39 Ga0157376_12812301 3300014969 Bacteria 526
40 Ga0207655_1136872 3300025728 Bacteria 791
41 Ga0207692_10000154 3300025898 Bacteria 21823
42 Ga0207692_10000239 3300025898 Bacteria 18586
43 Ga0207710_10000023 3300025900 Bacteria 329909
44 Ga0207680_11111114 3300025903 Bacteria 565
45 Ga0207685_10005455 3300025905 Bacteria 3359
46 Ga0207652_10717584 3300025921 Bacteria 891
47 Ga0207652_11320849 3300025921 Bacteria 624
48 Ga0207712_11567128 3300025961 Bacteria 590
49 Ga0207703_10000021 3300026035 Bacteria 247414
50 Ga0207703_10378822 3300026035 Bacteria 1308
51 Ga0207678_11834150 3300026067 Bacteria 530
52 Ga0207641_10002242 3300026088 Bacteria 18041
53 Ga0207674_11505458 3300026116 Bacteria 642
54 Ga0268266_10229106 3300028379 Bacteria 1711
55 Ga0307517_10475211 3300028786 Bacteria 642
56 Ga0307515_10021954 3300028794 Bacteria 11285
57 Ga0316177_1211941 3300030731 Bacteria 11266
58 Ga0316176_1000913 3300030732 Bacteria 1493
59 Ga0316176_1178427 3300030732 Bacteria 1814
60 Ga0314311_1080877 3300030733 Bacteria 1527
61 Ga0314311_1251800 3300030733 Bacteria 929
62 Ga0316180_1008999 3300030736 Bacteria 909
63 Ga0316180_1048919 3300030736 Bacteria 2876
64 Ga0316180_1165141 3300030736 Bacteria 1170
65 Ga0316183_1022330 3300030742 Bacteria 635
66 Ga0307509_10058029 3300031507 Bacteria 4100
67 Ga0307509_10084994 3300031507 Bacteria 3258
68 Ga0307509_10155450 3300031507 Bacteria 2194
69 Ga0307509_10423121 3300031507 Bacteria 1032
70 Ga0307408_100069180 3300031548 Bacteria 2602
71 Ga0307508_10547186 3300031616 Bacteria 755
72 Ga0307516_10236606 3300031730 Bacteria 1527
73 Ga0307516_10320704 3300031730 Bacteria 1220
74 Ga0307405_10006185 3300031731 Bacteria 5866
75 Ga0307405_10415389 3300031731 Bacteria 1057
76 Ga0307405_11993234 3300031731 Bacteria 519
77 Ga0307413_10560413 3300031824 Bacteria 928
78 Ga0307413_11294421 3300031824 Bacteria 637
79 Ga0307410_10004139 3300031852 Bacteria 7436
80 Ga0307410_10203826 3300031852 Bacteria 1512
81 Ga0307410_10607358 3300031852 Bacteria 913
82 Ga0307410_11790245 3300031852 Bacteria 545
83 Ga0307407_10117411 3300031903 Bacteria 1681
84 Ga0307407_10167925 3300031903 Bacteria 1442
85 Ga0307407_10536461 3300031903 Bacteria 863
86 Ga0307412_10130910 3300031911 Bacteria 1822
87 Ga0307412_10220865 3300031911 Bacteria 1452
88 Ga0307412_10444568 3300031911 Bacteria 1066
89 Ga0307409_100178039 3300031995 Bacteria 1879
90 Ga0307409_102311608 3300031995 Bacteria 567
91 Ga0307416_101968674 3300032002 Bacteria 687
92 Ga0307416_102438141 3300032002 Bacteria 622
93 Ga0307411_10573344 3300032005 Bacteria 966
94 Ga0307507_10374391 3300033179 Bacteria 824
95 Ga0307510_10409890 3300033180 Bacteria 798
96 Ga0373935_0001950 3300035692 Bacteria 11604
97 Ga0373935_0244465 3300035692 Bacteria 1254
98 Ga0439438_016027 3300041405 Bacteria 2188
99 Ga0439439_0020404 3300041406 Bacteria 1648
100 Ga0439466_0233134 3300041411 Bacteria 558
101 Ga0439465_0211120 3300041413 Bacteria 710
102 Ga0451797_0524355 3300041453 Bacteria 729
103 Ga0451795_0264496 3300041456 Bacteria 620
104 Ga0451802_2106956 3300041460 Bacteria 645
105 Ga0439433_0007809 3300041999 Bacteria 2312
106 Ga0439433_0020095 3300041999 Bacteria 1490
107 Ga0439442_043706 3300042002 Bacteria 944
108 Ga0439449_0219194 3300042007 Bacteria 713
109 Ga0439452_065066 3300042010 Bacteria 811
110 Ga0439462_0031871 3300042015 Bacteria 1397
111 Ga0450906_008316 3300042145 Bacteria 2012
112 Ga0450908_015531 3300042184 Bacteria 1363
113 Ga0439434_0207455 3300042435 Bacteria 662
114 Ga0466972_0004934 3300044658 Bacteria 6696
115 Ga0466972_0006036 3300044658 Bacteria 6087
116 Ga0466972_0130957 3300044658 Bacteria 1181
117 Ga0466972_0150716 3300044658 Bacteria 1093
118 Ga0466972_0201388 3300044658 Bacteria 932
119 Ga0466965_0001022 3300044683 Bacteria 10830
120 Ga0466965_0018693 3300044683 Bacteria 3325
121 Ga0466965_0022404 3300044683 Bacteria 3045
122 Ga0466965_0042883 3300044683 Bacteria 2232
123 Ga0466965_0068871 3300044683 Bacteria 1777
124 Ga0466965_0095586 3300044683 Bacteria 1515
125 Ga0466965_0124035 3300044683 Bacteria 1335
126 Ga0466965_0202016 3300044683 Bacteria 1054
127 Ga0466965_0750104 3300044683 Bacteria 562
128 Ga0466968_0060062 3300044735 Bacteria 1638
129 Ga0466968_0116269 3300044735 Bacteria 1207
130 Ga0466957_0788688 3300044842 Bacteria 674
131 Ga0466960_0003285 3300044901 Bacteria 6201
132 Ga0495592_0066468 3300046454 Bacteria 2638
133 Ga0495592_0074962 3300046454 Bacteria 2457
134 Ga0495629_0031927 3300046459 Bacteria 3729
135 Ga0495629_0042103 3300046459 Bacteria 3210
136 Ga0495594_0255522 3300046499 Bacteria 998
137 Ga0495594_0322107 3300046499 Bacteria 881
138 Ga0495594_0387086 3300046499 Bacteria 796
139 Ga0495628_0005346 3300046516 Bacteria 11266
140 Ga0495630_1065483 3300046517 Bacteria 613
141 Ga0495652_0002490 3300046529 Bacteria 18913
142 Ga0495652_0035803 3300046529 Bacteria 4319
143 Ga0495640_0031529 3300046533 Bacteria 3781
144 Ga0495667_0109363 3300046559 Bacteria 1786
145 Ga0495623_0045217 3300046679 Bacteria 2797
146 Ga0495623_0054427 3300046679 Bacteria 2525
147 Ga0495646_0004919 3300046680 Bacteria 8438
148 Ga0495613_0012432 3300046689 Bacteria 6325
149 Ga0495624_0173426 3300046690 Bacteria 1315
150 Ga0495604_0021901 3300047317 Bacteria 5102
151 Ga0495604_0033663 3300047317 Bacteria 4055
152 Ga0495676_0118564 3300047321 Bacteria 1930
153 Ga0495675_0042842 3300047444 Bacteria 2883
154 Ga0495675_0852561 3300047444 Bacteria 501
155 Ga0495593_0030362 3300047673 Bacteria 2958
156 Ga0496118_0449205 3300048921 Bacteria 655
157 Ga0496121_0567447 3300048924 Bacteria 707
158 Ga0496122_0017392 3300048925 Bacteria 6726
159 Ga0496123_0028530 3300048926 Bacteria 4129
160 Ga0501031_0373778 3300049568 Bacteria 922
161 Ga0501031_0409880 3300049568 Bacteria 876
162 Ga0501032_0766048 3300049569 Bacteria 610
163 Ga0501038_0233049 3300049574 Bacteria 1464
164 Ga0501039_0752219 3300049575 Bacteria 761
165 Ga0501042_0093422 3300049578 Bacteria 2160
166 Ga0501043_0041741 3300049579 Bacteria 3604
167 Ga0501043_0879180 3300049579 Bacteria 644
168 Ga0501047_0049326 3300049581 Bacteria 4065
169 Ga0501048_0951335 3300049582 Bacteria 618
170 Ga0501209_142973 3300049656 Bacteria 718
171 Ga0501080_1440533 3300049742 Bacteria 587
172 Ga0501083_0000059 3300049744 Bacteria 78374
173 Ga0501035_0011695 3300049822 Bacteria 8133
174 Ga0501035_0099581 3300049822 Bacteria 2551
175 Ga0501044_0017060 3300049823 Bacteria 7791
176 Ga0501044_0032106 3300049823 Bacteria 5521
177 Ga0501044_0388717 3300049823 Bacteria 1309
178 Ga0501045_1288294 3300049824 Bacteria 532
179 nmdc:mga00v17_213660_c1 3300050491 Bacteria 1248
180 nmdc:mga06z11_536100_c1 3300050494 Bacteria 710
181 nmdc:mga06z11_841079_c1 3300050494 Bacteria 559
182 nmdc:mga0qj67_966_c1 3300050509 Bacteria 19788
183 Ga0495601_0004715 3300053077 Bacteria 7902
184 Ga0500652_222816 3300053131 Bacteria 758
185 Ga0500600_0129068 3300053149 Bacteria 1290
186 Ga0500616_0000389 3300053153 Bacteria 61206
187 Ga0500630_184937 3300053159 Bacteria 834
188 Ga0501084_0616935 3300054114 Bacteria 916
189 2579855340 2579778521 Bacteria 7624758
190 2619856017 2619618881 Bacteria 7521104
191 2620350955 2619619003 Bacteria 7619552
192 2676480636 2675903059 Bacteria 8644972
193 2739237720 2738543011 Bacteria 5731169
194 2753270829 2751185782 Bacteria 11227053
195 2768647651 2767802112 Bacteria 6465194
196 2812333769 2811994874 Bacteria 5367947
197 2835188373 2835188231 Bacteria 3476928
198 2837184434 2837183177 Bacteria 4637169
199 2839986246 2839986021 Bacteria 3685650
200 2889304922 2889300758 Bacteria 5690814
201 2939746478 2939743619 Bacteria 5762299
202 8001786916 8001781756 Bacteria 9586736
203 8004027050 8004025490 Bacteria 4327753
204 8054927052 8054920844 Bacteria 7068637
205 8055158682 8055157932 Bacteria 6429399
206 nmdc:mga09592_374787_c1
207 rootH1_10076955
208 Ga0065714_10438957
209 Ga0070683_101064900
210 Ga0070710_10000727
211 Ga0070710_10001069
212 Ga0070708_100840997
213 Ga0070698_100038883
214 Ga0068853_101149343
215 Ga0070665_100123887
216 Ga0070702_100230985
217 Ga0068859_100011447
218 Ga0068863_100001572
219 Ga0068858_100002112
220 Ga0068858_100026868
221 Ga0068862_101041484
222 Ga0075365_10001280
223 Ga0075367_10460512
224 Ga0068871_101453202
225 Ga0075428_100854994
226 Ga0075430_100002168
227 Ga0075429_100249695
228 Ga0097620_100011447
229 Ga0105244_10191134
230 Ga0105245_10549844
231 Ga0114129_10082107
232 Ga0105242_11658436
233 Ga0105242_11910766
234 Ga0105249_12089578
235 Ga0105239_11695648
236 Ga0157371_10083665
237 Ga0157370_10001157
238 Ga0163162_11420607
239 Ga0163162_11483607
240 Ga0163163_12513304
241 Ga0157380_10754467
242 Ga0157379_11010958
243 Ga0157379_11962816
244 Ga0157376_12812301
245 Ga0207655_1136872
246 Ga0207692_10000154
247 Ga0207692_10000239
248 Ga0207710_10000023
249 Ga0207680_11111114
250 Ga0207685_10005455
251 Ga0207652_10717584
252 Ga0207652_11320849
253 Ga0207712_11567128
254 Ga0207703_10000021
255 Ga0207703_10378822
256 Ga0207678_11834150
257 Ga0207641_10002242
258 Ga0207674_11505458
259 Ga0268266_10229106
260 Ga0307517_10475211
261 Ga0307515_10021954
262 Ga0316177_1211941
263 Ga0316176_1000913
264 Ga0316176_1178427
265 Ga0314311_1080877
266 Ga0314311_1251800
267 Ga0316180_1008999
268 Ga0316180_1048919
269 Ga0316180_1165141
270 Ga0316183_1022330
271 Ga0307509_10058029
272 Ga0307509_10084994
273 Ga0307509_10155450
274 Ga0307509_10423121
275 Ga0307408_100069180
276 Ga0307508_10547186
277 Ga0307516_10236606
278 Ga0307516_10320704
279 Ga0307405_10006185
280 Ga0307405_10415389
281 Ga0307405_11993234
282 Ga0307413_10560413
283 Ga0307413_11294421
284 Ga0307410_10004139
285 Ga0307410_10203826
286 Ga0307410_10607358
287 Ga0307410_11790245
288 Ga0307407_10117411
289 Ga0307407_10167925
290 Ga0307407_10536461
291 Ga0307412_10130910
292 Ga0307412_10220865
293 Ga0307412_10444568
294 Ga0307409_100178039
295 Ga0307409_102311608
296 Ga0307416_101968674
297 Ga0307416_102438141
298 Ga0307411_10573344
299 Ga0307507_10374391
300 Ga0307510_10409890
301 Ga0373935_0001950
302 Ga0373935_0244465
303 Ga0439438_016027
304 Ga0439439_0020404
305 Ga0439466_0233134
306 Ga0439465_0211120
307 Ga0451797_0524355
308 Ga0451795_0264496
309 Ga0451802_2106956
310 Ga0439433_0007809
311 Ga0439433_0020095
312 Ga0439442_043706
313 Ga0439449_0219194
314 Ga0439452_065066
315 Ga0439462_0031871
316 Ga0450906_008316
317 Ga0450908_015531
318 Ga0439434_0207455
319 Ga0466972_0004934
320 Ga0466972_0006036
321 Ga0466972_0130957
322 Ga0466972_0150716
323 Ga0466972_0201388
324 Ga0466965_0001022
325 Ga0466965_0018693
326 Ga0466965_0022404
327 Ga0466965_0042883
328 Ga0466965_0068871
329 Ga0466965_0095586
330 Ga0466965_0124035
331 Ga0466965_0202016
332 Ga0466965_0750104
333 Ga0466968_0060062
334 Ga0466968_0116269
335 Ga0466957_0788688
336 Ga0466960_0003285
337 Ga0495592_0066468
338 Ga0495592_0074962
339 Ga0495629_0031927
340 Ga0495629_0042103
341 Ga0495594_0255522
342 Ga0495594_0322107
343 Ga0495594_0387086
344 Ga0495628_0005346
345 Ga0495630_1065483
346 Ga0495652_0002490
347 Ga0495652_0035803
348 Ga0495640_0031529
349 Ga0495667_0109363
350 Ga0495623_0045217
351 Ga0495623_0054427
352 Ga0495646_0004919
353 Ga0495613_0012432
354 Ga0495624_0173426
355 Ga0495604_0021901
356 Ga0495604_0033663
357 Ga0495676_0118564
358 Ga0495675_0042842
359 Ga0495675_0852561
360 Ga0495593_0030362
361 Ga0496118_0449205
362 Ga0496121_0567447
363 Ga0496122_0017392
364 Ga0496123_0028530
365 Ga0501031_0373778
366 Ga0501031_0409880
367 Ga0501032_0766048
368 Ga0501038_0233049
369 Ga0501039_0752219
370 Ga0501042_0093422
371 Ga0501043_0041741
372 Ga0501043_0879180
373 Ga0501047_0049326
374 Ga0501048_0951335
375 Ga0501209_142973
376 Ga0501080_1440533
377 Ga0501083_0000059
378 Ga0501035_0011695
379 Ga0501035_0099581
380 Ga0501044_0017060
381 Ga0501044_0032106
382 Ga0501044_0388717
383 Ga0501045_1288294
384 nmdc:mga00v17_213660_c1
385 nmdc:mga06z11_536100_c1
386 nmdc:mga06z11_841079_c1
387 nmdc:mga0qj67_966_c1
388 Ga0495601_0004715
389 Ga0500652_222816
390 Ga0500600_0129068
391 Ga0500616_0000389
392 Ga0500630_184937
393 Ga0501084_0616935
394 2579855340
395 2619856017
396 2620350955
397 2676480636
398 2739237720
399 2753270829
400 2768647651
401 2812333769
402 2835188373
403 2837184434
404 2839986246
405 2889304922
406 2939746478
407 8001786916
408 8004027050
409 8054927052
410 8055158682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

29

144

0.9

Map