F313367

General Info

Members Datasets Scaffolds Average Seq Length
205 139 410 164

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10425538|Ga0070676_104255382
Length 164
Sequence MAKAKKAVPEGHHTVTPQLTLDNAARAIDWYKKALGAEEVSRAVGPDGKILHAEVRIGDSPIMLNDVMGGKGPGAFGGSPASLWVYVEDADALFNRAVAAGAKVHPGPMGRMADQFWGDRCGAFTDPEGYTWTIATRKEDLSPEEMKKRQEEWMKQFSQQQNRG

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
135 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
136 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
137 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
138 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 2.93
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.46
Rhizosphere 97.56
Stem 0
Stem Tuber 0
Unclassified 32.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10425538 3300005328 Unclassified 929
2 Ga0007429J51699_1038297 3300003579 Unclassified 596
3 Ga0058859_11741613 3300004798 Unclassified 608
4 Ga0058860_12218303 3300004801 Unclassified 611
5 Ga0065715_10023297 3300005293 Bacteria 1585
6 Ga0070658_10155728 3300005327 Unclassified 1916
7 Ga0070676_10423418 3300005328 Unclassified 931
8 Ga0070690_100281632 3300005330 Bacteria 1186
9 Ga0070670_100744103 3300005331 Bacteria 883
10 Ga0070677_10237367 3300005333 Bacteria 898
11 Ga0070680_100018125 3300005336 Bacteria 5562
12 Ga0070680_100039461 3300005336 Bacteria 3821
13 Ga0068868_101094730 3300005338 Bacteria 733
14 Ga0070660_100272201 3300005339 Unclassified 1384
15 Ga0070689_100765879 3300005340 Unclassified 847
16 Ga0070687_100334031 3300005343 Unclassified 972
17 Ga0070661_100060821 3300005344 Bacteria 2771
18 Ga0070661_100700681 3300005344 Unclassified 825
19 Ga0070661_101319494 3300005344 Unclassified 606
20 Ga0070668_100081543 3300005347 Bacteria 2536
21 Ga0070675_101084460 3300005354 Bacteria 736
22 Ga0070675_101711917 3300005354 Unclassified 580
23 Ga0070674_101181240 3300005356 Bacteria 679
24 Ga0070659_100280639 3300005366 Unclassified 1386
25 Ga0070667_100866856 3300005367 Bacteria 840
26 Ga0070709_10208925 3300005434 Bacteria 1387
27 Ga0070714_100040442 3300005435 Bacteria 3930
28 Ga0070710_10451833 3300005437 Unclassified 871
29 Ga0070711_100203467 3300005439 Bacteria 1529
30 Ga0070705_100207878 3300005440 Bacteria 1347
31 Ga0070705_100283255 3300005440 Bacteria 1179
32 Ga0070705_100419126 3300005440 Bacteria 996
33 Ga0070705_100828818 3300005440 Bacteria 738
34 Ga0070700_100236001 3300005441 Unclassified 1304
35 Ga0070694_100095835 3300005444 Bacteria 2090
36 Ga0070694_100890542 3300005444 Unclassified 734
37 Ga0070708_100088309 3300005445 Bacteria 2819
38 Ga0070708_100930870 3300005445 Bacteria 815
39 Ga0070663_100088358 3300005455 Bacteria 2292
40 Ga0070678_101376742 3300005456 Unclassified 658
41 Ga0070681_10012651 3300005458 Bacteria 8372
42 Ga0070681_10078186 3300005458 Bacteria 3265
43 Ga0070681_10657124 3300005458 Bacteria 963
44 Ga0068867_100702145 3300005459 Bacteria 893
45 Ga0068867_100711185 3300005459 Unclassified 887
46 Ga0068867_100860950 3300005459 Unclassified 813
47 Ga0070706_100009120 3300005467 Bacteria 9238
48 Ga0070707_100492900 3300005468 Bacteria 1187
49 Ga0070698_100099776 3300005471 Unclassified 2877
50 Ga0070698_100294745 3300005471 Bacteria 1553
51 Ga0070699_100684588 3300005518 Bacteria 936
52 Ga0070679_100000222 3300005530 Bacteria 46466
53 Ga0070697_100523868 3300005536 Unclassified 1038
54 Ga0068853_100080663 3300005539 Bacteria 2847
55 Ga0070672_100429949 3300005543 Bacteria 1135
56 Ga0070704_101313885 3300005549 Bacteria 662
57 Ga0068855_100414396 3300005563 Bacteria 1474
58 Ga0070664_100499462 3300005564 Bacteria 1121
59 Ga0070664_100884399 3300005564 Unclassified 837
60 Ga0068857_100327395 3300005577 Bacteria 1416
61 Ga0068854_100258688 3300005578 Bacteria 1393
62 Ga0068856_100417577 3300005614 Unclassified 1362
63 Ga0068856_100583729 3300005614 Unclassified 1139
64 Ga0070702_101183562 3300005615 Bacteria 615
65 Ga0068852_100221547 3300005616 Bacteria 1799
66 Ga0068852_101797361 3300005616 Unclassified 635
67 Ga0068859_100260004 3300005617 Bacteria 1827
68 Ga0068859_100277156 3300005617 Unclassified 1770
69 Ga0068859_100405780 3300005617 Bacteria 1459
70 Ga0068866_10405076 3300005718 Bacteria 881
71 Ga0068861_100368856 3300005719 Bacteria 1265
72 Ga0068860_101615251 3300005843 Bacteria 670
73 Ga0068862_100001853 3300005844 Bacteria 19160
74 Ga0068871_100267912 3300006358 Unclassified 1492
75 Ga0068871_100483789 3300006358 Bacteria 1114
76 Ga0075428_100019136 3300006844 Bacteria 7573
77 Ga0075428_100451485 3300006844 Bacteria 1377
78 Ga0075430_100001056 3300006846 Bacteria 21787
79 Ga0075431_100069735 3300006847 Bacteria 3627
80 Ga0075433_10118016 3300006852 Bacteria 2355
81 Ga0075433_10119875 3300006852 Unclassified 2335
82 Ga0075434_100000907 3300006871 Bacteria 23753
83 Ga0075434_100174228 3300006871 Bacteria 2171
84 Ga0075434_100392266 3300006871 Bacteria 1409
85 Ga0075429_100111843 3300006880 Bacteria 2387
86 Ga0068865_100452978 3300006881 Unclassified 1061
87 Ga0068865_100707108 3300006881 Unclassified 862
88 Ga0075436_100003345 3300006914 Bacteria 10982
89 Ga0075436_100350470 3300006914 Unclassified 1064
90 Ga0097620_100260019 3300006931 Bacteria 1827
91 Ga0097620_100277147 3300006931 Unclassified 1770
92 Ga0097620_100405818 3300006931 Bacteria 1459
93 Ga0075435_100000083 3300007076 Bacteria 49520
94 Ga0075435_100082323 3300007076 Bacteria 2645
95 Ga0075435_100193555 3300007076 Unclassified 1722
96 Ga0105240_10786324 3300009093 Unclassified 1032
97 Ga0105245_10055840 3300009098 Bacteria 3548
98 Ga0105245_10116665 3300009098 Unclassified 2489
99 Ga0114129_10003377 3300009147 Bacteria 22426
100 Ga0114129_10005481 3300009147 Bacteria 17934
101 Ga0105242_10186522 3300009176 Bacteria 1833
102 Ga0105242_10374272 3300009176 Unclassified 1322
103 Ga0105242_10477116 3300009176 Unclassified 1181
104 Ga0105242_10687090 3300009176 Bacteria 1000
105 Ga0105242_11244772 3300009176 Bacteria 765
106 Ga0105249_11669918 3300009553 Unclassified 710
107 Ga0157370_10619071 3300013104 Unclassified 991
108 Ga0157374_10374599 3300013296 Bacteria 1417
109 Ga0157378_10536490 3300013297 Bacteria 1174
110 Ga0157372_10342605 3300013307 Bacteria 1741
111 Ga0157375_10344058 3300013308 Bacteria 1657
112 Ga0157375_11075303 3300013308 Unclassified 941
113 Ga0157380_10218845 3300014326 Bacteria 1702
114 Ga0206352_10325105 3300020078 Bacteria 611
115 Ga0206350_10115086 3300020080 Unclassified 626
116 Ga0206350_11289239 3300020080 Bacteria 672
117 Ga0207682_10079837 3300025893 Bacteria 1400
118 Ga0207682_10362847 3300025893 Bacteria 683
119 Ga0207642_10101241 3300025899 Bacteria 1447
120 Ga0207642_10655198 3300025899 Bacteria 658
121 Ga0207645_10062116 3300025907 Bacteria 2386
122 Ga0207645_10251428 3300025907 Bacteria 1169
123 Ga0207705_10655406 3300025909 Bacteria 816
124 Ga0207684_10020846 3300025910 Bacteria 5599
125 Ga0207707_10074117 3300025912 Unclassified 2969
126 Ga0207707_10131839 3300025912 Bacteria 2185
127 Ga0207695_10331127 3300025913 Archaea 1411
128 Ga0207695_10453976 3300025913 Unclassified 1165
129 Ga0207660_10004552 3300025917 Bacteria 9042
130 Ga0207660_10179585 3300025917 Unclassified 1643
131 Ga0207662_10610345 3300025918 Unclassified 760
132 Ga0207649_10081059 3300025920 Unclassified 2100
133 Ga0207649_10380750 3300025920 Unclassified 1051
134 Ga0207652_10006448 3300025921 Bacteria 9465
135 Ga0207652_10032943 3300025921 Bacteria 4362
136 Ga0207646_10215509 3300025922 Bacteria 1734
137 Ga0207646_10615978 3300025922 Bacteria 974
138 Ga0207646_11483272 3300025922 Unclassified 588
139 Ga0207694_10035155 3300025924 Bacteria 3843
140 Ga0207659_10633446 3300025926 Archaea 913
141 Ga0207687_10097555 3300025927 Unclassified 2156
142 Ga0207687_10498709 3300025927 Bacteria 1016
143 Ga0207664_10008857 3300025929 Bacteria 7041
144 Ga0207690_10313802 3300025932 Unclassified 1230
145 Ga0207706_11081481 3300025933 Unclassified 671
146 Ga0207686_10223535 3300025934 Bacteria 1361
147 Ga0207686_11530564 3300025934 Unclassified 550
148 Ga0207670_10986942 3300025936 Unclassified 708
149 Ga0207669_10381306 3300025937 Bacteria 1099
150 Ga0207691_10457518 3300025940 Bacteria 1086
151 Ga0207711_10665200 3300025941 Bacteria 971
152 Ga0207689_10067213 3300025942 Bacteria 2946
153 Ga0207689_10082489 3300025942 Bacteria 2643
154 Ga0207651_10248155 3300025960 Bacteria 1455
155 Ga0207668_10340353 3300025972 Unclassified 1251
156 Ga0207640_10428439 3300025981 Bacteria 1084
157 Ga0207639_10013067 3300026041 Bacteria 5797
158 Ga0207678_10169873 3300026067 Bacteria 1862
159 Ga0207708_10215835 3300026075 Bacteria 1535
160 Ga0207702_10082268 3300026078 Bacteria 2799
161 Ga0207702_10335362 3300026078 Unclassified 1443
162 Ga0207641_11230662 3300026088 Unclassified 749
163 Ga0207648_10070923 3300026089 Bacteria 3037
164 Ga0207648_10101517 3300026089 Bacteria 2521
165 Ga0207648_10679942 3300026089 Unclassified 953
166 Ga0207674_10255462 3300026116 Bacteria 1699
167 Ga0207675_100290436 3300026118 Bacteria 1590
168 Ga0207683_10054833 3300026121 Bacteria 3495
169 Ga0207698_10007115 3300026142 Bacteria 7008
170 Ga0207698_11485677 3300026142 Unclassified 693
171 Ga0268266_10449641 3300028379 Bacteria 1225
172 Ga0268265_10000426 3300028380 Bacteria 45123
173 Ga0268265_10982990 3300028380 Bacteria 833
174 Ga0265332_10013779 3300031238 Bacteria 3580
175 Ga0265328_10009585 3300031239 Bacteria 3939
176 Ga0265331_10027518 3300031250 Bacteria 2849
177 Ga0265316_10423227 3300031344 Bacteria 957
178 Ga0265342_10037999 3300031712 Bacteria 2934
179 Ga0373935_0313398 3300035692 Unclassified 1112
180 Ga0373925_0429106 3300037068 Unclassified 1081
181 Ga0451577_0635967 3300042876 Bacteria 968
182 Ga0466963_0241253 3300044694 Bacteria 1267
183 Ga0451576_0681928 3300045051 Bacteria 1080
184 Ga0495582_0012393 3300046473 Bacteria 4696
185 Ga0495599_0567469 3300046678 Unclassified 663
186 Ga0495600_0361517 3300046809 Bacteria 908
187 Ga0496106_0481901 3300048909 Bacteria 997
188 Ga0496114_0581866 3300048917 Unclassified 988
189 Ga0496114_0712749 3300048917 Unclassified 879
190 nmdc:mga05p37_27628_c2 3300050507 Bacteria 4401
191 nmdc:mga05p37_73511_c1 3300050507 Bacteria 4207
192 nmdc:mga0qj67_26717_c1 3300050509 Bacteria 4470
193 nmdc:mga08y16_579022_c1 3300050511 Bacteria 1133
194 nmdc:mga0n895_126126_c1 3300050512 Bacteria 2583
195 nmdc:mga0n895_186532_c1 3300050512 Unclassified 2105
196 nmdc:mga0n895_7_c1 3300050512 Bacteria 121855
197 nmdc:mga0rr50_191042_c1 3300050513 Unclassified 1678
198 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
199 nmdc:mga0rr50_41683_c1 3300050513 Bacteria 3347
200 nmdc:mga08x19_156941_c1 3300050514 Bacteria 1544
201 nmdc:mga08x19_263_c1 3300050514 Bacteria 39779
202 nmdc:mga0a205_201310_c1 3300050515 Unclassified 1882
203 nmdc:mga0a205_22817_c1 3300050515 Bacteria 5933
204 nmdc:mga0a205_348084_c1 3300050515 Bacteria 1350
205 Ga0495601_0664124 3300053077 Unclassified 666
206 Ga0070676_10425538
207 Ga0007429J51699_1038297
208 Ga0058859_11741613
209 Ga0058860_12218303
210 Ga0065715_10023297
211 Ga0070658_10155728
212 Ga0070676_10423418
213 Ga0070690_100281632
214 Ga0070670_100744103
215 Ga0070677_10237367
216 Ga0070680_100018125
217 Ga0070680_100039461
218 Ga0068868_101094730
219 Ga0070660_100272201
220 Ga0070689_100765879
221 Ga0070687_100334031
222 Ga0070661_100060821
223 Ga0070661_100700681
224 Ga0070661_101319494
225 Ga0070668_100081543
226 Ga0070675_101084460
227 Ga0070675_101711917
228 Ga0070674_101181240
229 Ga0070659_100280639
230 Ga0070667_100866856
231 Ga0070709_10208925
232 Ga0070714_100040442
233 Ga0070710_10451833
234 Ga0070711_100203467
235 Ga0070705_100207878
236 Ga0070705_100283255
237 Ga0070705_100419126
238 Ga0070705_100828818
239 Ga0070700_100236001
240 Ga0070694_100095835
241 Ga0070694_100890542
242 Ga0070708_100088309
243 Ga0070708_100930870
244 Ga0070663_100088358
245 Ga0070678_101376742
246 Ga0070681_10012651
247 Ga0070681_10078186
248 Ga0070681_10657124
249 Ga0068867_100702145
250 Ga0068867_100711185
251 Ga0068867_100860950
252 Ga0070706_100009120
253 Ga0070707_100492900
254 Ga0070698_100099776
255 Ga0070698_100294745
256 Ga0070699_100684588
257 Ga0070679_100000222
258 Ga0070697_100523868
259 Ga0068853_100080663
260 Ga0070672_100429949
261 Ga0070704_101313885
262 Ga0068855_100414396
263 Ga0070664_100499462
264 Ga0070664_100884399
265 Ga0068857_100327395
266 Ga0068854_100258688
267 Ga0068856_100417577
268 Ga0068856_100583729
269 Ga0070702_101183562
270 Ga0068852_100221547
271 Ga0068852_101797361
272 Ga0068859_100260004
273 Ga0068859_100277156
274 Ga0068859_100405780
275 Ga0068866_10405076
276 Ga0068861_100368856
277 Ga0068860_101615251
278 Ga0068862_100001853
279 Ga0068871_100267912
280 Ga0068871_100483789
281 Ga0075428_100019136
282 Ga0075428_100451485
283 Ga0075430_100001056
284 Ga0075431_100069735
285 Ga0075433_10118016
286 Ga0075433_10119875
287 Ga0075434_100000907
288 Ga0075434_100174228
289 Ga0075434_100392266
290 Ga0075429_100111843
291 Ga0068865_100452978
292 Ga0068865_100707108
293 Ga0075436_100003345
294 Ga0075436_100350470
295 Ga0097620_100260019
296 Ga0097620_100277147
297 Ga0097620_100405818
298 Ga0075435_100000083
299 Ga0075435_100082323
300 Ga0075435_100193555
301 Ga0105240_10786324
302 Ga0105245_10055840
303 Ga0105245_10116665
304 Ga0114129_10003377
305 Ga0114129_10005481
306 Ga0105242_10186522
307 Ga0105242_10374272
308 Ga0105242_10477116
309 Ga0105242_10687090
310 Ga0105242_11244772
311 Ga0105249_11669918
312 Ga0157370_10619071
313 Ga0157374_10374599
314 Ga0157378_10536490
315 Ga0157372_10342605
316 Ga0157375_10344058
317 Ga0157375_11075303
318 Ga0157380_10218845
319 Ga0206352_10325105
320 Ga0206350_10115086
321 Ga0206350_11289239
322 Ga0207682_10079837
323 Ga0207682_10362847
324 Ga0207642_10101241
325 Ga0207642_10655198
326 Ga0207645_10062116
327 Ga0207645_10251428
328 Ga0207705_10655406
329 Ga0207684_10020846
330 Ga0207707_10074117
331 Ga0207707_10131839
332 Ga0207695_10331127
333 Ga0207695_10453976
334 Ga0207660_10004552
335 Ga0207660_10179585
336 Ga0207662_10610345
337 Ga0207649_10081059
338 Ga0207649_10380750
339 Ga0207652_10006448
340 Ga0207652_10032943
341 Ga0207646_10215509
342 Ga0207646_10615978
343 Ga0207646_11483272
344 Ga0207694_10035155
345 Ga0207659_10633446
346 Ga0207687_10097555
347 Ga0207687_10498709
348 Ga0207664_10008857
349 Ga0207690_10313802
350 Ga0207706_11081481
351 Ga0207686_10223535
352 Ga0207686_11530564
353 Ga0207670_10986942
354 Ga0207669_10381306
355 Ga0207691_10457518
356 Ga0207711_10665200
357 Ga0207689_10067213
358 Ga0207689_10082489
359 Ga0207651_10248155
360 Ga0207668_10340353
361 Ga0207640_10428439
362 Ga0207639_10013067
363 Ga0207678_10169873
364 Ga0207708_10215835
365 Ga0207702_10082268
366 Ga0207702_10335362
367 Ga0207641_11230662
368 Ga0207648_10070923
369 Ga0207648_10101517
370 Ga0207648_10679942
371 Ga0207674_10255462
372 Ga0207675_100290436
373 Ga0207683_10054833
374 Ga0207698_10007115
375 Ga0207698_11485677
376 Ga0268266_10449641
377 Ga0268265_10000426
378 Ga0268265_10982990
379 Ga0265332_10013779
380 Ga0265328_10009585
381 Ga0265331_10027518
382 Ga0265316_10423227
383 Ga0265342_10037999
384 Ga0373935_0313398
385 Ga0373925_0429106
386 Ga0451577_0635967
387 Ga0466963_0241253
388 Ga0451576_0681928
389 Ga0495582_0012393
390 Ga0495599_0567469
391 Ga0495600_0361517
392 Ga0496106_0481901
393 Ga0496114_0581866
394 Ga0496114_0712749
395 nmdc:mga05p37_27628_c2
396 nmdc:mga05p37_73511_c1
397 nmdc:mga0qj67_26717_c1
398 nmdc:mga08y16_579022_c1
399 nmdc:mga0n895_126126_c1
400 nmdc:mga0n895_186532_c1
401 nmdc:mga0n895_7_c1
402 nmdc:mga0rr50_191042_c1
403 nmdc:mga0rr50_3_c1
404 nmdc:mga0rr50_41683_c1
405 nmdc:mga08x19_156941_c1
406 nmdc:mga08x19_263_c1
407 nmdc:mga0a205_201310_c1
408 nmdc:mga0a205_22817_c1
409 nmdc:mga0a205_348084_c1
410 Ga0495601_0664124

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

12

134

0.91

PF18029

Glyoxalase_6

Glyoxalase-like domain

18

135

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.7852 14 138
2i7r-assembly1.cif.gz_B conserved domain protein 0.7812 14 136
3itw-assembly1.cif.gz_B-2 crystal structure of tiox from micromonospora sp. ml1 0.7756 14 143
1ecs-assembly1.cif.gz_B the 1.7 a crystal structure of a bleomycin resistance determinant encoded on the transposon tn5 0.7677 14 138
3itw-assembly1.cif.gz_A-2 crystal structure of tiox from micromonospora sp. ml1 0.7677 14 138
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9424 81 148 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.877 81 148 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8545 80 138 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8284 80 138 3.30.720.110
3itwB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8252 14 69 3.30.720.120
ID Description Score Start End GO Terms
AF-A0A3S4BLH8-F1-model_v4 VOC family protein 0.9611 4 153
AF-A0A327W6L9-F1-model_v4 PhnB protein 0.9606 21 153
AF-A0A2E6PKE6-F1-model_v4 Glyoxalase 0.9584 19 156
AF-A0A7K2Q7F2-F1-model_v4 VOC family protein 0.9474 8 146
AF-A0A7C2UBA7-F1-model_v4 VOC family protein 0.9461 21 150

Map