F313371

General Info

Members Datasets Scaffolds Average Seq Length
205 130 410 114

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_11595420|Ga0070676_115954201
Length 122
Sequence MPRHPENPRNDAELLQGTLDLLILKVTALGPIHGYAIVQRIQQISRDALQIRQGSLYPALYRLENKGWLTAEWKTTEGGRQAKYYSLTQSGRKQLEAETAGWKRLCEAISLVLETAEEGAGI

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
49 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
81 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
82 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
83 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
84 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
85 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
86 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
100 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
110 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
116 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
117 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
118 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
121 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
122 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
123 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
127 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
128 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.51
Metatranscriptomes 0.49
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.95
Nodule 0
Rhizoplane 0.98
Rhizosphere 90.24
Stem 0
Stem Tuber 0
Unclassified 26.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_11595420 3300005328 Unclassified 504
2 Ga0070666_10506598 3300005335 Unclassified 875
3 Ga0068868_100945882 3300005338 Bacteria 785
4 Ga0070661_100940131 3300005344 Bacteria 715
5 Ga0070675_100662937 3300005354 Bacteria 949
6 Ga0070673_101057826 3300005364 Unclassified 757
7 Ga0070667_100924051 3300005367 Bacteria 813
8 Ga0070667_102179293 3300005367 Unclassified 522
9 Ga0070714_100053053 3300005435 Bacteria 3459
10 Ga0070714_100152404 3300005435 Bacteria 2084
11 Ga0070713_100050834 3300005436 Bacteria 3426
12 Ga0070713_100406094 3300005436 Bacteria 1273
13 Ga0070713_100967184 3300005436 Bacteria 820
14 Ga0070713_101338226 3300005436 Bacteria 694
15 Ga0070711_101753857 3300005439 Bacteria 544
16 Ga0070681_10128688 3300005458 Bacteria 2465
17 Ga0070706_100686905 3300005467 Bacteria 950
18 Ga0070679_100013150 3300005530 Bacteria 7925
19 Ga0070697_100924490 3300005536 Unclassified 774
20 Ga0070695_100432660 3300005545 Bacteria 1004
21 Ga0070665_100242468 3300005548 Bacteria 1803
22 Ga0068855_100016416 3300005563 Bacteria 8902
23 Ga0068855_100032314 3300005563 Bacteria 6250
24 Ga0068855_100364733 3300005563 Bacteria 1589
25 Ga0068856_100025072 3300005614 Bacteria 5811
26 Ga0068856_100842736 3300005614 Bacteria 936
27 Ga0068860_100419303 3300005843 Bacteria 1326
28 Ga0068862_101112478 3300005844 Unclassified 785
29 Ga0081455_10066573 3300005937 Bacteria 3008
30 Ga0070717_10044068 3300006028 Bacteria 3643
31 Ga0070717_11071627 3300006028 Bacteria 734
32 Ga0075367_10088782 3300006178 Unclassified 1879
33 Ga0075366_10634399 3300006195 Bacteria 663
34 Ga0097621_100706736 3300006237 Unclassified 928
35 Ga0097621_101774192 3300006237 Bacteria 588
36 Ga0068871_101198269 3300006358 Bacteria 712
37 Ga0075428_100000161 3300006844 Bacteria 61275
38 Ga0075434_100000188 3300006871 Bacteria 40703
39 Ga0075434_100054354 3300006871 Bacteria 3978
40 Ga0075434_101881009 3300006871 Unclassified 605
41 Ga0075436_100020356 3300006914 Bacteria 4554
42 Ga0075436_100034229 3300006914 Bacteria 3503
43 Ga0075436_100204610 3300006914 Bacteria 1398
44 Ga0075436_100301518 3300006914 Unclassified 1148
45 Ga0075435_100000002 3300007076 Bacteria 140391
46 Ga0075435_100045110 3300007076 Bacteria 3532
47 Ga0075435_100578934 3300007076 Bacteria 973
48 Ga0075435_101722065 3300007076 Bacteria 550
49 Ga0075435_101829332 3300007076 Bacteria 533
50 Ga0105240_10094261 3300009093 Bacteria 3652
51 Ga0105240_10274151 3300009093 Bacteria 1941
52 Ga0105240_10739256 3300009093 Unclassified 1070
53 Ga0111539_10002460 3300009094 Bacteria 24604
54 Ga0114129_10250317 3300009147 Bacteria 2379
55 Ga0114129_11398389 3300009147 Unclassified 863
56 Ga0114129_12263829 3300009147 Bacteria 653
57 Ga0114129_12467688 3300009147 Bacteria 622
58 Ga0105243_10048095 3300009148 Unclassified 3361
59 Ga0105237_10638067 3300009545 Bacteria 1072
60 Ga0105237_11386824 3300009545 Unclassified 709
61 Ga0105238_10127510 3300009551 Bacteria 2523
62 Ga0105238_11177937 3300009551 Unclassified 790
63 Ga0105249_10187260 3300009553 Bacteria 2017
64 Ga0105249_11474582 3300009553 Unclassified 752
65 Ga0105239_10069523 3300010375 Bacteria 3869
66 Ga0157370_11608027 3300013104 Bacteria 584
67 Ga0157369_10002213 3300013105 Bacteria 23417
68 Ga0157369_10020746 3300013105 Bacteria 7345
69 Ga0157369_10260684 3300013105 Bacteria 1808
70 Ga0157369_10303698 3300013105 Bacteria 1660
71 Ga0157369_10848495 3300013105 Bacteria 938
72 Ga0157374_10580419 3300013296 Bacteria 1130
73 Ga0157378_11266408 3300013297 Bacteria 778
74 Ga0157378_12637667 3300013297 Unclassified 555
75 Ga0157372_10013277 3300013307 Bacteria 8791
76 Ga0157372_10061141 3300013307 Bacteria 4216
77 Ga0157372_11305158 3300013307 Bacteria 837
78 Ga0157376_10017195 3300014969 Bacteria 5510
79 Ga0157376_10162500 3300014969 Bacteria 2026
80 Ga0213874_10085197 3300021377 Bacteria 1030
81 Ga0213874_10206030 3300021377 Unclassified 709
82 Ga0213876_10289477 3300021384 Unclassified 870
83 Ga0213875_10113344 3300021388 Bacteria 1267
84 Ga0213875_10166571 3300021388 Bacteria 1034
85 Ga0224572_1011319 3300024225 Bacteria 1688
86 Ga0207653_10057558 3300025885 Bacteria 1305
87 Ga0207692_10402284 3300025898 Bacteria 854
88 Ga0207680_10766327 3300025903 Unclassified 692
89 Ga0207699_10183245 3300025906 Unclassified 1409
90 Ga0207699_10425540 3300025906 Unclassified 949
91 Ga0207695_10084654 3300025913 Bacteria 3201
92 Ga0207695_10323710 3300025913 Bacteria 1431
93 Ga0207671_10427946 3300025914 Bacteria 1053
94 Ga0207671_11111682 3300025914 Unclassified 620
95 Ga0207652_10043110 3300025921 Bacteria 3842
96 Ga0207646_10592852 3300025922 Bacteria 995
97 Ga0207694_10709880 3300025924 Unclassified 848
98 Ga0207659_10542820 3300025926 Bacteria 988
99 Ga0207700_10023283 3300025928 Unclassified 4267
100 Ga0207700_10591658 3300025928 Bacteria 987
101 Ga0207664_10097889 3300025929 Bacteria 2418
102 Ga0207711_11025363 3300025941 Unclassified 765
103 Ga0207689_10661038 3300025942 Bacteria 881
104 Ga0207667_10007949 3300025949 Bacteria 12658
105 Ga0207667_10430356 3300025949 Bacteria 1342
106 Ga0207667_10520056 3300025949 Bacteria 1205
107 Ga0207651_10492877 3300025960 Bacteria 1058
108 Ga0207712_10124322 3300025961 Bacteria 1956
109 Ga0207677_10586091 3300026023 Bacteria 977
110 Ga0207708_11959156 3300026075 Unclassified 513
111 Ga0207702_10237057 3300026078 Bacteria 1708
112 Ga0207702_10814771 3300026078 Bacteria 923
113 Ga0207641_10337871 3300026088 Bacteria 1432
114 Ga0207676_11565570 3300026095 Bacteria 657
115 Ga0207675_100468137 3300026118 Unclassified 1251
116 Ga0207428_10000039 3300027907 Bacteria 213218
117 Ga0268266_10355587 3300028379 Bacteria 1377
118 Ga0268266_10387844 3300028379 Bacteria 1319
119 Ga0268265_11062203 3300028380 Unclassified 802
120 Ga0265338_10032641 3300028800 Bacteria 5070
121 Ga0265338_10048957 3300028800 Bacteria 3837
122 Ga0265324_10009526 3300029957 Bacteria 3786
123 Ga0265770_1006240 3300030878 Bacteria 1655
124 Ga0265320_10022051 3300031240 Bacteria 3415
125 Ga0265316_10508609 3300031344 Bacteria 860
126 Ga0373926_0099451 3300035083 Bacteria 1087
127 Ga0373956_0151255 3300035119 Bacteria 1092
128 Ga0373955_0116429 3300035172 Unclassified 1550
129 Ga0373924_0300474 3300035410 Bacteria 713
130 Ga0373935_0033977 3300035692 Bacteria 3177
131 Ga0373927_0003177 3300035695 Bacteria 11850
132 Ga0373927_0003728 3300035695 Bacteria 10829
133 Ga0373927_0030512 3300035695 Bacteria 3517
134 Ga0373933_0660821 3300035724 Unclassified 687
135 Ga0373947_0824122 3300035725 Unclassified 633
136 Ga0373937_0038887 3300036401 Bacteria 4335
137 Ga0373937_0422219 3300036401 Bacteria 1266
138 Ga0373925_0119243 3300037068 Unclassified 2047
139 Ga0373925_0510232 3300037068 Bacteria 987
140 Ga0395898_1205122 3300037466 Bacteria 688
141 Ga0436364_0422362 3300037853 Bacteria 3844
142 Ga0436364_0484616 3300037853 Bacteria 1419
143 Ga0436364_0782884 3300037853 Bacteria 1114
144 Ga0436364_1084897 3300037853 Unclassified 597
145 Ga0436364_1463032 3300037853 Bacteria 1186
146 Ga0436363_0542376 3300039450 Bacteria 680
147 Ga0436363_0600677 3300039450 Bacteria 602
148 Ga0436363_1011044 3300039450 Bacteria 953
149 Ga0436363_1612791 3300039450 Unclassified 2704
150 Ga0436362_0688442 3300039453 Bacteria 987
151 Ga0436362_0711883 3300039453 Unclassified 789
152 Ga0436362_0961861 3300039453 Unclassified 1815
153 Ga0466961_0766232 3300044693 Unclassified 577
154 Ga0466963_0059250 3300044694 Bacteria 2555
155 Ga0466970_0634883 3300044765 Bacteria 621
156 Ga0466957_0350054 3300044842 Bacteria 1002
157 Ga0466959_0172953 3300045049 Bacteria 1514
158 Ga0451576_0132843 3300045051 Bacteria 2595
159 Ga0495653_0626105 3300046463 Unclassified 659
160 Ga0495580_0000640 3300046472 Bacteria 29681
161 Ga0495580_0051611 3300046472 Bacteria 2907
162 Ga0495580_0099480 3300046472 Unclassified 2023
163 Ga0495580_0282133 3300046472 Bacteria 1133
164 Ga0495664_0229048 3300046477 Bacteria 1125
165 Ga0495594_0203547 3300046499 Bacteria 1128
166 Ga0495630_0085883 3300046517 Bacteria 2376
167 Ga0495665_0023849 3300046531 Bacteria 3287
168 Ga0495645_0205332 3300046543 Bacteria 1333
169 Ga0495645_0381827 3300046543 Unclassified 901
170 Ga0495667_0419884 3300046559 Bacteria 842
171 Ga0495635_0277160 3300046663 Bacteria 1127
172 Ga0495657_0467164 3300046675 Unclassified 738
173 Ga0495599_0287635 3300046678 Bacteria 994
174 Ga0495646_0461704 3300046680 Unclassified 655
175 Ga0495624_0525874 3300046690 Unclassified 707
176 Ga0495624_0826455 3300046690 Bacteria 547
177 Ga0495674_0181999 3300047319 Unclassified 1750
178 Ga0495674_0477193 3300047319 Bacteria 1000
179 Ga0495676_0667219 3300047321 Bacteria 674
180 Ga0495684_0730016 3300047471 Unclassified 654
181 Ga0495602_0314252 3300048088 Bacteria 1142
182 Ga0495614_0159025 3300048089 Unclassified 1010
183 Ga0496107_0098121 3300048910 Bacteria 2146
184 Ga0496115_0068021 3300048918 Bacteria 2883
185 nmdc:mga06z11_631736_c1 3300050494 Bacteria 652
186 nmdc:mga04h51_68810_c1 3300050495 Bacteria 635
187 nmdc:mga05p37_2093180_c1 3300050507 Bacteria 531
188 nmdc:mga05p37_227311_c1 3300050507 Bacteria 2249
189 nmdc:mga09592_1587218_c1 3300050508 Unclassified 530
190 nmdc:mga06r32_81803_c1 3300050510 Unclassified 3145
191 nmdc:mga08y16_6_c1 3300050511 Bacteria 622294
192 nmdc:mga0n895_1561683_c1 3300050512 Unclassified 625
193 nmdc:mga0n895_165_c1 3300050512 Bacteria 40820
194 nmdc:mga0rr50_1004952_c1 3300050513 Bacteria 711
195 nmdc:mga0rr50_1229992_c1 3300050513 Bacteria 636
196 nmdc:mga0rr50_1478901_c1 3300050513 Unclassified 574
197 nmdc:mga0rr50_1506325_c1 3300050513 Bacteria 569
198 nmdc:mga0rr50_50_c1 3300050513 Bacteria 71098
199 nmdc:mga0rr50_839635_c1 3300050513 Bacteria 784
200 nmdc:mga08x19_1212_c1 3300050514 Bacteria 16055
201 nmdc:mga08x19_199920_c1 3300050514 Unclassified 1370
202 nmdc:mga08x19_321113_c1 3300050514 Bacteria 1078
203 nmdc:mga08x19_632_c1 3300050514 Bacteria 11335
204 Ga0495601_0316049 3300053077 Unclassified 1017
205 Ga0495619_0821998 3300053085 Unclassified 628
206 Ga0070676_11595420
207 Ga0070666_10506598
208 Ga0068868_100945882
209 Ga0070661_100940131
210 Ga0070675_100662937
211 Ga0070673_101057826
212 Ga0070667_100924051
213 Ga0070667_102179293
214 Ga0070714_100053053
215 Ga0070714_100152404
216 Ga0070713_100050834
217 Ga0070713_100406094
218 Ga0070713_100967184
219 Ga0070713_101338226
220 Ga0070711_101753857
221 Ga0070681_10128688
222 Ga0070706_100686905
223 Ga0070679_100013150
224 Ga0070697_100924490
225 Ga0070695_100432660
226 Ga0070665_100242468
227 Ga0068855_100016416
228 Ga0068855_100032314
229 Ga0068855_100364733
230 Ga0068856_100025072
231 Ga0068856_100842736
232 Ga0068860_100419303
233 Ga0068862_101112478
234 Ga0081455_10066573
235 Ga0070717_10044068
236 Ga0070717_11071627
237 Ga0075367_10088782
238 Ga0075366_10634399
239 Ga0097621_100706736
240 Ga0097621_101774192
241 Ga0068871_101198269
242 Ga0075428_100000161
243 Ga0075434_100000188
244 Ga0075434_100054354
245 Ga0075434_101881009
246 Ga0075436_100020356
247 Ga0075436_100034229
248 Ga0075436_100204610
249 Ga0075436_100301518
250 Ga0075435_100000002
251 Ga0075435_100045110
252 Ga0075435_100578934
253 Ga0075435_101722065
254 Ga0075435_101829332
255 Ga0105240_10094261
256 Ga0105240_10274151
257 Ga0105240_10739256
258 Ga0111539_10002460
259 Ga0114129_10250317
260 Ga0114129_11398389
261 Ga0114129_12263829
262 Ga0114129_12467688
263 Ga0105243_10048095
264 Ga0105237_10638067
265 Ga0105237_11386824
266 Ga0105238_10127510
267 Ga0105238_11177937
268 Ga0105249_10187260
269 Ga0105249_11474582
270 Ga0105239_10069523
271 Ga0157370_11608027
272 Ga0157369_10002213
273 Ga0157369_10020746
274 Ga0157369_10260684
275 Ga0157369_10303698
276 Ga0157369_10848495
277 Ga0157374_10580419
278 Ga0157378_11266408
279 Ga0157378_12637667
280 Ga0157372_10013277
281 Ga0157372_10061141
282 Ga0157372_11305158
283 Ga0157376_10017195
284 Ga0157376_10162500
285 Ga0213874_10085197
286 Ga0213874_10206030
287 Ga0213876_10289477
288 Ga0213875_10113344
289 Ga0213875_10166571
290 Ga0224572_1011319
291 Ga0207653_10057558
292 Ga0207692_10402284
293 Ga0207680_10766327
294 Ga0207699_10183245
295 Ga0207699_10425540
296 Ga0207695_10084654
297 Ga0207695_10323710
298 Ga0207671_10427946
299 Ga0207671_11111682
300 Ga0207652_10043110
301 Ga0207646_10592852
302 Ga0207694_10709880
303 Ga0207659_10542820
304 Ga0207700_10023283
305 Ga0207700_10591658
306 Ga0207664_10097889
307 Ga0207711_11025363
308 Ga0207689_10661038
309 Ga0207667_10007949
310 Ga0207667_10430356
311 Ga0207667_10520056
312 Ga0207651_10492877
313 Ga0207712_10124322
314 Ga0207677_10586091
315 Ga0207708_11959156
316 Ga0207702_10237057
317 Ga0207702_10814771
318 Ga0207641_10337871
319 Ga0207676_11565570
320 Ga0207675_100468137
321 Ga0207428_10000039
322 Ga0268266_10355587
323 Ga0268266_10387844
324 Ga0268265_11062203
325 Ga0265338_10032641
326 Ga0265338_10048957
327 Ga0265324_10009526
328 Ga0265770_1006240
329 Ga0265320_10022051
330 Ga0265316_10508609
331 Ga0373926_0099451
332 Ga0373956_0151255
333 Ga0373955_0116429
334 Ga0373924_0300474
335 Ga0373935_0033977
336 Ga0373927_0003177
337 Ga0373927_0003728
338 Ga0373927_0030512
339 Ga0373933_0660821
340 Ga0373947_0824122
341 Ga0373937_0038887
342 Ga0373937_0422219
343 Ga0373925_0119243
344 Ga0373925_0510232
345 Ga0395898_1205122
346 Ga0436364_0422362
347 Ga0436364_0484616
348 Ga0436364_0782884
349 Ga0436364_1084897
350 Ga0436364_1463032
351 Ga0436363_0542376
352 Ga0436363_0600677
353 Ga0436363_1011044
354 Ga0436363_1612791
355 Ga0436362_0688442
356 Ga0436362_0711883
357 Ga0436362_0961861
358 Ga0466961_0766232
359 Ga0466963_0059250
360 Ga0466970_0634883
361 Ga0466957_0350054
362 Ga0466959_0172953
363 Ga0451576_0132843
364 Ga0495653_0626105
365 Ga0495580_0000640
366 Ga0495580_0051611
367 Ga0495580_0099480
368 Ga0495580_0282133
369 Ga0495664_0229048
370 Ga0495594_0203547
371 Ga0495630_0085883
372 Ga0495665_0023849
373 Ga0495645_0205332
374 Ga0495645_0381827
375 Ga0495667_0419884
376 Ga0495635_0277160
377 Ga0495657_0467164
378 Ga0495599_0287635
379 Ga0495646_0461704
380 Ga0495624_0525874
381 Ga0495624_0826455
382 Ga0495674_0181999
383 Ga0495674_0477193
384 Ga0495676_0667219
385 Ga0495684_0730016
386 Ga0495602_0314252
387 Ga0495614_0159025
388 Ga0496107_0098121
389 Ga0496115_0068021
390 nmdc:mga06z11_631736_c1
391 nmdc:mga04h51_68810_c1
392 nmdc:mga05p37_2093180_c1
393 nmdc:mga05p37_227311_c1
394 nmdc:mga09592_1587218_c1
395 nmdc:mga06r32_81803_c1
396 nmdc:mga08y16_6_c1
397 nmdc:mga0n895_1561683_c1
398 nmdc:mga0n895_165_c1
399 nmdc:mga0rr50_1004952_c1
400 nmdc:mga0rr50_1229992_c1
401 nmdc:mga0rr50_1478901_c1
402 nmdc:mga0rr50_1506325_c1
403 nmdc:mga0rr50_50_c1
404 nmdc:mga0rr50_839635_c1
405 nmdc:mga08x19_1212_c1
406 nmdc:mga08x19_199920_c1
407 nmdc:mga08x19_321113_c1
408 nmdc:mga08x19_632_c1
409 Ga0495601_0316049
410 Ga0495619_0821998

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

23

97

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9365 15 114
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9349 16 110
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9275 16 110
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9265 13 110
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9179 13 114
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9275 16 110 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.925 15 114 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.92 16 109 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9197 16 109 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8855 19 99 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V9ELH6-F1-model_v4 PadR family transcriptional regulator 0.9822 13 113
AF-A0A2V7S1H0-F1-model_v4 PadR family transcriptional regulator 0.9821 13 113
AF-A0A1Q6Y065-F1-model_v4 PadR family transcriptional regulator 0.9817 15 114
AF-A0A143PW67-F1-model_v4 Lineage-specific thermal regulator protein 0.9798 16 113
AF-A0A537T4U9-F1-model_v4 PadR family transcriptional regulator 0.9788 12 115

Map