F312705

General Info

Members Datasets Scaffolds Average Seq Length
204 130 408 234

Family's Representative Sequence

Representative Sequence 3300031731|Ga0307405_10454139|Ga0307405_104541392
Length 235
Sequence MQTGFDVNLQGVRQRIDKAAMRVGRDPDDIKLVAVSKTHSVNSIRQAISAGISTFGENKVQEAETKIEELGRDAAEWRLIGHLQSNKARKAVQLFDVIESLDSVDLAKRLERICIEDGRSELPVFIEVDLAGEETKSGVSETQLPELVRILAHCVCLRFDGLMVLPPFSDPEASRPYFQKLRAIRDGLQKNGAFKYGDGELSMGMSHDFEVAIEEGATLVRVGTAIFGERVYAQP

Samples

Sample ID Description Type Environment
1 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
109 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
119 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
120 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
121 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
122 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
123 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
124 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
125 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
126 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
127 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
128 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
129 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
130 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.49
Rhizosphere 99.51
Stem 0
Stem Tuber 0
Unclassified 9.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307405_10454139 3300031731 Bacteria 1017
2 JGI24034J26672_10000030 3300002239 Bacteria 97515
3 Ga0065704_10106814 3300005289 Bacteria 2073
4 Ga0065712_10162922 3300005290 Unclassified 1278
5 Ga0065715_10132093 3300005293 Bacteria 1995
6 Ga0065715_10173305 3300005293 Bacteria 1527
7 Ga0070658_10004694 3300005327 Bacteria 11108
8 Ga0070676_10163365 3300005328 Bacteria 1435
9 Ga0070676_10317301 3300005328 Bacteria 1062
10 Ga0070670_100125385 3300005331 Bacteria 2216
11 Ga0068869_100338587 3300005334 Bacteria 1224
12 Ga0070666_10107595 3300005335 Bacteria 1927
13 Ga0070680_100056149 3300005336 Bacteria 3218
14 Ga0070687_100382753 3300005343 Unclassified 917
15 Ga0070668_100188377 3300005347 Bacteria 1689
16 Ga0070669_100164972 3300005353 Bacteria 1724
17 Ga0070675_100009495 3300005354 Bacteria 7572
18 Ga0070675_100511396 3300005354 Bacteria 1083
19 Ga0070671_100359778 3300005355 Unclassified 1242
20 Ga0070674_100748050 3300005356 Bacteria 840
21 Ga0070673_100073415 3300005364 Bacteria 2754
22 Ga0070673_100345758 3300005364 Bacteria 1319
23 Ga0070667_100006067 3300005367 Bacteria 10034
24 Ga0070667_100346395 3300005367 Bacteria 1344
25 Ga0070694_100539023 3300005444 Bacteria 933
26 Ga0070694_100598561 3300005444 Bacteria 888
27 Ga0070694_100788713 3300005444 Bacteria 778
28 Ga0070678_100209654 3300005456 Bacteria 1614
29 Ga0070681_10023738 3300005458 Bacteria 6172
30 Ga0068867_100002780 3300005459 Bacteria 12307
31 Ga0068867_100432879 3300005459 Unclassified 1117
32 Ga0070685_10008662 3300005466 Bacteria 5237
33 Ga0070679_100440050 3300005530 Bacteria 1249
34 Ga0068853_100140399 3300005539 Bacteria 2168
35 Ga0070672_100027553 3300005543 Bacteria 4239
36 Ga0070686_100243583 3300005544 Bacteria 1310
37 Ga0070704_100111719 3300005549 Bacteria 2081
38 Ga0068855_100552481 3300005563 Bacteria 1246
39 Ga0068857_100159011 3300005577 Bacteria 2050
40 Ga0068854_100200725 3300005578 Bacteria 1568
41 Ga0070702_100437631 3300005615 Bacteria 945
42 Ga0068852_100326280 3300005616 Bacteria 1492
43 Ga0068852_100807376 3300005616 Bacteria 952
44 Ga0068859_100035857 3300005617 Bacteria 4977
45 Ga0068859_100044224 3300005617 Bacteria 4474
46 Ga0068859_100941766 3300005617 Bacteria 947
47 Ga0068864_100001917 3300005618 Bacteria 17077
48 Ga0068864_100600216 3300005618 Unclassified 1068
49 Ga0068866_10213937 3300005718 Unclassified 1159
50 Ga0068861_100020046 3300005719 Unclassified 4783
51 Ga0068861_100113613 3300005719 Bacteria 2173
52 Ga0068861_100135036 3300005719 Bacteria 2006
53 Ga0068861_100404439 3300005719 Unclassified 1212
54 Ga0068863_100094090 3300005841 Bacteria 2844
55 Ga0068863_100479010 3300005841 Bacteria 1223
56 Ga0068858_100000550 3300005842 Bacteria 39088
57 Ga0068858_100101308 3300005842 Unclassified 2686
58 Ga0068858_100153804 3300005842 Unclassified 2164
59 Ga0068860_100066265 3300005843 Bacteria 3430
60 Ga0068860_100389172 3300005843 Bacteria 1377
61 Ga0068860_100462533 3300005843 Bacteria 1262
62 Ga0068860_100600958 3300005843 Bacteria 1105
63 Ga0068862_100426021 3300005844 Bacteria 1246
64 Ga0068862_100565996 3300005844 Bacteria 1087
65 Ga0070715_10000013 3300006163 Bacteria 155405
66 Ga0097621_100182318 3300006237 Bacteria 1814
67 Ga0068871_100053724 3300006358 Bacteria 3266
68 Ga0075428_100550175 3300006844 Unclassified 1234
69 Ga0075433_10008261 3300006852 Bacteria 8297
70 Ga0068865_100051999 3300006881 Bacteria 2838
71 Ga0097620_100035858 3300006931 Bacteria 4977
72 Ga0097620_100044225 3300006931 Bacteria 4474
73 Ga0097620_100664111 3300006931 Bacteria 1134
74 Ga0097620_100941813 3300006931 Bacteria 947
75 Ga0099794_10039625 3300007265 Bacteria 2237
76 Ga0105240_10569799 3300009093 Bacteria 1250
77 Ga0105247_10000552 3300009101 Bacteria 30429
78 Ga0105247_10157929 3300009101 Bacteria 1499
79 Ga0105243_10696600 3300009148 Bacteria 990
80 Ga0105248_10453839 3300009177 Bacteria 1444
81 Ga0105248_10638275 3300009177 Bacteria 1201
82 Ga0105237_10049711 3300009545 Bacteria 4214
83 Ga0105237_10985164 3300009545 Unclassified 850
84 Ga0105249_10006274 3300009553 Bacteria 10326
85 Ga0105249_10023182 3300009553 Bacteria 5567
86 Ga0105249_10082318 3300009553 Bacteria 2995
87 Ga0105239_10274076 3300010375 Bacteria 1898
88 Ga0157370_10029652 3300013104 Bacteria 5366
89 Ga0157369_10128146 3300013105 Bacteria 2690
90 Ga0157374_10306410 3300013296 Bacteria 1572
91 Ga0157374_10341404 3300013296 Bacteria 1487
92 Ga0157374_10560026 3300013296 Bacteria 1151
93 Ga0157378_10038942 3300013297 Unclassified 4215
94 Ga0157378_10042543 3300013297 Bacteria 4032
95 Ga0157378_10111340 3300013297 Bacteria 2510
96 Ga0163162_10028585 3300013306 Bacteria 5518
97 Ga0163162_10034819 3300013306 Bacteria 5013
98 Ga0163162_10295380 3300013306 Bacteria 1752
99 Ga0157372_10033023 3300013307 Bacteria 5681
100 Ga0157372_10102577 3300013307 Bacteria 3268
101 Ga0157375_10618213 3300013308 Bacteria 1242
102 Ga0157375_10754852 3300013308 Bacteria 1124
103 Ga0163163_10260388 3300014325 Bacteria 1785
104 Ga0163163_10325158 3300014325 Bacteria 1592
105 Ga0157379_10459789 3300014968 Bacteria 1176
106 Ga0163161_10191200 3300017792 Bacteria 1574
107 Ga0163161_10514107 3300017792 Bacteria 977
108 Ga0207642_10075551 3300025899 Bacteria 1618
109 Ga0207710_10000001 3300025900 Bacteria 1797433
110 Ga0207710_10037551 3300025900 Bacteria 2139
111 Ga0207688_10157118 3300025901 Bacteria 1346
112 Ga0207680_10127245 3300025903 Bacteria 1674
113 Ga0207685_10000013 3300025905 Bacteria 186374
114 Ga0207645_10224346 3300025907 Bacteria 1239
115 Ga0207705_10040274 3300025909 Bacteria 3350
116 Ga0207707_10002288 3300025912 Bacteria 17267
117 Ga0207695_10114707 3300025913 Bacteria 2669
118 Ga0207695_10464397 3300025913 Bacteria 1149
119 Ga0207660_10042385 3300025917 Bacteria 3195
120 Ga0207646_10058480 3300025922 Bacteria 3443
121 Ga0207681_10222192 3300025923 Bacteria 1462
122 Ga0207650_10291327 3300025925 Bacteria 1331
123 Ga0207644_10044760 3300025931 Bacteria 3146
124 Ga0207686_10020192 3300025934 Bacteria 3802
125 Ga0207709_10318614 3300025935 Bacteria 1163
126 Ga0207704_10066741 3300025938 Bacteria 2260
127 Ga0207691_10008766 3300025940 Bacteria 9702
128 Ga0207691_10468344 3300025940 Bacteria 1071
129 Ga0207689_10128410 3300025942 Unclassified 2085
130 Ga0207689_10281194 3300025942 Bacteria 1378
131 Ga0207679_10009559 3300025945 Bacteria 6216
132 Ga0207679_10305133 3300025945 Unclassified 1374
133 Ga0207651_10060119 3300025960 Bacteria 2636
134 Ga0207651_10408891 3300025960 Unclassified 1156
135 Ga0207712_10023160 3300025961 Bacteria 4096
136 Ga0207712_10057534 3300025961 Bacteria 2744
137 Ga0207712_10269388 3300025961 Bacteria 1385
138 Ga0207712_10291980 3300025961 Bacteria 1335
139 Ga0207712_10461075 3300025961 Bacteria 1080
140 Ga0207668_10104346 3300025972 Bacteria 2113
141 Ga0207640_10277537 3300025981 Bacteria 1314
142 Ga0207658_10094096 3300025986 Unclassified 2331
143 Ga0207677_10156385 3300026023 Bacteria 1766
144 Ga0207703_10000347 3300026035 Bacteria 49743
145 Ga0207703_10125234 3300026035 Unclassified 2211
146 Ga0207703_10727808 3300026035 Unclassified 944
147 Ga0207639_10045664 3300026041 Bacteria 3301
148 Ga0207641_10020330 3300026088 Bacteria 5452
149 Ga0207641_10241237 3300026088 Bacteria 1684
150 Ga0207641_10303502 3300026088 Bacteria 1509
151 Ga0207648_10011631 3300026089 Bacteria 8283
152 Ga0207648_10124488 3300026089 Bacteria 2267
153 Ga0207648_10253883 3300026089 Bacteria 1568
154 Ga0207648_10427544 3300026089 Unclassified 1203
155 Ga0207648_10894570 3300026089 Bacteria 829
156 Ga0207676_10102530 3300026095 Bacteria 2376
157 Ga0207676_10173601 3300026095 Bacteria 1880
158 Ga0207674_10170764 3300026116 Bacteria 2128
159 Ga0207675_100007906 3300026118 Bacteria 10025
160 Ga0207675_100092534 3300026118 Bacteria 2844
161 Ga0207675_100116365 3300026118 Bacteria 2526
162 Ga0207675_100208675 3300026118 Bacteria 1878
163 Ga0207683_10251039 3300026121 Bacteria 1614
164 Ga0207698_10067468 3300026142 Bacteria 2821
165 Ga0268265_10852127 3300028380 Bacteria 892
166 Ga0268264_10011061 3300028381 Bacteria 7453
167 Ga0268264_10536984 3300028381 Bacteria 1145
168 Ga0268264_10582586 3300028381 Bacteria 1101
169 Ga0307408_100105404 3300031548 Bacteria 2155
170 Ga0307408_100512181 3300031548 Bacteria 1052
171 Ga0307405_10010590 3300031731 Bacteria 4791
172 Ga0307413_10003645 3300031824 Bacteria 6538
173 Ga0307413_10013457 3300031824 Bacteria 4114
174 Ga0307410_10194059 3300031852 Bacteria 1546
175 Ga0307406_10008064 3300031901 Bacteria 5866
176 Ga0307406_10037864 3300031901 Bacteria 2982
177 Ga0307407_10037894 3300031903 Bacteria 2667
178 Ga0307407_10050467 3300031903 Bacteria 2380
179 Ga0307412_10081434 3300031911 Bacteria 2239
180 Ga0307409_100025859 3300031995 Bacteria 4126
181 Ga0307416_100031976 3300032002 Bacteria 3970
182 Ga0307414_10008199 3300032004 Bacteria 5910
183 Ga0307414_10108991 3300032004 Bacteria 2102
184 Ga0307411_10000968 3300032005 Bacteria 11006
185 Ga0307411_10085032 3300032005 Bacteria 2190
186 Ga0307411_10125726 3300032005 Bacteria 1864
187 Ga0307415_100028349 3300032126 Bacteria 3561
188 Ga0307415_100029274 3300032126 Bacteria 3517
189 Ga0307415_100227002 3300032126 Bacteria 1501
190 Ga0439432_088897 3300042006 Bacteria 931
191 Ga0496109_0031467 3300048912 Bacteria 4761
192 Ga0501216_012317 3300049660 Bacteria 1403
193 Ga0501242_003639 3300049674 Bacteria 1677
194 Ga0501243_028936 3300049675 Bacteria 939
195 Ga0501247_000220 3300049677 Bacteria 3881
196 Ga0501259_011909 3300049688 Bacteria 1444
197 Ga0501221_012978 3300049704 Bacteria 1525
198 Ga0501245_018030 3300049708 Bacteria 1082
199 Ga0501267_000989 3300049764 Bacteria 2343
200 Ga0501270_002283 3300049767 Bacteria 1949
201 Ga0501272_002020 3300049769 Bacteria 1994
202 nmdc:mga0n895_30037_c1 3300050512 Bacteria 5189
203 nmdc:mga0a205_148269_c1 3300050515 Bacteria 2246
204 Ga0501084_0239115 3300054114 Bacteria 1533
205 Ga0307405_10454139
206 JGI24034J26672_10000030
207 Ga0065704_10106814
208 Ga0065712_10162922
209 Ga0065715_10132093
210 Ga0065715_10173305
211 Ga0070658_10004694
212 Ga0070676_10163365
213 Ga0070676_10317301
214 Ga0070670_100125385
215 Ga0068869_100338587
216 Ga0070666_10107595
217 Ga0070680_100056149
218 Ga0070687_100382753
219 Ga0070668_100188377
220 Ga0070669_100164972
221 Ga0070675_100009495
222 Ga0070675_100511396
223 Ga0070671_100359778
224 Ga0070674_100748050
225 Ga0070673_100073415
226 Ga0070673_100345758
227 Ga0070667_100006067
228 Ga0070667_100346395
229 Ga0070694_100539023
230 Ga0070694_100598561
231 Ga0070694_100788713
232 Ga0070678_100209654
233 Ga0070681_10023738
234 Ga0068867_100002780
235 Ga0068867_100432879
236 Ga0070685_10008662
237 Ga0070679_100440050
238 Ga0068853_100140399
239 Ga0070672_100027553
240 Ga0070686_100243583
241 Ga0070704_100111719
242 Ga0068855_100552481
243 Ga0068857_100159011
244 Ga0068854_100200725
245 Ga0070702_100437631
246 Ga0068852_100326280
247 Ga0068852_100807376
248 Ga0068859_100035857
249 Ga0068859_100044224
250 Ga0068859_100941766
251 Ga0068864_100001917
252 Ga0068864_100600216
253 Ga0068866_10213937
254 Ga0068861_100020046
255 Ga0068861_100113613
256 Ga0068861_100135036
257 Ga0068861_100404439
258 Ga0068863_100094090
259 Ga0068863_100479010
260 Ga0068858_100000550
261 Ga0068858_100101308
262 Ga0068858_100153804
263 Ga0068860_100066265
264 Ga0068860_100389172
265 Ga0068860_100462533
266 Ga0068860_100600958
267 Ga0068862_100426021
268 Ga0068862_100565996
269 Ga0070715_10000013
270 Ga0097621_100182318
271 Ga0068871_100053724
272 Ga0075428_100550175
273 Ga0075433_10008261
274 Ga0068865_100051999
275 Ga0097620_100035858
276 Ga0097620_100044225
277 Ga0097620_100664111
278 Ga0097620_100941813
279 Ga0099794_10039625
280 Ga0105240_10569799
281 Ga0105247_10000552
282 Ga0105247_10157929
283 Ga0105243_10696600
284 Ga0105248_10453839
285 Ga0105248_10638275
286 Ga0105237_10049711
287 Ga0105237_10985164
288 Ga0105249_10006274
289 Ga0105249_10023182
290 Ga0105249_10082318
291 Ga0105239_10274076
292 Ga0157370_10029652
293 Ga0157369_10128146
294 Ga0157374_10306410
295 Ga0157374_10341404
296 Ga0157374_10560026
297 Ga0157378_10038942
298 Ga0157378_10042543
299 Ga0157378_10111340
300 Ga0163162_10028585
301 Ga0163162_10034819
302 Ga0163162_10295380
303 Ga0157372_10033023
304 Ga0157372_10102577
305 Ga0157375_10618213
306 Ga0157375_10754852
307 Ga0163163_10260388
308 Ga0163163_10325158
309 Ga0157379_10459789
310 Ga0163161_10191200
311 Ga0163161_10514107
312 Ga0207642_10075551
313 Ga0207710_10000001
314 Ga0207710_10037551
315 Ga0207688_10157118
316 Ga0207680_10127245
317 Ga0207685_10000013
318 Ga0207645_10224346
319 Ga0207705_10040274
320 Ga0207707_10002288
321 Ga0207695_10114707
322 Ga0207695_10464397
323 Ga0207660_10042385
324 Ga0207646_10058480
325 Ga0207681_10222192
326 Ga0207650_10291327
327 Ga0207644_10044760
328 Ga0207686_10020192
329 Ga0207709_10318614
330 Ga0207704_10066741
331 Ga0207691_10008766
332 Ga0207691_10468344
333 Ga0207689_10128410
334 Ga0207689_10281194
335 Ga0207679_10009559
336 Ga0207679_10305133
337 Ga0207651_10060119
338 Ga0207651_10408891
339 Ga0207712_10023160
340 Ga0207712_10057534
341 Ga0207712_10269388
342 Ga0207712_10291980
343 Ga0207712_10461075
344 Ga0207668_10104346
345 Ga0207640_10277537
346 Ga0207658_10094096
347 Ga0207677_10156385
348 Ga0207703_10000347
349 Ga0207703_10125234
350 Ga0207703_10727808
351 Ga0207639_10045664
352 Ga0207641_10020330
353 Ga0207641_10241237
354 Ga0207641_10303502
355 Ga0207648_10011631
356 Ga0207648_10124488
357 Ga0207648_10253883
358 Ga0207648_10427544
359 Ga0207648_10894570
360 Ga0207676_10102530
361 Ga0207676_10173601
362 Ga0207674_10170764
363 Ga0207675_100007906
364 Ga0207675_100092534
365 Ga0207675_100116365
366 Ga0207675_100208675
367 Ga0207683_10251039
368 Ga0207698_10067468
369 Ga0268265_10852127
370 Ga0268264_10011061
371 Ga0268264_10536984
372 Ga0268264_10582586
373 Ga0307408_100105404
374 Ga0307408_100512181
375 Ga0307405_10010590
376 Ga0307413_10003645
377 Ga0307413_10013457
378 Ga0307410_10194059
379 Ga0307406_10008064
380 Ga0307406_10037864
381 Ga0307407_10037894
382 Ga0307407_10050467
383 Ga0307412_10081434
384 Ga0307409_100025859
385 Ga0307416_100031976
386 Ga0307414_10008199
387 Ga0307414_10108991
388 Ga0307411_10000968
389 Ga0307411_10085032
390 Ga0307411_10125726
391 Ga0307415_100028349
392 Ga0307415_100029274
393 Ga0307415_100227002
394 Ga0439432_088897
395 Ga0496109_0031467
396 Ga0501216_012317
397 Ga0501242_003639
398 Ga0501243_028936
399 Ga0501247_000220
400 Ga0501259_011909
401 Ga0501221_012978
402 Ga0501245_018030
403 Ga0501267_000989
404 Ga0501270_002283
405 Ga0501272_002020
406 nmdc:mga0n895_30037_c1
407 nmdc:mga0a205_148269_c1
408 Ga0501084_0239115

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

7

231

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f8e-assembly3.cif.gz_C crystal structure of yggs from fusobacterium nucleatum 0.9335 8 231
7ygf-assembly3.cif.gz_C crystal structure of yggs from fusobacterium nucleatum 0.9331 8 231
7ub8-assembly2.cif.gz_B the crystal structure of the k38a/k137a/k233a/k234a quadruple mutant of e. coli yggs in complex with plp 0.931 8 232
3sy1-assembly1.cif.gz_A crystal structure of engineered protein. northeast structural genomics consortium target or70 0.93 8 233
7uau-assembly1.cif.gz_A the crystal structure of the k137a mutant of e. coli yggs in complex with plp 0.9269 8 233
ID Description Score Start End Superfamily
af_B9EWG6_2_244_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9258 8 237 3.20.20.10
af_Q9Z2Y8_11_258_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9244 8 236 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9227 8 233 3.20.20.10
af_Q9P6Q1_1_232_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9208 8 237 3.20.20.10
af_Q2FZ87_1_222_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9185 9 234 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A838S1B3-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9882 102 234 GO:0030170
AF-A0A3M1S6R1-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9813 8 167 GO:0030170
AF-A0A7Y2GG41-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9807 8 235 GO:0030170
AF-A0A399WW61-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9798 8 236 GO:0016020
GO:0030170
AF-A0A1W9T8Y4-F1-model_v4 YggS family pyridoxal phosphate enzyme 0.9779 9 194 GO:0030170

Map