F313910

General Info

Members Datasets Scaffolds Average Seq Length
205 103 410 121

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_11085511|Ga0207699_110855111
Length 146
Sequence MTALIINNNCFLWRADQSCTCMASERKKKMVAVIEDDEAYRVAVQRLVKSAGFSVQSFASAEDFLSSGRQRETGCLITDIRMPGMSGLDLQSKLNSDHCPIPTIFITAHSDEKMRLQAMRGGAVKFLPKPFDGETLLEAVRVALEN

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
58 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
86 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
95 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
101 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
102 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
103 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 3.41
Rhizosphere 94.15
Stem 0
Stem Tuber 0
Unclassified 10.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_11085511 3300025906 Unclassified 592
2 rootL2_10191297 3300003322 Bacteria 5690
3 Ga0070658_10027520 3300005327 Bacteria 4561
4 Ga0070658_10102022 3300005327 Bacteria 2372
5 Ga0070680_100086561 3300005336 Bacteria 2590
6 Ga0070680_101106107 3300005336 Bacteria 685
7 Ga0070660_100051099 3300005339 Bacteria 3182
8 Ga0070709_10109082 3300005434 Bacteria 1857
9 Ga0070709_10114624 3300005434 Bacteria 1817
10 Ga0070709_10145906 3300005434 Bacteria 1630
11 Ga0070709_10379278 3300005434 Bacteria 1051
12 Ga0070709_11316363 3300005434 Unclassified 583
13 Ga0070714_100814566 3300005435 Bacteria 905
14 Ga0070714_102449367 3300005435 Bacteria 507
15 Ga0070713_101976308 3300005436 Bacteria 566
16 Ga0070710_10019580 3300005437 Bacteria 3499
17 Ga0070710_10067331 3300005437 Bacteria 2055
18 Ga0070710_10409251 3300005437 Unclassified 911
19 Ga0070711_100054246 3300005439 Bacteria 2765
20 Ga0070711_100665783 3300005439 Bacteria 874
21 Ga0070708_100003071 3300005445 Bacteria 12976
22 Ga0070708_100010768 3300005445 Bacteria 7423
23 Ga0070708_100085345 3300005445 Bacteria 2865
24 Ga0070681_10066106 3300005458 Bacteria 3584
25 Ga0070681_10824375 3300005458 Bacteria 845
26 Ga0070706_100028880 3300005467 Bacteria 5108
27 Ga0070706_100053131 3300005467 Bacteria 3739
28 Ga0070706_100122206 3300005467 Bacteria 2427
29 Ga0070706_100240549 3300005467 Bacteria 1690
30 Ga0070706_101474726 3300005467 Unclassified 622
31 Ga0070706_101601696 3300005467 Unclassified 594
32 Ga0070707_100005353 3300005468 Bacteria 12015
33 Ga0070707_100070105 3300005468 Bacteria 3376
34 Ga0070707_100575116 3300005468 Bacteria 1089
35 Ga0070707_101038279 3300005468 Bacteria 785
36 Ga0070707_101890393 3300005468 Unclassified 564
37 Ga0070698_100120456 3300005471 Bacteria 2584
38 Ga0070698_100120650 3300005471 Bacteria 2582
39 Ga0070698_100153568 3300005471 Bacteria 2248
40 Ga0070699_100005458 3300005518 Bacteria 11146
41 Ga0070699_100006685 3300005518 Bacteria 10030
42 Ga0070699_100213215 3300005518 Bacteria 1720
43 Ga0070699_100215871 3300005518 Bacteria 1709
44 Ga0070699_100530995 3300005518 Bacteria 1070
45 Ga0070697_100004863 3300005536 Bacteria 10305
46 Ga0070697_100019488 3300005536 Bacteria 5359
47 Ga0070697_100040315 3300005536 Bacteria 3777
48 Ga0070697_100918690 3300005536 Bacteria 777
49 Ga0070665_100891710 3300005548 Bacteria 902
50 Ga0068855_100019386 3300005563 Bacteria 8172
51 Ga0068857_100599116 3300005577 Bacteria 1041
52 Ga0068856_100167689 3300005614 Bacteria 2207
53 Ga0068852_100073665 3300005616 Bacteria 3005
54 Ga0068861_100053567 3300005719 Bacteria 3070
55 Ga0068858_101841753 3300005842 Unclassified 598
56 Ga0081455_10020958 3300005937 Bacteria 6142
57 Ga0081540_1015445 3300005983 Bacteria 4836
58 Ga0070717_10038108 3300006028 Bacteria 3906
59 Ga0070717_10388733 3300006028 Bacteria 1252
60 Ga0070717_10587873 3300006028 Bacteria 1010
61 Ga0070717_11816327 3300006028 Unclassified 551
62 Ga0070715_10021373 3300006163 Bacteria 2509
63 Ga0070715_10185206 3300006163 Bacteria 1047
64 Ga0070715_10205953 3300006163 Bacteria 1002
65 Ga0070715_10213084 3300006163 Bacteria 988
66 Ga0070716_100055176 3300006173 Bacteria 2273
67 Ga0070716_100069893 3300006173 Bacteria 2059
68 Ga0070716_100079695 3300006173 Bacteria 1951
69 Ga0070716_100207940 3300006173 Bacteria 1306
70 Ga0070716_100228085 3300006173 Bacteria 1255
71 Ga0070716_100814837 3300006173 Bacteria 724
72 Ga0070712_100029598 3300006175 Bacteria 3672
73 Ga0070712_100129387 3300006175 Bacteria 1911
74 Ga0070712_100140305 3300006175 Bacteria 1843
75 Ga0070712_100193814 3300006175 Bacteria 1592
76 Ga0070712_100508203 3300006175 Bacteria 1011
77 Ga0075434_100001719 3300006871 Bacteria 18770
78 Ga0075434_102263257 3300006871 Bacteria 547
79 Ga0075436_100000418 3300006914 Bacteria 27188
80 Ga0075436_100027433 3300006914 Bacteria 3919
81 Ga0075435_100000117 3300007076 Bacteria 44257
82 Ga0099795_10009905 3300007788 Bacteria 2783
83 Ga0105240_10000002 3300009093 Bacteria 1924170
84 Ga0105240_10018039 3300009093 Bacteria 9491
85 Ga0105245_10216680 3300009098 Bacteria 1845
86 Ga0105245_12605501 3300009098 Bacteria 559
87 Ga0105247_10101947 3300009101 Bacteria 1836
88 Ga0105247_10910942 3300009101 Bacteria 680
89 Ga0114129_10392616 3300009147 Bacteria 1830
90 Ga0105243_10457220 3300009148 Bacteria 1199
91 Ga0105241_10000055 3300009174 Bacteria 86842
92 Ga0105241_10017346 3300009174 Bacteria 5289
93 Ga0105242_10574037 3300009176 Bacteria 1085
94 Ga0105238_10042848 3300009551 Bacteria 4582
95 Ga0105238_10245288 3300009551 Bacteria 1769
96 Ga0105238_10358069 3300009551 Bacteria 1448
97 Ga0105249_10046177 3300009553 Bacteria 3964
98 Ga0105249_10879214 3300009553 Bacteria 962
99 Ga0099796_10062583 3300010159 Bacteria 1323
100 Ga0105239_10667170 3300010375 Bacteria 1188
101 Ga0105239_12018592 3300010375 Unclassified 670
102 Ga0157371_10471915 3300013102 Bacteria 924
103 Ga0157370_10011781 3300013104 Bacteria 9126
104 Ga0157370_11955852 3300013104 Bacteria 526
105 Ga0157369_10023790 3300013105 Bacteria 6821
106 Ga0157369_10029789 3300013105 Bacteria 6028
107 Ga0157369_11960320 3300013105 Unclassified 594
108 Ga0157374_10034934 3300013296 Bacteria 4596
109 Ga0157378_10089652 3300013297 Bacteria 2794
110 Ga0157378_10551704 3300013297 Bacteria 1158
111 Ga0163162_10780940 3300013306 Bacteria 1073
112 Ga0157372_10008330 3300013307 Bacteria 11025
113 Ga0157375_10010723 3300013308 Bacteria 8074
114 Ga0157375_12349826 3300013308 Unclassified 636
115 Ga0163163_10026311 3300014325 Bacteria 5560
116 Ga0163163_10057045 3300014325 Bacteria 3861
117 Ga0157379_10000352 3300014968 Bacteria 36938
118 Ga0157379_10013895 3300014968 Bacteria 7057
119 Ga0157379_10236519 3300014968 Bacteria 1656
120 Ga0157376_10898997 3300014969 Bacteria 903
121 Ga0213874_10025537 3300021377 Bacteria 1667
122 Ga0228598_1066899 3300024227 Unclassified 717
123 Ga0207692_10015406 3300025898 Bacteria 3363
124 Ga0207692_10278808 3300025898 Unclassified 1011
125 Ga0207710_10462984 3300025900 Unclassified 655
126 Ga0207685_10006184 3300025905 Bacteria 3237
127 Ga0207685_10018908 3300025905 Bacteria 2259
128 Ga0207685_10104520 3300025905 Bacteria 1217
129 Ga0207685_10398220 3300025905 Unclassified 705
130 Ga0207699_10095546 3300025906 Bacteria 1874
131 Ga0207699_10165124 3300025906 Bacteria 1477
132 Ga0207699_10235574 3300025906 Bacteria 1255
133 Ga0207705_10229638 3300025909 Bacteria 1411
134 Ga0207684_10000307 3300025910 Bacteria 69402
135 Ga0207684_10000963 3300025910 Bacteria 32275
136 Ga0207684_10095186 3300025910 Bacteria 2541
137 Ga0207684_10226669 3300025910 Bacteria 1613
138 Ga0207654_10000034 3300025911 Bacteria 113041
139 Ga0207654_10239746 3300025911 Bacteria 1211
140 Ga0207707_10104232 3300025912 Bacteria 2479
141 Ga0207695_10000002 3300025913 Bacteria 2188391
142 Ga0207695_10071055 3300025913 Unclassified 3555
143 Ga0207693_10004706 3300025915 Bacteria 11482
144 Ga0207693_10045663 3300025915 Bacteria 3442
145 Ga0207693_10194501 3300025915 Bacteria 1596
146 Ga0207693_10508957 3300025915 Bacteria 940
147 Ga0207693_10925819 3300025915 Unclassified 668
148 Ga0207663_10005688 3300025916 Bacteria 6305
149 Ga0207663_10455353 3300025916 Unclassified 987
150 Ga0207663_10726794 3300025916 Bacteria 787
151 Ga0207660_10066458 3300025917 Bacteria 2609
152 Ga0207657_10068956 3300025919 Bacteria 3003
153 Ga0207646_10001522 3300025922 Bacteria 28372
154 Ga0207646_10006410 3300025922 Bacteria 12167
155 Ga0207646_10108306 3300025922 Bacteria 2493
156 Ga0207694_10018185 3300025924 Bacteria 5314
157 Ga0207694_10272205 3300025924 Bacteria 1389
158 Ga0207694_10873571 3300025924 Unclassified 760
159 Ga0207687_10192283 3300025927 Bacteria 1589
160 Ga0207700_10273504 3300025928 Bacteria 1450
161 Ga0207664_10032969 3300025929 Bacteria 3975
162 Ga0207664_10616579 3300025929 Bacteria 975
163 Ga0207664_11073941 3300025929 Bacteria 720
164 Ga0207686_10266197 3300025934 Bacteria 1259
165 Ga0207665_10034150 3300025939 Bacteria 3375
166 Ga0207665_10041933 3300025939 Bacteria 3058
167 Ga0207665_10057926 3300025939 Bacteria 2618
168 Ga0207665_10083575 3300025939 Bacteria 2202
169 Ga0207665_10083591 3300025939 Bacteria 2202
170 Ga0207665_10097966 3300025939 Bacteria 2042
171 Ga0207665_10278068 3300025939 Bacteria 1245
172 Ga0207665_10316476 3300025939 Bacteria 1170
173 Ga0207665_10677827 3300025939 Bacteria 809
174 Ga0207665_10747483 3300025939 Bacteria 771
175 Ga0207665_10806901 3300025939 Bacteria 742
176 Ga0207667_10002313 3300025949 Bacteria 23883
177 Ga0207712_10058790 3300025961 Bacteria 2718
178 Ga0207668_10847306 3300025972 Bacteria 811
179 Ga0207674_10436235 3300026116 Bacteria 1266
180 Ga0207675_100003683 3300026118 Bacteria 14936
181 Ga0207698_10208784 3300026142 Bacteria 1755
182 Ga0209179_1000726 3300027512 Bacteria 3572
183 Ga0265338_10012775 3300028800 Bacteria 9551
184 Ga0265760_10009642 3300031090 Unclassified 2758
185 Ga0307510_10038482 3300033180 Bacteria 5289
186 Ga0436363_1288436 3300039450 Bacteria 14211
187 Ga0466967_0260940 3300045976 Bacteria 1658
188 Ga0495592_0002028 3300046454 Bacteria 14263
189 Ga0495599_0238875 3300046678 Bacteria 1108
190 Ga0495674_0490294 3300047319 Bacteria 984
191 Ga0496102_0000450 3300048905 Bacteria 46831
192 Ga0496102_0195971 3300048905 Bacteria 1903
193 Ga0496103_0003764 3300048906 Bacteria 9220
194 Ga0496104_0038094 3300048907 Bacteria 4497
195 Ga0496107_0041456 3300048910 Bacteria 3305
196 Ga0496107_0476372 3300048910 Unclassified 926
197 Ga0496112_0053518 3300048915 Bacteria 3965
198 nmdc:mga05p37_996024_c1 3300050507 Bacteria 891
199 nmdc:mga0n895_137_c1 3300050512 Bacteria 43956
200 nmdc:mga0n895_1572956_c1 3300050512 Unclassified 622
201 nmdc:mga0n895_2009128_c1 3300050512 Bacteria 536
202 nmdc:mga0rr50_1517363_c1 3300050513 Bacteria 566
203 nmdc:mga08x19_27832_c1 3300050514 Bacteria 3537
204 Ga0495619_0859152 3300053085 Bacteria 612
205 Ga0500646_0123675 3300053090 Bacteria 834
206 Ga0207699_11085511
207 rootL2_10191297
208 Ga0070658_10027520
209 Ga0070658_10102022
210 Ga0070680_100086561
211 Ga0070680_101106107
212 Ga0070660_100051099
213 Ga0070709_10109082
214 Ga0070709_10114624
215 Ga0070709_10145906
216 Ga0070709_10379278
217 Ga0070709_11316363
218 Ga0070714_100814566
219 Ga0070714_102449367
220 Ga0070713_101976308
221 Ga0070710_10019580
222 Ga0070710_10067331
223 Ga0070710_10409251
224 Ga0070711_100054246
225 Ga0070711_100665783
226 Ga0070708_100003071
227 Ga0070708_100010768
228 Ga0070708_100085345
229 Ga0070681_10066106
230 Ga0070681_10824375
231 Ga0070706_100028880
232 Ga0070706_100053131
233 Ga0070706_100122206
234 Ga0070706_100240549
235 Ga0070706_101474726
236 Ga0070706_101601696
237 Ga0070707_100005353
238 Ga0070707_100070105
239 Ga0070707_100575116
240 Ga0070707_101038279
241 Ga0070707_101890393
242 Ga0070698_100120456
243 Ga0070698_100120650
244 Ga0070698_100153568
245 Ga0070699_100005458
246 Ga0070699_100006685
247 Ga0070699_100213215
248 Ga0070699_100215871
249 Ga0070699_100530995
250 Ga0070697_100004863
251 Ga0070697_100019488
252 Ga0070697_100040315
253 Ga0070697_100918690
254 Ga0070665_100891710
255 Ga0068855_100019386
256 Ga0068857_100599116
257 Ga0068856_100167689
258 Ga0068852_100073665
259 Ga0068861_100053567
260 Ga0068858_101841753
261 Ga0081455_10020958
262 Ga0081540_1015445
263 Ga0070717_10038108
264 Ga0070717_10388733
265 Ga0070717_10587873
266 Ga0070717_11816327
267 Ga0070715_10021373
268 Ga0070715_10185206
269 Ga0070715_10205953
270 Ga0070715_10213084
271 Ga0070716_100055176
272 Ga0070716_100069893
273 Ga0070716_100079695
274 Ga0070716_100207940
275 Ga0070716_100228085
276 Ga0070716_100814837
277 Ga0070712_100029598
278 Ga0070712_100129387
279 Ga0070712_100140305
280 Ga0070712_100193814
281 Ga0070712_100508203
282 Ga0075434_100001719
283 Ga0075434_102263257
284 Ga0075436_100000418
285 Ga0075436_100027433
286 Ga0075435_100000117
287 Ga0099795_10009905
288 Ga0105240_10000002
289 Ga0105240_10018039
290 Ga0105245_10216680
291 Ga0105245_12605501
292 Ga0105247_10101947
293 Ga0105247_10910942
294 Ga0114129_10392616
295 Ga0105243_10457220
296 Ga0105241_10000055
297 Ga0105241_10017346
298 Ga0105242_10574037
299 Ga0105238_10042848
300 Ga0105238_10245288
301 Ga0105238_10358069
302 Ga0105249_10046177
303 Ga0105249_10879214
304 Ga0099796_10062583
305 Ga0105239_10667170
306 Ga0105239_12018592
307 Ga0157371_10471915
308 Ga0157370_10011781
309 Ga0157370_11955852
310 Ga0157369_10023790
311 Ga0157369_10029789
312 Ga0157369_11960320
313 Ga0157374_10034934
314 Ga0157378_10089652
315 Ga0157378_10551704
316 Ga0163162_10780940
317 Ga0157372_10008330
318 Ga0157375_10010723
319 Ga0157375_12349826
320 Ga0163163_10026311
321 Ga0163163_10057045
322 Ga0157379_10000352
323 Ga0157379_10013895
324 Ga0157379_10236519
325 Ga0157376_10898997
326 Ga0213874_10025537
327 Ga0228598_1066899
328 Ga0207692_10015406
329 Ga0207692_10278808
330 Ga0207710_10462984
331 Ga0207685_10006184
332 Ga0207685_10018908
333 Ga0207685_10104520
334 Ga0207685_10398220
335 Ga0207699_10095546
336 Ga0207699_10165124
337 Ga0207699_10235574
338 Ga0207705_10229638
339 Ga0207684_10000307
340 Ga0207684_10000963
341 Ga0207684_10095186
342 Ga0207684_10226669
343 Ga0207654_10000034
344 Ga0207654_10239746
345 Ga0207707_10104232
346 Ga0207695_10000002
347 Ga0207695_10071055
348 Ga0207693_10004706
349 Ga0207693_10045663
350 Ga0207693_10194501
351 Ga0207693_10508957
352 Ga0207693_10925819
353 Ga0207663_10005688
354 Ga0207663_10455353
355 Ga0207663_10726794
356 Ga0207660_10066458
357 Ga0207657_10068956
358 Ga0207646_10001522
359 Ga0207646_10006410
360 Ga0207646_10108306
361 Ga0207694_10018185
362 Ga0207694_10272205
363 Ga0207694_10873571
364 Ga0207687_10192283
365 Ga0207700_10273504
366 Ga0207664_10032969
367 Ga0207664_10616579
368 Ga0207664_11073941
369 Ga0207686_10266197
370 Ga0207665_10034150
371 Ga0207665_10041933
372 Ga0207665_10057926
373 Ga0207665_10083575
374 Ga0207665_10083591
375 Ga0207665_10097966
376 Ga0207665_10278068
377 Ga0207665_10316476
378 Ga0207665_10677827
379 Ga0207665_10747483
380 Ga0207665_10806901
381 Ga0207667_10002313
382 Ga0207712_10058790
383 Ga0207668_10847306
384 Ga0207674_10436235
385 Ga0207675_100003683
386 Ga0207698_10208784
387 Ga0209179_1000726
388 Ga0265338_10012775
389 Ga0265760_10009642
390 Ga0307510_10038482
391 Ga0436363_1288436
392 Ga0466967_0260940
393 Ga0495592_0002028
394 Ga0495599_0238875
395 Ga0495674_0490294
396 Ga0496102_0000450
397 Ga0496102_0195971
398 Ga0496103_0003764
399 Ga0496104_0038094
400 Ga0496107_0041456
401 Ga0496107_0476372
402 Ga0496112_0053518
403 nmdc:mga05p37_996024_c1
404 nmdc:mga0n895_137_c1
405 nmdc:mga0n895_1572956_c1
406 nmdc:mga0n895_2009128_c1
407 nmdc:mga0rr50_1517363_c1
408 nmdc:mga08x19_27832_c1
409 Ga0495619_0859152
410 Ga0500646_0123675

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

31

141

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pl1-assembly1.cif.gz_A berrylium fluoride activated receiver domain of e.coli phop 0.9275 7 123
3w9s-assembly1.cif.gz_B crystal structure analysis of the n-terminal receiver domain of response regulator pmra 0.9266 8 123
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9247 6 125
3nnn-assembly1.cif.gz_B bef3 activated drrd receiver domain 0.9245 5 123
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9243 6 125
ID Description Score Start End Superfamily
af_Q2G2G2_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9561 6 85 3.40.50.2300
af_P0AFU4_2_125_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9477 5 123 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9455 4 82 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9406 6 85 3.40.50.2300
af_P0AA16_3_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9394 5 85 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7R7Y367-F1-model_v4 deleted 0.9886 3 123
AF-A0A5B8G2S3-F1-model_v4 Response regulator transcription factor 0.9864 5 125 GO:0000160
GO:0006355
AF-A0A7W5MDP2-F1-model_v4 deleted 0.9851 1 123
AF-A0A849K0B6-F1-model_v4 Response regulator 0.9847 5 122 GO:0000160
AF-A0A0H1RAK0-F1-model_v4 Response regulatory domain-containing protein 0.9827 3 123 GO:0000160

Map