F314303

General Info

Members Datasets Scaffolds Average Seq Length
205 145 178 948

Family's Representative Sequence

Representative Sequence 3300046691|Ga0495670_0000002|Ga0495670_0000002_345054_348143
Length 1029
Sequence MAIVTAEKGHTLLSIRVDRAPASGVDRIMIGVAEMRRPGRRRMKIQVSKSHQWGLKALSGASLGAVALGLLLPATAFAGVDPDDKVEAAKAESAAAAPQDVPPAPEAAQDQPGDEIVVTGFRQSLGAAIAVKRQSVSSVDAIVAEDIAKFPDQNLAESLQRIPGVSIQRDAGEGRSITVRGLGAQFTRVRLNGLETVATSTDGASANRDRAFDFNVFASELFSSLVVHKTAEPSLDEGSLGAVVDLNTGNPLGGKSGLTAVANIQGSYNDLSKKVGPRLAGLLSWRNADGSFGVSVSAAYQKTNNLELGNNSVRWAQARFDSVNGTPCFYTTQAGNTAAPNSGGFYRPSAICDQAALAFHPRIPRYGEVRHDRERLGITGSVQFAPTEATKISIDGLYSRFKETREEKWGEVLLRSNERSIDLTNFTVDSNNTMVTGTLNDAWVRTEHYLRKSNTEFYQFGGSWDQDLGEDFRFTVVGGLSKSSADIPVETTFVFDDRDAQGYSFDYTDMHFPKLTFGTSVTDPANFQLAEIRDRPSNVTNKFQTAQARFEWDANEFLTVKAGGVYRKFTFDSVAFTRDAVVCGNGGLDVVLKQITCSPSSAFGPTAVYGFAATGLSESFNLGDAGQPNGNTNSWIVPDIAKSAAFTGLYNRTPAVDAGNTRSVGEKVTGGYFQFDIKTDALGFDVAFNGGMRYAHTDQTSSGLNSGVLVTVDRSYDDWLPSMNLALYPTKDIIVRAAVAKVLTRPTLGNLTPGGSVDGFNYRVTFGNPFLDPFRATAYDFALEWYFAPQSIASIAVFKKDIESFPVTAVTSGTFASTGLPLSVLPPSSPAFINPEGQIWSITGNVNGKGAKLKGIELSLQAPFTFLPGFLSHFGGILNATFVDSSANYTVAGPTVATCVPPANPAAACTFGPNVGASRTSTLFGLSKTALNGTLYYEDSKFSARASVSYRGPYVDQNSGTGNVFEGYNEAVNVDASVRYKLTDWVELSVEGVNLTDAYRDRYTDLDANRNYEYNHFGRTILFGARLKL

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
5 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
6 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
7 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
8 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
9 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
10 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
11 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
12 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
13 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
14 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
15 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
16 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
17 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
18 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
19 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
20 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
21 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
22 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
23 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
24 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
51 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
54 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
55 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
90 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
91 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
92 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
93 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
94 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
95 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
117 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
118 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
119 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
120 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
121 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
124 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
125 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
126 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
127 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
131 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
132 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
133 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
134 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
135 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
136 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
137 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
138 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
139 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
141 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
142 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
143 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
144 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
145 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.83
Metatranscriptomes 0
Isolates 13.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 30.73
Nodule 0
Rhizoplane 0.98
Rhizosphere 52.68
Stem 0
Stem Tuber 0
Unclassified 15.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1000082 3300002774 Bacteria 56551
2 JGI25153J46596_10000029 3300003215 Bacteria 201658
3 Ga0055524_1000276 3300003775 Bacteria 50977
4 Ga0055536_1001798 3300003781 Bacteria 12640
5 Ga0055530_10000099 3300003791 Bacteria 73409
6 Ga0055530_10007861 3300003791 Bacteria 4392
7 Ga0055540_1000624 3300003792 Bacteria 25179
8 Ga0055531_10000498 3300003794 Bacteria 35916
9 Ga0055531_10011140 3300003794 Bacteria 4377
10 Ga0065165_1000523 3300005262 Bacteria 58644
11 Ga0065165_1003129 3300005262 Bacteria 12239
12 Ga0070683_100038814 3300005329 Bacteria 4367
13 Ga0070661_100000011 3300005344 Bacteria 175355
14 Ga0070674_100000474 3300005356 Bacteria 20247
15 Ga0070659_100000810 3300005366 Bacteria 22806
16 Ga0070678_100000141 3300005456 Bacteria 29532
17 Ga0070679_100000008 3300005530 Bacteria 194672
18 Ga0070665_100000049 3300005548 Bacteria 261123
19 Ga0070665_100000129 3300005548 Bacteria 141818
20 Ga0068854_100004058 3300005578 Bacteria 9195
21 Ga0068854_100025199 3300005578 Bacteria 4081
22 Ga0068863_100001700 3300005841 Bacteria 21804
23 Ga0068863_100009670 3300005841 Bacteria 9408
24 Ga0068858_100000188 3300005842 Bacteria 65676
25 Ga0075368_10000253 3300006042 Bacteria 15250
26 Ga0075367_10003012 3300006178 Bacteria 7887
27 Ga0105245_10002743 3300009098 Bacteria 15831
28 Ga0105243_10001284 3300009148 Bacteria 22555
29 Ga0105237_10004370 3300009545 Bacteria 16384
30 Ga0105238_10042941 3300009551 Bacteria 4576
31 Ga0157378_10048025 3300013297 Bacteria 3795
32 Ga0157380_10012987 3300014326 Bacteria 6055
33 Ga0183363_1006 3300015690 Bacteria 400466
34 Ga0213873_10000006 3300021358 Bacteria 408723
35 Ga0213876_10000004 3300021384 Bacteria 943822
36 Ga0207425_1000020 3300025245 Bacteria 372623
37 Ga0209129_1003233 3300025258 Bacteria 7252
38 Ga0209565_1000008 3300025263 Bacteria 774179
39 Ga0209565_1000054 3300025263 Bacteria 206016
40 Ga0209673_1003728 3300025273 Bacteria 8711
41 Ga0209673_1006997 3300025273 Bacteria 5310
42 Ga0209675_1000227 3300025291 Bacteria 57390
43 Ga0209676_1000084 3300025292 Bacteria 274330
44 Ga0209676_1000330 3300025292 Bacteria 91216
45 Ga0209676_1001318 3300025292 Bacteria 25177
46 Ga0209676_1003861 3300025292 Bacteria 8764
47 Ga0209025_1000383 3300025294 Bacteria 91739
48 Ga0209564_1000565 3300025295 Bacteria 58712
49 Ga0209758_1000004 3300025297 Bacteria 1375322
50 Ga0209758_1000933 3300025297 Bacteria 39569
51 Ga0209758_1010839 3300025297 Bacteria 5383
52 Ga0209050_1000001 3300025298 Bacteria 3563507
53 Ga0209050_1000113 3300025298 Bacteria 209222
54 Ga0209050_1000299 3300025298 Bacteria 104017
55 Ga0209050_1000419 3300025298 Bacteria 78444
56 Ga0209050_1003825 3300025298 Bacteria 10743
57 Ga0209050_1008877 3300025298 Bacteria 5263
58 Ga0209256_1000009 3300025299 Bacteria 922071
59 Ga0209256_1000010 3300025299 Bacteria 912110
60 Ga0209051_1000951 3300025303 Bacteria 28407
61 Ga0209257_1000083 3300025304 Bacteria 296207
62 Ga0209257_1000126 3300025304 Bacteria 215705
63 Ga0209257_1000441 3300025304 Bacteria 78385
64 Ga0209257_1000785 3300025304 Bacteria 46654
65 Ga0209257_1000857 3300025304 Bacteria 43371
66 Ga0209257_1002515 3300025304 Bacteria 18019
67 Ga0209257_1006428 3300025304 Bacteria 7576
68 Ga0207647_10000375 3300025904 Bacteria 36351
69 Ga0207671_10009273 3300025914 Bacteria 8243
70 Ga0207649_10000038 3300025920 Bacteria 129260
71 Ga0207652_10000008 3300025921 Bacteria 286698
72 Ga0207687_10001034 3300025927 Bacteria 18922
73 Ga0207690_10000946 3300025932 Bacteria 18590
74 Ga0207709_10000005 3300025935 Bacteria 806813
75 Ga0207669_10000193 3300025937 Bacteria 27676
76 Ga0207661_10048015 3300025944 Bacteria 3391
77 Ga0207640_10000527 3300025981 Bacteria 23072
78 Ga0207640_10004624 3300025981 Bacteria 7471
79 Ga0207703_10001090 3300026035 Bacteria 25837
80 Ga0207648_10018318 3300026089 Bacteria 6343
81 Ga0207674_10000057 3300026116 Bacteria 113117
82 Ga0207674_10085921 3300026116 Bacteria 3140
83 Ga0207683_10002740 3300026121 Bacteria 15393
84 Ga0209813_10000091 3300027866 Bacteria 33557
85 Ga0268266_10000019 3300028379 Bacteria 556465
86 Ga0268266_10000036 3300028379 Bacteria 348910
87 Ga0307510_10016359 3300033180 Bacteria 8754
88 Ga0395900_0073549 3300037418 Bacteria 3514
89 Ga0395898_0046625 3300037466 Bacteria 4257
90 Ga0395905_0001115 3300037471 Bacteria 33668
91 Ga0395905_0054251 3300037471 Bacteria 3751
92 Ga0395901_0088706 3300038443 Bacteria 3235
93 Ga0436365_0970858 3300039437 Bacteria 175279
94 Ga0436365_1530935 3300039437 Bacteria 6910
95 Ga0436362_0554113 3300039453 Bacteria 162652
96 Ga0439461_0000180 3300041410 Bacteria 8595
97 Ga0439461_0002174 3300041410 Bacteria 3107
98 Ga0439465_0001111 3300041413 Bacteria 8624
99 Ga0439431_0000181 3300041997 Bacteria 12196
100 Ga0439432_001041 3300042006 Bacteria 10520
101 Ga0439462_0000142 3300042015 Bacteria 11575
102 Ga0439434_0000194 3300042435 Bacteria 16652
103 Ga0495627_000342 3300046453 Bacteria 43925
104 Ga0495638_0000305 3300046460 Bacteria 63286
105 Ga0495638_0000523 3300046460 Bacteria 44816
106 Ga0495650_0005757 3300046471 Bacteria 7914
107 Ga0495585_0003090 3300046492 Bacteria 11448
108 Ga0495596_0000006 3300046500 Bacteria 161501
109 Ga0495607_0015442 3300046501 Bacteria 4950
110 Ga0495583_0000710 3300046506 Bacteria 42765
111 Ga0495606_0029688 3300046507 Bacteria 3833
112 Ga0495610_0000019 3300046512 Bacteria 351524
113 Ga0495610_0004304 3300046512 Bacteria 10575
114 Ga0495632_0000001 3300046519 Bacteria 873295
115 Ga0495632_0002377 3300046519 Bacteria 14391
116 Ga0495632_0005577 3300046519 Bacteria 8289
117 Ga0495637_0000390 3300046520 Bacteria 32575
118 Ga0495637_0007397 3300046520 Bacteria 5441
119 Ga0495643_0000004 3300046522 Bacteria 519944
120 Ga0495643_0000495 3300046522 Bacteria 49682
121 Ga0495643_0001957 3300046522 Bacteria 17301
122 Ga0495643_0006425 3300046522 Bacteria 7751
123 Ga0495643_0008851 3300046522 Bacteria 6337
124 Ga0495648_0000114 3300046524 Bacteria 98677
125 Ga0495648_0000235 3300046524 Bacteria 63436
126 Ga0495663_0000001 3300046525 Bacteria 595264
127 Ga0495663_0000917 3300046525 Bacteria 9859
128 Ga0495654_0010066 3300046530 Bacteria 5160
129 Ga0495633_0000095 3300046558 Bacteria 119308
130 Ga0495633_0001391 3300046558 Bacteria 18878
131 Ga0495668_0017323 3300046616 Bacteria 4180
132 Ga0495625_0000153 3300046660 Bacteria 105123
133 Ga0495625_0001605 3300046660 Bacteria 26691
134 Ga0495669_0000047 3300046684 Bacteria 82672
135 Ga0495670_0000002 3300046691 Bacteria 601814
136 Ga0495671_0000020 3300046692 Bacteria 268306
137 Ga0495671_0000217 3300046692 Bacteria 49682
138 Ga0495687_000043 3300047443 Bacteria 216711
139 Ga0495673_0000316 3300047469 Bacteria 62814
140 Ga0495681_0000061 3300047470 Bacteria 99933
141 Ga0495681_0000346 3300047470 Bacteria 36454
142 Ga0495681_0014268 3300047470 Bacteria 4564
143 Ga0495686_0001248 3300047472 Bacteria 28936
144 Ga0495615_0000125 3300048090 Bacteria 19309
145 Ga0495626_0001400 3300048091 Bacteria 19323
146 Ga0496111_0005071 3300048914 Bacteria 8377
147 Ga0496116_0000060 3300048919 Bacteria 272219
148 Ga0496118_0016080 3300048921 Bacteria 6884
149 Ga0496121_0005435 3300048924 Bacteria 16331
150 Ga0496122_0001697 3300048925 Bacteria 34173
151 Ga0496122_0007557 3300048925 Bacteria 12026
152 Ga0496123_0000300 3300048926 Bacteria 96475
153 Ga0496123_0000457 3300048926 Bacteria 71921
154 Ga0496123_0001172 3300048926 Bacteria 38728
155 Ga0496123_0015275 3300048926 Bacteria 6307
156 Ga0496124_0001414 3300048927 Bacteria 35695
157 Ga0496124_0013014 3300048927 Bacteria 8154
158 Ga0496124_0019251 3300048927 Bacteria 6362
159 Ga0496124_0037976 3300048927 Bacteria 4183
160 Ga0501070_0047341 3300049586 Bacteria 3574
161 Ga0501249_000039 3300049679 Bacteria 58314
162 nmdc:mga06z11_1392_c1 3300050494 Bacteria 8978
163 nmdc:mga04h51_562_c1 3300050495 Bacteria 8849
164 Ga0500610_0000104 3300053079 Bacteria 25446
165 Ga0500643_003351 3300053087 Bacteria 7751
166 Ga0500556_0000055 3300053104 Bacteria 115798
167 Ga0500642_0000008 3300053130 Bacteria 293258
168 Ga0500642_0000342 3300053130 Bacteria 15905
169 Ga0500658_0001753 3300053134 Bacteria 8563
170 Ga0500568_0001100 3300053139 Bacteria 18207
171 Ga0500568_0009305 3300053139 Bacteria 4678
172 Ga0500604_0000053 3300053151 Bacteria 41228
173 Ga0500616_0000411 3300053153 Bacteria 57962
174 Ga0500624_000671 3300053157 Bacteria 8824
175 Ga0500625_000002 3300053729 Bacteria 371909
176 Ga0500645_000038 3300053730 Bacteria 112786
177 Ga0500645_000682 3300053730 Bacteria 21220
178 Ga0500645_002656 3300053730 Bacteria 7797

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10085921 Ga0207674_100859212 850
2 3300053139 Ga0500568_0001100 Ga0500568_0001100_5908_8751 851
3 3300046522 Ga0495643_0008851 Ga0495643_0008851_3007_5817 863
4 3300003781 Ga0055536_1001798 Ga0055536_10017989 865
5 3300003791 Ga0055530_10000099 Ga0055530_1000009948 865
6 3300003794 Ga0055531_10000498 Ga0055531_1000049829 865
7 3300025291 Ga0209675_1000227 Ga0209675_100022712 865
8 3300025292 Ga0209676_1000084 Ga0209676_100008465 865
9 3300025292 Ga0209676_1000330 Ga0209676_100033013 865
10 3300025298 Ga0209050_1000113 Ga0209050_1000113130 865
11 3300025298 Ga0209050_1003825 Ga0209050_10038253 865
12 3300025304 Ga0209257_1000083 Ga0209257_1000083139 865
13 3300025304 Ga0209257_1000126 Ga0209257_1000126113 865
14 3300048925 Ga0496122_0007557 Ga0496122_0007557_5622_8474 882
15 3300048926 Ga0496123_0000300 Ga0496123_0000300_90104_92956 882
16 3300013297 Ga0157378_10048025 Ga0157378_100480252 887
17 3300037418 Ga0395900_0073549 Ga0395900_0073549_416_3454 887
18 3300038443 Ga0395901_0088706 Ga0395901_0088706_137_3175 887
19 3300048090 Ga0495615_0000125 Ga0495615_0000125_6752_9640 888
20 3300005329 Ga0070683_100038814 Ga0070683_1000388142 889
21 3300025944 Ga0207661_10048015 Ga0207661_100480152 889
22 3300005841 Ga0068863_100001700 Ga0068863_10000170011 893
23 3300026116 Ga0207674_10000057 Ga0207674_1000005762 893
24 3300005842 Ga0068858_100000188 Ga0068858_10000018861 895
25 3300009551 Ga0105238_10042941 Ga0105238_100429412 895
26 3300025298 Ga0209050_1000299 Ga0209050_100029968 895
27 3300026035 Ga0207703_10001090 Ga0207703_1000109014 895
28 3300037471 Ga0395905_0054251 Ga0395905_0054251_306_3401 895
29 iso_pu_bacteria 8054302542 8054306958 895
30 3300046512 Ga0495610_0000019 Ga0495610_0000019_228969_231854 896
31 3300046522 Ga0495643_0000004 Ga0495643_0000004_399488_402364 897
32 3300005366 Ga0070659_100000810 Ga0070659_1000008106 898
33 3300025932 Ga0207690_10000946 Ga0207690_100009466 898
34 3300039437 Ga0436365_1530935 Ga0436365_1530935_3301_6258 898
35 3300046660 Ga0495625_0000153 Ga0495625_0000153_98333_101302 898
36 3300053134 Ga0500658_0001753 Ga0500658_0001753_2053_5007 898
37 3300053730 Ga0500645_002656 Ga0500645_002656_4203_7097 898
38 3300005841 Ga0068863_100009670 Ga0068863_1000096702 899
39 3300009148 Ga0105243_10001284 Ga0105243_1000128416 900
40 3300025297 Ga0209758_1000933 Ga0209758_100093314 900
41 3300025298 Ga0209050_1000419 Ga0209050_100041914 900
42 3300025304 Ga0209257_1000441 Ga0209257_100044114 900
43 3300005262 Ga0065165_1000523 Ga0065165_100052315 901
44 3300021358 Ga0213873_10000006 Ga0213873_1000000687 901
45 3300021384 Ga0213876_10000004 Ga0213876_10000004593 901
46 iso_pu_bacteria 8054302542 8054304321 901
47 3300005262 Ga0065165_1003129 Ga0065165_10031297 902
48 3300005548 Ga0070665_100000049 Ga0070665_10000004974 902
49 3300028379 Ga0268266_10000036 Ga0268266_1000003674 902
50 3300046460 Ga0495638_0000523 Ga0495638_0000523_3727_6681 902
51 3300033180 Ga0307510_10016359 Ga0307510_100163593 903
52 3300047470 Ga0495681_0014268 Ga0495681_0014268_354_3338 903
53 3300053087 Ga0500643_003351 Ga0500643_003351_2826_5756 903
54 3300003775 Ga0055524_1000276 Ga0055524_10002768 904
55 3300025263 Ga0209565_1000008 Ga0209565_1000008418 904
56 3300025273 Ga0209673_1003728 Ga0209673_10037283 904
57 3300025297 Ga0209758_1010839 Ga0209758_10108392 904
58 3300025299 Ga0209256_1000009 Ga0209256_1000009453 904
59 3300025299 Ga0209256_1000010 Ga0209256_1000010377 904
60 3300046453 Ga0495627_000342 Ga0495627_000342_7291_10194 904
61 3300046471 Ga0495650_0005757 Ga0495650_0005757_3653_6556 904
62 3300046500 Ga0495596_0000006 Ga0495596_0000006_103301_106180 904
63 3300046507 Ga0495606_0029688 Ga0495606_0029688_458_3538 904
64 3300046530 Ga0495654_0010066 Ga0495654_0010066_1412_4324 904
65 3300047470 Ga0495681_0000061 Ga0495681_0000061_50740_53643 904
66 3300053139 Ga0500568_0009305 Ga0500568_0009305_710_3724 904
67 3300015690 Ga0183363_1006 Ga0183363_1006373 905
68 3300046501 Ga0495607_0015442 Ga0495607_0015442_1791_4679 905
69 3300046519 Ga0495632_0005577 Ga0495632_0005577_2817_5741 905
70 3300046522 Ga0495643_0006425 Ga0495643_0006425_2284_5172 905
71 3300053157 Ga0500624_000671 Ga0500624_000671_1982_4870 905
72 3300025935 Ga0207709_10000005 Ga0207709_10000005289 906
73 3300026089 Ga0207648_10018318 Ga0207648_100183183 906
74 3300041410 Ga0439461_0002174 Ga0439461_0002174_62_2917 906
75 3300046524 Ga0495648_0000114 Ga0495648_0000114_36135_39053 906
76 3300005578 Ga0068854_100025199 Ga0068854_1000251992 907
77 3300025981 Ga0207640_10004624 Ga0207640_100046245 907
78 3300005356 Ga0070674_100000474 Ga0070674_10000047413 908
79 3300005456 Ga0070678_100000141 Ga0070678_1000001418 908
80 3300025937 Ga0207669_10000193 Ga0207669_100001937 908
81 3300026121 Ga0207683_10002740 Ga0207683_100027407 908
82 3300041410 Ga0439461_0000180 Ga0439461_0000180_4629_7541 908
83 3300041413 Ga0439465_0001111 Ga0439465_0001111_1279_4191 908
84 3300041997 Ga0439431_0000181 Ga0439431_0000181_8657_11569 908
85 3300042006 Ga0439432_001041 Ga0439432_001041_7330_10242 908
86 3300042015 Ga0439462_0000142 Ga0439462_0000142_3908_6820 908
87 3300042435 Ga0439434_0000194 Ga0439434_0000194_11733_14645 908
88 3300046616 Ga0495668_0017323 Ga0495668_0017323_1146_4094 908
89 3300053730 Ga0500645_000682 Ga0500645_000682_12518_15376 908
90 3300025295 Ga0209564_1000565 Ga0209564_100056512 909
91 3300053153 Ga0500616_0000411 Ga0500616_0000411_6138_9080 909
92 iso_pu_bacteria 2643221563 2643835205 909
93 iso_pu_bacteria 2643221608 2644056132 909
94 iso_pu_bacteria 2919138771 2919140255 909
95 3300039437 Ga0436365_0970858 Ga0436365_0970858_20206_23133 910
96 3300039453 Ga0436362_0554113 Ga0436362_0554113_51434_54361 910
97 3300048919 Ga0496116_0000060 Ga0496116_0000060_88012_90894 910
98 3300048921 Ga0496118_0016080 Ga0496118_0016080_2850_5732 910
99 3300048924 Ga0496121_0005435 Ga0496121_0005435_9996_12869 910
100 3300048926 Ga0496123_0000457 Ga0496123_0000457_18493_21375 910
101 3300048927 Ga0496124_0013014 Ga0496124_0013014_1477_4350 910
102 3300048927 Ga0496124_0037976 Ga0496124_0037976_1005_3887 910
103 3300053151 Ga0500604_0000053 Ga0500604_0000053_4743_7679 910
104 iso_pu_bacteria 2643221560 2643822248 910
105 iso_pu_bacteria 2818991438 2819552026 910
106 iso_pu_bacteria 8054302542 8054306372 910
107 3300009098 Ga0105245_10002743 Ga0105245_100027434 911
108 3300025927 Ga0207687_10001034 Ga0207687_100010349 911
109 3300046492 Ga0495585_0003090 Ga0495585_0003090_728_3667 911
110 3300005578 Ga0068854_100004058 Ga0068854_1000040582 912
111 3300025981 Ga0207640_10000527 Ga0207640_1000052712 912
112 3300037471 Ga0395905_0001115 Ga0395905_0001115_13371_16385 912
113 3300046512 Ga0495610_0004304 Ga0495610_0004304_6695_9583 912
114 3300048091 Ga0495626_0001400 Ga0495626_0001400_5543_8431 912
115 3300053729 Ga0500625_000002 Ga0500625_000002_21558_24476 912
116 iso_pu_bacteria 2739367664 2739652083 912
117 iso_pu_bacteria 2739367865 2740030557 912
118 3300025304 Ga0209257_1002515 Ga0209257_100251514 913
119 3300048914 Ga0496111_0005071 Ga0496111_0005071_4700_7681 913
120 3300048925 Ga0496122_0001697 Ga0496122_0001697_7619_10597 913
121 3300048926 Ga0496123_0001172 Ga0496123_0001172_23802_26780 913
122 iso_pu_bacteria 2738541275 2738709006 913
123 iso_pu_bacteria 2738541301 2738847431 913
124 iso_pu_bacteria 2738541304 2738863160 913
125 iso_pu_bacteria 2738543022 2739295678 913
126 iso_pu_bacteria 2738543033 2739357356 913
127 iso_pu_bacteria 2928100450 2928102225 913
128 iso_pu_bacteria 2928959182 2928962334 913
129 3300005344 Ga0070661_100000011 Ga0070661_100000011123 915
130 3300025920 Ga0207649_10000038 Ga0207649_1000003852 915
131 3300037466 Ga0395898_0046625 Ga0395898_0046625_223_3279 915
132 3300046519 Ga0495632_0000001 Ga0495632_0000001_756695_759541 915
133 3300046520 Ga0495637_0000390 Ga0495637_0000390_24816_27662 915
134 3300046522 Ga0495643_0000495 Ga0495643_0000495_24822_27668 915
135 3300046525 Ga0495663_0000001 Ga0495663_0000001_113755_116601 915
136 3300046558 Ga0495633_0001391 Ga0495633_0001391_7119_9965 915
137 3300046692 Ga0495671_0000217 Ga0495671_0000217_22015_24861 915
138 3300047470 Ga0495681_0000346 Ga0495681_0000346_11623_14469 915
139 3300049679 Ga0501249_000039 Ga0501249_000039_36458_39319 915
140 3300053730 Ga0500645_000038 Ga0500645_000038_41017_43992 915
141 3300005548 Ga0070665_100000129 Ga0070665_100000129132 916
142 3300009545 Ga0105237_10004370 Ga0105237_100043702 916
143 3300025914 Ga0207671_10009273 Ga0207671_100092732 916
144 3300028379 Ga0268266_10000019 Ga0268266_10000019364 916
145 3300047443 Ga0495687_000043 Ga0495687_000043_72881_75856 916
146 3300048926 Ga0496123_0015275 Ga0496123_0015275_1167_4067 916
147 3300048927 Ga0496124_0001414 Ga0496124_0001414_21676_24576 916
148 3300048927 Ga0496124_0019251 Ga0496124_0019251_1947_4847 916
149 3300053104 Ga0500556_0000055 Ga0500556_0000055_66183_69080 916
150 iso_pu_bacteria 2599185359 2600226561 916
151 iso_pu_bacteria 2643221622 2644126243 916
152 iso_pu_bacteria 2818991466 2819713393 916
153 iso_pu_bacteria 2928526807 2928527976 916
154 iso_pu_bacteria 2928968154 2928971805 916
155 3300025304 Ga0209257_1006428 Ga0209257_10064284 917
156 3300046558 Ga0495633_0000095 Ga0495633_0000095_24739_27609 917
157 3300047472 Ga0495686_0001248 Ga0495686_0001248_24089_26977 917
158 iso_pu_bacteria 2510917021 2511126288 917
159 3300005530 Ga0070679_100000008 Ga0070679_10000000875 918
160 3300025921 Ga0207652_10000008 Ga0207652_10000008219 918
161 3300046520 Ga0495637_0007397 Ga0495637_0007397_1221_4196 918
162 3300046660 Ga0495625_0001605 Ga0495625_0001605_18267_21242 918
163 3300046684 Ga0495669_0000047 Ga0495669_0000047_63513_66488 918
164 3300049586 Ga0501070_0047341 Ga0501070_0047341_45_2930 918
165 3300053079 Ga0500610_0000104 Ga0500610_0000104_7382_10357 918
166 iso_pu_bacteria 8057101203 8057103832 918
167 3300006042 Ga0075368_10000253 Ga0075368_1000025312 919
168 3300006178 Ga0075367_10003012 Ga0075367_100030121 919
169 3300027866 Ga0209813_10000091 Ga0209813_1000009127 919
170 3300046460 Ga0495638_0000305 Ga0495638_0000305_55464_58391 919
171 3300046506 Ga0495583_0000710 Ga0495583_0000710_31818_34745 919
172 3300046519 Ga0495632_0002377 Ga0495632_0002377_8534_11461 919
173 3300046524 Ga0495648_0000235 Ga0495648_0000235_5079_8006 919
174 3300046692 Ga0495671_0000020 Ga0495671_0000020_260087_263014 919
175 3300047469 Ga0495673_0000316 Ga0495673_0000316_5293_8220 919
176 3300050494 nmdc:mga06z11_1392_c1 nmdc:mga06z11_1392_c1_4092_6974 919
177 3300050495 nmdc:mga04h51_562_c1 nmdc:mga04h51_562_c1_4092_6974 919
178 3300025263 Ga0209565_1000054 Ga0209565_100005434 920
179 3300025273 Ga0209673_1006997 Ga0209673_10069974 920
180 3300046522 Ga0495643_0001957 Ga0495643_0001957_5395_8364 920
181 iso_pu_bacteria 2830075706 2830077001 920
182 3300025904 Ga0207647_10000375 Ga0207647_1000037523 921
183 iso_pu_bacteria 2512564014 2512645276 923
184 3300014326 Ga0157380_10012987 Ga0157380_100129872 924
185 3300046525 Ga0495663_0000917 Ga0495663_0000917_1881_4856 924
186 3300053130 Ga0500642_0000008 Ga0500642_0000008_142619_145564 924
187 3300053130 Ga0500642_0000342 Ga0500642_0000342_10584_13559 924
188 3300025298 Ga0209050_1008877 Ga0209050_10088773 925
189 3300046691 Ga0495670_0000002 Ga0495670_0000002_345054_348143 926
190 3300003791 Ga0055530_10007861 Ga0055530_100078611 934
191 3300003792 Ga0055540_1000624 Ga0055540_100062411 934
192 3300003794 Ga0055531_10011140 Ga0055531_100111401 934
193 3300025292 Ga0209676_1003861 Ga0209676_10038613 934
194 3300025298 Ga0209050_1000001 Ga0209050_10000012243 934
195 3300025303 Ga0209051_1000951 Ga0209051_100095129 934
196 3300025304 Ga0209257_1000857 Ga0209257_100085724 934
197 iso_pu_bacteria 2946787523 2946788500 935
198 3300002774 JGI25150J39212_1000082 JGI25150J39212_10000827 943
199 3300003215 JGI25153J46596_10000029 JGI25153J46596_10000029102 943
200 3300025245 Ga0207425_1000020 Ga0207425_100002030 943
201 3300025258 Ga0209129_1003233 Ga0209129_10032333 943
202 3300025292 Ga0209676_1001318 Ga0209676_10013188 943
203 3300025294 Ga0209025_1000383 Ga0209025_100038338 943
204 3300025297 Ga0209758_1000004 Ga0209758_1000004294 943
205 3300025304 Ga0209257_1000785 Ga0209257_10007859 943

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07715

Plug

TonB-dependent Receptor Plug Domain

131

243

0.9

PF14905

OMP_b-brl_3

Outer membrane protein beta-barrel family

643

1026

0.7

PF00593

TonB_dep_Rec_b-barrel

TonB dependent receptor-like, beta-barrel

490

995

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fp2-assembly2.cif.gz_B crystal structure of the siderophore receptor pira from pseudomonas aeruginosa 0.7205 80 943
6z8u-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7201 95 943
6z8q-assembly1.cif.gz_A copper transporter oprc 0.7186 95 943
6z8r-assembly2.cif.gz_B copper transporter oprc 0.7162 95 943
6fom-assembly1.cif.gz_A copper transporter oprc 0.7151 95 943
ID Description Score Start End Superfamily
2hdiA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.6804 197 943 2.40.170.20
2hdiA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.6778 197 943 2.40.170.20
3efmA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.6703 199 943 2.40.170.20
3efmA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.6635 199 943 2.40.170.20
1xkwA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.6617 193 943 2.40.170.20
ID Description Score Start End GO Terms
AF-A0A162B6U6-F1-model_v4 TonB-dependent receptor 0.8131 55 943 GO:0009279
AF-A0A7W7B1Q6-F1-model_v4 TonB-dependent receptor 0.8006 49 943 GO:0009279
GO:0030246
AF-A0A2N3AUY8-F1-model_v4 TonB-dependent receptor 0.7939 119 672 GO:0009279
AF-A0A502G241-F1-model_v4 TonB-dependent receptor 0.7938 53 943 GO:0009279
AF-A0A2N8FP07-F1-model_v4 deleted 0.793 267 401

Feature Viewer

pLDDT pTM Quality
75.01 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map