F312673

General Info

Members Datasets Scaffolds Average Seq Length
204 134 201 141

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10020398|Ga0307515_100203984
Length 168
Sequence MGHPAPEYRRHLPGGCSGRLGAARRWPEMRVRLVAVVAIAMLGATMTAHAADDAIDTPLTDVPGDAARGRAIVVNRQLGLCLLCHSGPFAEERSQGNMAPDLSGAGARWSEGQLRLRLVDSRRLNPQTLMPSYRRTDGLERVGAAWRGQAVLSAQQVEDVVAFLRTLK

Samples

Sample ID Description Type Environment
1 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
2 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
3 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
13 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
19 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
22 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
37 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
60 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
64 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
65 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
68 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
72 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
73 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
74 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
78 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
81 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
82 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
83 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
84 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
89 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
90 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
93 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
96 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
97 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
98 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
99 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
103 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
104 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
105 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
106 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
107 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
108 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
109 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
110 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
111 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
112 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
113 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
114 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
115 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
116 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
117 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
118 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
119 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
120 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
121 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
122 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
123 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
124 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
125 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
126 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
127 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
128 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
129 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
130 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
131 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
132 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
133 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
134 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 0
Isolates 1.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35.29
Nodule 0
Rhizoplane 2.94
Rhizosphere 41.18
Stem 0
Stem Tuber 0
Unclassified 20.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_101139465 3300005334 Bacteria 684
2 Ga0070668_101847166 3300005347 Bacteria 556
3 Ga0070675_100691799 3300005354 Bacteria 928
4 Ga0070673_100305899 3300005364 Bacteria 1401
5 Ga0070667_100001934 3300005367 Bacteria 18379
6 Ga0068855_100906942 3300005563 Bacteria 931
7 Ga0068854_101074350 3300005578 Bacteria 716
8 Ga0068852_100182449 3300005616 Bacteria 1974
9 Ga0068861_100098149 3300005719 Bacteria 2325
10 Ga0068862_100406263 3300005844 Bacteria 1275
11 Ga0081455_10009526 3300005937 Bacteria 9976
12 Ga0075365_10098959 3300006038 Bacteria 1995
13 Ga0075368_10049610 3300006042 Bacteria 1666
14 Ga0075368_10175010 3300006042 Bacteria 903
15 Ga0075363_100163283 3300006048 Bacteria 1262
16 Ga0075364_10182924 3300006051 Bacteria 1419
17 Ga0075362_10018002 3300006177 Bacteria 2918
18 Ga0075362_10046347 3300006177 Bacteria 1933
19 Ga0075362_10172032 3300006177 Bacteria 1047
20 Ga0075367_10017464 3300006178 Bacteria 3939
21 Ga0075367_10029448 3300006178 Bacteria 3140
22 Ga0075369_10011576 3300006186 Bacteria 3473
23 Ga0075369_10159126 3300006186 Bacteria 1035
24 Ga0075366_10016273 3300006195 Bacteria 4273
25 Ga0075366_10076189 3300006195 Bacteria 2002
26 Ga0075370_10034420 3300006353 Bacteria 2839
27 Ga0075370_10113345 3300006353 Bacteria 1575
28 Ga0075370_10156068 3300006353 Bacteria 1338
29 Ga0068865_100122673 3300006881 Bacteria 1935
30 Ga0105240_10058123 3300009093 Bacteria 4829
31 Ga0105245_10135824 3300009098 Bacteria 2311
32 Ga0105241_10716406 3300009174 Bacteria 915
33 Ga0105248_12246797 3300009177 Bacteria 621
34 Ga0105237_10186971 3300009545 Bacteria 2071
35 Ga0105237_10373997 3300009545 Bacteria 1430
36 Ga0105239_10330864 3300010375 Bacteria 1718
37 Ga0157369_11024496 3300013105 Bacteria 845
38 Ga0157375_10528416 3300013308 Bacteria 1342
39 Ga0157379_10120730 3300014968 Bacteria 2357
40 Ga0157379_10332313 3300014968 Bacteria 1389
41 Ga0157379_11152344 3300014968 Bacteria 744
42 Ga0209673_1009561 3300025273 Bacteria 4178
43 Ga0209050_1000282 3300025298 Bacteria 108629
44 Ga0209256_1038372 3300025299 Bacteria 1241
45 Ga0209051_1085399 3300025303 Bacteria 895
46 Ga0207682_10136939 3300025893 Bacteria 1096
47 Ga0207680_10275262 3300025903 Bacteria 1168
48 Ga0207695_10032651 3300025913 Bacteria 5694
49 Ga0207671_10262730 3300025914 Bacteria 1359
50 Ga0207657_10567826 3300025919 Bacteria 886
51 Ga0207659_10338303 3300025926 Bacteria 1246
52 Ga0207687_10144813 3300025927 Bacteria 1806
53 Ga0207690_10834293 3300025932 Bacteria 763
54 Ga0207706_10052888 3300025933 Bacteria 3585
55 Ga0207669_10488657 3300025937 Bacteria 983
56 Ga0207704_10024034 3300025938 Bacteria 3296
57 Ga0207689_10526534 3300025942 Bacteria 992
58 Ga0207667_10823574 3300025949 Bacteria 924
59 Ga0207651_10568372 3300025960 Bacteria 988
60 Ga0207640_10654682 3300025981 Bacteria 895
61 Ga0207658_10006941 3300025986 Bacteria 7710
62 Ga0207658_11042348 3300025986 Bacteria 747
63 Ga0207678_10049003 3300026067 Bacteria 3650
64 Ga0207648_10611359 3300026089 Bacteria 1005
65 Ga0207674_10130688 3300026116 Bacteria 2474
66 Ga0207675_100123470 3300026118 Bacteria 2451
67 Ga0207698_11265478 3300026142 Bacteria 752
68 Ga0209813_10188866 3300027866 Bacteria 757
69 Ga0268265_10447315 3300028380 Bacteria 1206
70 Ga0307517_10003242 3300028786 Bacteria 25464
71 Ga0307517_10094739 3300028786 Bacteria 2408
72 Ga0307515_10020398 3300028794 Bacteria 11827
73 Ga0307515_10031041 3300028794 Bacteria 8934
74 Ga0307515_10065748 3300028794 Bacteria 5039
75 Ga0307515_10121841 3300028794 Bacteria 2947
76 Ga0307515_10249828 3300028794 Bacteria 1528
77 Ga0307512_10041391 3300030522 Bacteria 3830
78 Ga0307512_10148115 3300030522 Bacteria 1413
79 Ga0307513_10018336 3300031456 Bacteria 8367
80 Ga0307513_10343991 3300031456 Bacteria 1241
81 Ga0307509_10009390 3300031507 Bacteria 12239
82 Ga0307509_10061405 3300031507 Bacteria 3967
83 Ga0307509_10197255 3300031507 Bacteria 1855
84 Ga0307509_10219249 3300031507 Bacteria 1718
85 Ga0307509_10351500 3300031507 Bacteria 1197
86 Ga0307509_10560291 3300031507 Unclassified 819
87 Ga0307509_10631436 3300031507 Bacteria 741
88 Ga0307508_10000028 3300031616 Bacteria 168639
89 Ga0307508_10001494 3300031616 Bacteria 26240
90 Ga0307508_10084591 3300031616 Bacteria 2754
91 Ga0307508_10253794 3300031616 Bacteria 1354
92 Ga0307508_10468225 3300031616 Bacteria 853
93 Ga0307508_10887875 3300031616 Bacteria 516
94 Ga0307514_10034183 3300031649 Bacteria 4052
95 Ga0307514_10140769 3300031649 Bacteria 1640
96 Ga0307516_10001972 3300031730 Bacteria 28094
97 Ga0307516_10117227 3300031730 Bacteria 2457
98 Ga0307516_10141690 3300031730 Bacteria 2173
99 Ga0307516_10318328 3300031730 Bacteria 1227
100 Ga0307516_10394411 3300031730 Bacteria 1044
101 Ga0307405_10786163 3300031731 Bacteria 796
102 Ga0307410_11979663 3300031852 Bacteria 520
103 Ga0307507_10370947 3300033179 Bacteria 830
104 Ga0307510_10009944 3300033180 Bacteria 11306
105 Ga0307510_10033557 3300033180 Bacteria 5762
106 Ga0307510_10143253 3300033180 Bacteria 2028
107 Ga0307510_10167684 3300033180 Bacteria 1780
108 Ga0307510_10178141 3300033180 Bacteria 1693
109 Ga0307510_10195426 3300033180 Bacteria 1565
110 Ga0373950_0091702 3300034818 Unclassified 646
111 Ga0373931_0110413 3300035691 Bacteria 1559
112 Ga0373925_0153977 3300037068 Bacteria 1807
113 Ga0395900_0111107 3300037418 Bacteria 2815
114 Ga0436362_0425435 3300039453 Bacteria 815
115 Ga0436362_0834207 3300039453 Bacteria 706
116 Ga0451793_1280473 3300041452 Bacteria 673
117 Ga0451577_0253127 3300042876 Bacteria 1594
118 Ga0495592_0001923 3300046454 Bacteria 14629
119 Ga0495638_0049859 3300046460 Bacteria 2616
120 Ga0495610_0075414 3300046512 Bacteria 1562
121 Ga0495616_0315133 3300046513 Bacteria 658
122 Ga0495620_0150490 3300046515 Bacteria 907
123 Ga0495631_0228525 3300046518 Bacteria 794
124 Ga0495632_0004456 3300046519 Bacteria 9514
125 Ga0495632_0023136 3300046519 Bacteria 3322
126 Ga0495632_0023266 3300046519 Bacteria 3311
127 Ga0495632_0167785 3300046519 Bacteria 1009
128 Ga0495648_0277323 3300046524 Bacteria 796
129 Ga0495609_0097701 3300046538 Bacteria 1274
130 Ga0495622_0168406 3300046557 Bacteria 986
131 Ga0495622_0190812 3300046557 Bacteria 916
132 Ga0495611_0150694 3300046648 Bacteria 1086
133 Ga0495611_0187896 3300046648 Bacteria 965
134 Ga0495625_0069085 3300046660 Bacteria 2482
135 Ga0495625_0224186 3300046660 Bacteria 1230
136 Ga0495624_0172537 3300046690 Bacteria 1319
137 Ga0495671_0142092 3300046692 Bacteria 1170
138 Ga0495671_0445509 3300046692 Bacteria 619
139 Ga0495649_0000541 3300046694 Bacteria 32077
140 Ga0495660_0005435 3300046810 Bacteria 7629
141 Ga0495676_0047900 3300047321 Bacteria 3451
142 Ga0495687_004487 3300047443 Bacteria 9398
143 Ga0495687_009407 3300047443 Bacteria 5464
144 Ga0495593_0132198 3300047673 Bacteria 1266
145 Ga0496106_0014751 3300048909 Bacteria 5777
146 Ga0496106_0132347 3300048909 Bacteria 1957
147 Ga0496112_0490433 3300048915 Bacteria 1165
148 Ga0496113_0221742 3300048916 Bacteria 1507
149 Ga0496113_0741050 3300048916 Bacteria 783
150 Ga0496121_0172578 3300048924 Bacteria 1569
151 Ga0495682_0105637 3300049460 Bacteria 1010
152 nmdc:mga03683_106015_c1 3300050489 Bacteria 1239
153 nmdc:mga03683_62588_c1 3300050489 Bacteria 1576
154 nmdc:mga03n38_173579_c1 3300050490 Bacteria 1100
155 nmdc:mga00v17_53877_c1 3300050491 Bacteria 2453
156 nmdc:mga0yw44_54778_c1 3300050492 Bacteria 2425
157 nmdc:mga0yw44_742542_c1 3300050492 Bacteria 667
158 nmdc:mga0yw44_83781_c1 3300050492 Bacteria 2003
159 nmdc:mga0k408_195101_c1 3300050493 Bacteria 1209
160 nmdc:mga0k408_51352_c1 3300050493 Bacteria 2389
161 nmdc:mga06z11_125716_c1 3300050494 Bacteria 1435
162 nmdc:mga06z11_189889_c1 3300050494 Bacteria 1189
163 nmdc:mga06z11_19185_c1 3300050494 Bacteria 3139
164 nmdc:mga04h51_216731_c1 3300050495 Bacteria 757
165 nmdc:mga04h51_31733_c1 3300050495 Bacteria 1671
166 nmdc:mga07m45_110535_c1 3300050496 Bacteria 1583
167 nmdc:mga07m45_190093_c1 3300050496 Bacteria 1194
168 nmdc:mga07m45_326000_c1 3300050496 Bacteria 893
169 nmdc:mga07m45_326733_c1 3300050496 Bacteria 892
170 Ga0500578_0001060 3300053086 Bacteria 29908
171 Ga0500578_0017684 3300053086 Bacteria 4581
172 Ga0500644_0008293 3300053088 Bacteria 2739
173 Ga0500583_0127602 3300053092 Bacteria 1261
174 Ga0500583_0207998 3300053092 Bacteria 972
175 Ga0500651_0033486 3300053093 Bacteria 3240
176 Ga0500651_0085062 3300053093 Bacteria 1955
177 Ga0500650_0283576 3300053098 Bacteria 736
178 Ga0500594_0019960 3300053118 Bacteria 1666
179 Ga0500607_074129 3300053121 Bacteria 1750
180 Ga0500628_020083 3300053129 Bacteria 1338
181 Ga0500642_0011091 3300053130 Bacteria 3208
182 Ga0500652_000299 3300053131 Bacteria 18083
183 Ga0500655_059449 3300053133 Bacteria 769
184 Ga0500658_0003732 3300053134 Bacteria 5738
185 Ga0500658_0090865 3300053134 Bacteria 1320
186 Ga0500559_0000694 3300053136 Bacteria 22155
187 Ga0500564_181156 3300053138 Bacteria 878
188 Ga0500568_0016275 3300053139 Bacteria 3311
189 Ga0500568_0048787 3300053139 Bacteria 1672
190 Ga0500573_0328616 3300053140 Bacteria 752
191 Ga0500619_000023 3300053154 Bacteria 50489
192 Ga0500619_050138 3300053154 Bacteria 1349
193 Ga0500620_217136 3300053155 Bacteria 647
194 Ga0500622_0000125 3300053156 Bacteria 81109
195 Ga0500622_0008466 3300053156 Bacteria 5753
196 Ga0500636_0044331 3300053177 Bacteria 2623
197 Ga0500645_000226 3300053730 Bacteria 42982
198 Ga0500645_001912 3300053730 Bacteria 9900
199 Ga0500645_005748 3300053730 Bacteria 4514
200 Ga0500552_001171 3300053733 Bacteria 2483
201 Ga0500587_002482 3300053739 Bacteria 2621

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031730 Ga0307516_10141690 Ga0307516_101416902 127
2 3300006186 Ga0075369_10159126 Ga0075369_101591262 133
3 3300006195 Ga0075366_10076189 Ga0075366_100761892 134
4 3300025919 Ga0207657_10567826 Ga0207657_105678262 134
5 3300028794 Ga0307515_10065748 Ga0307515_100657482 134
6 3300031507 Ga0307509_10351500 Ga0307509_103515002 134
7 3300039453 Ga0436362_0425435 Ga0436362_0425435_124_540 134
8 3300039453 Ga0436362_0834207 Ga0436362_0834207_101_517 134
9 3300050496 nmdc:mga07m45_190093_c1 nmdc:mga07m45_190093_c1_347_757 134
10 3300006177 Ga0075362_10172032 Ga0075362_101720322 135
11 3300006178 Ga0075367_10017464 Ga0075367_100174642 135
12 3300006195 Ga0075366_10016273 Ga0075366_100162734 135
13 3300006353 Ga0075370_10156068 Ga0075370_101560682 135
14 3300046519 Ga0495632_0004456 Ga0495632_0004456_5707_6123 135
15 3300050493 nmdc:mga0k408_51352_c1 nmdc:mga0k408_51352_c1_532_948 135
16 3300050494 nmdc:mga06z11_189889_c1 nmdc:mga06z11_189889_c1_36_452 135
17 3300050495 nmdc:mga04h51_31733_c1 nmdc:mga04h51_31733_c1_95_511 135
18 3300050496 nmdc:mga07m45_326000_c1 nmdc:mga07m45_326000_c1_18_434 135
19 3300053092 Ga0500583_0127602 Ga0500583_0127602_17_433 135
20 3300053129 Ga0500628_020083 Ga0500628_020083_349_765 135
21 3300053130 Ga0500642_0011091 Ga0500642_0011091_1204_1620 135
22 3300053131 Ga0500652_000299 Ga0500652_000299_789_1205 135
23 3300053133 Ga0500655_059449 Ga0500655_059449_12_428 135
24 3300053134 Ga0500658_0090865 Ga0500658_0090865_445_861 135
25 3300053156 Ga0500622_0000125 Ga0500622_0000125_3047_3463 135
26 iso_pu_bacteria 2643221625 2644143380 135
27 iso_pu_bacteria 2643221648 2644276183 135
28 iso_pu_bacteria 2643221654 2644301137 135
29 3300009545 Ga0105237_10373997 Ga0105237_103739972 136
30 3300014968 Ga0157379_11152344 Ga0157379_111523442 136
31 3300025903 Ga0207680_10275262 Ga0207680_102752622 136
32 3300025986 Ga0207658_11042348 Ga0207658_110423482 136
33 3300028794 Ga0307515_10031041 Ga0307515_1003104110 136
34 3300030522 Ga0307512_10041391 Ga0307512_100413915 136
35 3300030522 Ga0307512_10148115 Ga0307512_101481152 136
36 3300031507 Ga0307509_10009390 Ga0307509_100093909 136
37 3300031507 Ga0307509_10061405 Ga0307509_100614056 136
38 3300031507 Ga0307509_10197255 Ga0307509_101972552 136
39 3300031507 Ga0307509_10560291 Ga0307509_105602911 136
40 3300031507 Ga0307509_10631436 Ga0307509_106314362 136
41 3300031616 Ga0307508_10000028 Ga0307508_10000028125 136
42 3300031616 Ga0307508_10084591 Ga0307508_100845912 136
43 3300031616 Ga0307508_10253794 Ga0307508_102537942 136
44 3300031616 Ga0307508_10468225 Ga0307508_104682252 136
45 3300031616 Ga0307508_10887875 Ga0307508_108878751 136
46 3300031649 Ga0307514_10034183 Ga0307514_100341835 136
47 3300031649 Ga0307514_10140769 Ga0307514_101407692 136
48 3300033179 Ga0307507_10370947 Ga0307507_103709472 136
49 3300033180 Ga0307510_10009944 Ga0307510_100099442 136
50 3300033180 Ga0307510_10033557 Ga0307510_100335572 136
51 3300033180 Ga0307510_10143253 Ga0307510_101432532 136
52 3300033180 Ga0307510_10167684 Ga0307510_101676842 136
53 3300033180 Ga0307510_10178141 Ga0307510_101781414 136
54 3300033180 Ga0307510_10195426 Ga0307510_101954263 136
55 3300034818 Ga0373950_0091702 Ga0373950_0091702_174_584 136
56 3300035691 Ga0373931_0110413 Ga0373931_0110413_298_708 136
57 3300041452 Ga0451793_1280473 Ga0451793_1280473_248_658 136
58 3300046454 Ga0495592_0001923 Ga0495592_0001923_4400_4810 136
59 3300046460 Ga0495638_0049859 Ga0495638_0049859_1679_2089 136
60 3300046515 Ga0495620_0150490 Ga0495620_0150490_241_651 136
61 3300046519 Ga0495632_0023136 Ga0495632_0023136_2217_2627 136
62 3300046557 Ga0495622_0168406 Ga0495622_0168406_213_623 136
63 3300046557 Ga0495622_0190812 Ga0495622_0190812_170_580 136
64 3300046660 Ga0495625_0224186 Ga0495625_0224186_738_1151 136
65 3300046690 Ga0495624_0172537 Ga0495624_0172537_428_838 136
66 3300047321 Ga0495676_0047900 Ga0495676_0047900_1270_1680 136
67 3300047673 Ga0495593_0132198 Ga0495593_0132198_695_1105 136
68 3300049460 Ga0495682_0105637 Ga0495682_0105637_55_465 136
69 3300050489 nmdc:mga03683_62588_c1 nmdc:mga03683_62588_c1_502_915 136
70 3300053088 Ga0500644_0008293 Ga0500644_0008293_184_594 136
71 3300053093 Ga0500651_0085062 Ga0500651_0085062_315_725 136
72 3300053118 Ga0500594_0019960 Ga0500594_0019960_995_1405 136
73 3300053121 Ga0500607_074129 Ga0500607_074129_785_1195 136
74 3300053136 Ga0500559_0000694 Ga0500559_0000694_5372_5782 136
75 3300053138 Ga0500564_181156 Ga0500564_181156_233_643 136
76 3300053154 Ga0500619_050138 Ga0500619_050138_268_678 136
77 3300053156 Ga0500622_0008466 Ga0500622_0008466_3174_3584 136
78 3300053177 Ga0500636_0044331 Ga0500636_0044331_1813_2223 136
79 3300053739 Ga0500587_002482 Ga0500587_002482_1016_1426 136
80 3300028786 Ga0307517_10003242 Ga0307517_1000324213 137
81 3300028786 Ga0307517_10094739 Ga0307517_100947393 137
82 3300031507 Ga0307509_10219249 Ga0307509_102192494 137
83 3300031616 Ga0307508_10001494 Ga0307508_1000149419 137
84 3300031730 Ga0307516_10318328 Ga0307516_103183282 137
85 3300046519 Ga0495632_0167785 Ga0495632_0167785_78_491 137
86 3300046660 Ga0495625_0069085 Ga0495625_0069085_164_577 137
87 3300053092 Ga0500583_0207998 Ga0500583_0207998_190_603 137
88 3300005578 Ga0068854_101074350 Ga0068854_1010743502 138
89 3300005616 Ga0068852_100182449 Ga0068852_1001824492 138
90 3300006038 Ga0075365_10098959 Ga0075365_100989594 138
91 3300006042 Ga0075368_10175010 Ga0075368_101750102 138
92 3300006177 Ga0075362_10046347 Ga0075362_100463473 138
93 3300006178 Ga0075367_10029448 Ga0075367_100294486 138
94 3300006353 Ga0075370_10113345 Ga0075370_101133452 138
95 3300009093 Ga0105240_10058123 Ga0105240_100581234 138
96 3300009174 Ga0105241_10716406 Ga0105241_107164062 138
97 3300009177 Ga0105248_12246797 Ga0105248_122467972 138
98 3300009545 Ga0105237_10186971 Ga0105237_101869712 138
99 3300010375 Ga0105239_10330864 Ga0105239_103308644 138
100 3300025273 Ga0209673_1009561 Ga0209673_10095612 138
101 3300025298 Ga0209050_1000282 Ga0209050_1000282109 138
102 3300025299 Ga0209256_1038372 Ga0209256_10383722 138
103 3300025303 Ga0209051_1085399 Ga0209051_10853992 138
104 3300025913 Ga0207695_10032651 Ga0207695_100326512 138
105 3300025914 Ga0207671_10262730 Ga0207671_102627302 138
106 3300025926 Ga0207659_10338303 Ga0207659_103383032 138
107 3300025932 Ga0207690_10834293 Ga0207690_108342932 138
108 3300025933 Ga0207706_10052888 Ga0207706_100528885 138
109 3300025981 Ga0207640_10654682 Ga0207640_106546822 138
110 3300026067 Ga0207678_10049003 Ga0207678_100490035 138
111 3300026089 Ga0207648_10611359 Ga0207648_106113592 138
112 3300026116 Ga0207674_10130688 Ga0207674_101306882 138
113 3300026142 Ga0207698_11265478 Ga0207698_112654782 138
114 3300028794 Ga0307515_10020398 Ga0307515_100203984 138
115 3300028794 Ga0307515_10121841 Ga0307515_101218412 138
116 3300028794 Ga0307515_10249828 Ga0307515_102498282 138
117 3300031456 Ga0307513_10018336 Ga0307513_100183368 138
118 3300031731 Ga0307405_10786163 Ga0307405_107861631 138
119 3300046518 Ga0495631_0228525 Ga0495631_0228525_164_580 138
120 3300046648 Ga0495611_0187896 Ga0495611_0187896_486_902 138
121 3300046692 Ga0495671_0445509 Ga0495671_0445509_61_477 138
122 3300047443 Ga0495687_004487 Ga0495687_004487_7734_8150 138
123 3300050489 nmdc:mga03683_106015_c1 nmdc:mga03683_106015_c1_800_1216 138
124 3300050490 nmdc:mga03n38_173579_c1 nmdc:mga03n38_173579_c1_235_651 138
125 3300050491 nmdc:mga00v17_53877_c1 nmdc:mga00v17_53877_c1_1226_1642 138
126 3300050492 nmdc:mga0yw44_54778_c1 nmdc:mga0yw44_54778_c1_1373_1789 138
127 3300050492 nmdc:mga0yw44_83781_c1 nmdc:mga0yw44_83781_c1_101_520 138
128 3300050493 nmdc:mga0k408_195101_c1 nmdc:mga0k408_195101_c1_632_1048 138
129 3300050494 nmdc:mga06z11_125716_c1 nmdc:mga06z11_125716_c1_798_1214 138
130 3300050494 nmdc:mga06z11_19185_c1 nmdc:mga06z11_19185_c1_295_711 138
131 3300050495 nmdc:mga04h51_216731_c1 nmdc:mga04h51_216731_c1_320_736 138
132 3300050496 nmdc:mga07m45_110535_c1 nmdc:mga07m45_110535_c1_935_1351 138
133 3300050496 nmdc:mga07m45_326733_c1 nmdc:mga07m45_326733_c1_243_659 138
134 3300053086 Ga0500578_0001060 Ga0500578_0001060_3252_3671 138
135 3300053086 Ga0500578_0017684 Ga0500578_0017684_3481_3936 138
136 3300053134 Ga0500658_0003732 Ga0500658_0003732_1097_1513 138
137 3300053139 Ga0500568_0048787 Ga0500568_0048787_561_977 138
138 3300053154 Ga0500619_000023 Ga0500619_000023_22222_22650 138
139 3300053730 Ga0500645_005748 Ga0500645_005748_2699_3154 138
140 3300005367 Ga0070667_100001934 Ga0070667_1000019345 139
141 3300006177 Ga0075362_10018002 Ga0075362_100180023 139
142 3300006881 Ga0068865_100122673 Ga0068865_1001226732 139
143 3300009098 Ga0105245_10135824 Ga0105245_101358242 139
144 3300014968 Ga0157379_10332313 Ga0157379_103323132 139
145 3300025927 Ga0207687_10144813 Ga0207687_101448131 139
146 3300025937 Ga0207669_10488657 Ga0207669_104886572 139
147 3300025938 Ga0207704_10024034 Ga0207704_100240342 139
148 3300025986 Ga0207658_10006941 Ga0207658_100069413 139
149 3300031852 Ga0307410_11979663 Ga0307410_119796631 139
150 3300037068 Ga0373925_0153977 Ga0373925_0153977_1101_1526 139
151 3300048915 Ga0496112_0490433 Ga0496112_0490433_578_1006 139
152 3300048916 Ga0496113_0221742 Ga0496113_0221742_418_837 139
153 3300048916 Ga0496113_0741050 Ga0496113_0741050_97_525 139
154 3300053139 Ga0500568_0016275 Ga0500568_0016275_2097_2519 139
155 3300005347 Ga0070668_101847166 Ga0070668_1018471661 140
156 3300005354 Ga0070675_100691799 Ga0070675_1006917991 140
157 3300005364 Ga0070673_100305899 Ga0070673_1003058992 140
158 3300005844 Ga0068862_100406263 Ga0068862_1004062632 140
159 3300006048 Ga0075363_100163283 Ga0075363_1001632833 140
160 3300013308 Ga0157375_10528416 Ga0157375_105284162 140
161 3300025893 Ga0207682_10136939 Ga0207682_101369392 140
162 3300025960 Ga0207651_10568372 Ga0207651_105683722 140
163 3300028380 Ga0268265_10447315 Ga0268265_104473153 140
164 3300042876 Ga0451577_0253127 Ga0451577_0253127_1077_1535 140
165 3300050492 nmdc:mga0yw44_742542_c1 nmdc:mga0yw44_742542_c1_10_435 140
166 3300053155 Ga0500620_217136 Ga0500620_217136_183_608 140
167 3300046524 Ga0495648_0277323 Ga0495648_0277323_14_463 141
168 3300014968 Ga0157379_10120730 Ga0157379_101207302 142
169 3300046648 Ga0495611_0150694 Ga0495611_0150694_531_962 142
170 3300048909 Ga0496106_0014751 Ga0496106_0014751_2646_3074 142
171 3300048924 Ga0496121_0172578 Ga0496121_0172578_759_1187 142
172 3300053093 Ga0500651_0033486 Ga0500651_0033486_2439_2876 142
173 3300053730 Ga0500645_001912 Ga0500645_001912_6317_6760 142
174 3300053733 Ga0500552_001171 Ga0500552_001171_362_802 142
175 3300005563 Ga0068855_100906942 Ga0068855_1009069422 143
176 3300005719 Ga0068861_100098149 Ga0068861_1000981493 143
177 3300005937 Ga0081455_10009526 Ga0081455_100095264 143
178 3300013105 Ga0157369_11024496 Ga0157369_110244961 143
179 3300025949 Ga0207667_10823574 Ga0207667_108235742 143
180 3300026118 Ga0207675_100123470 Ga0207675_1001234702 143
181 3300031730 Ga0307516_10001972 Ga0307516_1000197219 143
182 3300031730 Ga0307516_10394411 Ga0307516_103944112 143
183 3300037418 Ga0395900_0111107 Ga0395900_0111107_1679_2125 143
184 3300048909 Ga0496106_0132347 Ga0496106_0132347_86_559 143
185 3300053140 Ga0500573_0328616 Ga0500573_0328616_10_456 143
186 3300053730 Ga0500645_000226 Ga0500645_000226_10791_11240 143
187 3300005334 Ga0068869_101139465 Ga0068869_1011394652 144
188 3300006042 Ga0075368_10049610 Ga0075368_100496104 144
189 3300006051 Ga0075364_10182924 Ga0075364_101829242 144
190 3300006186 Ga0075369_10011576 Ga0075369_100115762 144
191 3300006353 Ga0075370_10034420 Ga0075370_100344202 144
192 3300025942 Ga0207689_10526534 Ga0207689_105265341 144
193 3300027866 Ga0209813_10188866 Ga0209813_101888661 144
194 3300031456 Ga0307513_10343991 Ga0307513_103439911 144
195 3300031730 Ga0307516_10117227 Ga0307516_101172274 144
196 3300046512 Ga0495610_0075414 Ga0495610_0075414_86_520 144
197 3300046513 Ga0495616_0315133 Ga0495616_0315133_168_602 144
198 3300046519 Ga0495632_0023266 Ga0495632_0023266_758_1192 144
199 3300046538 Ga0495609_0097701 Ga0495609_0097701_368_802 144
200 3300046692 Ga0495671_0142092 Ga0495671_0142092_713_1147 144
201 3300046694 Ga0495649_0000541 Ga0495649_0000541_15286_15720 144
202 3300046810 Ga0495660_0005435 Ga0495660_0005435_4474_4908 144
203 3300047443 Ga0495687_009407 Ga0495687_009407_4106_4540 144
204 3300053098 Ga0500650_0283576 Ga0500650_0283576_189_623 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00034

Cytochrom_C

Cytochrome c

66

168

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h31-assembly1.cif.gz_B oxidised soxax complex from rhodovulum sulfidophilum 0.8993 24 143
2c1d-assembly4.cif.gz_H crystal structure of soxxa from p. pantotrophus 0.8928 24 143
2oz1-assembly1.cif.gz_B the soxax complex of rhodovulum sulfidophilum 0.8784 24 144
1h33-assembly1.cif.gz_B oxidised soxax complex from rhodovulum sulfidophilum 0.8765 24 144
1h33-assembly1.cif.gz_B oxidised soxax complex from rhodovulum sulfidophilum 0.79 24 144
ID Description Score Start End Superfamily
2c1dD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9082 24 143 1.10.760.10
2oz1D00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8997 24 144 1.10.760.10
2c1dD00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7956 24 143 1.10.760.10
2oz1D00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7942 24 144 1.10.760.10
1k3gA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.7597 72 144 1.10.760.10
ID Description Score Start End GO Terms
AF-A0A0S9QCE0-F1-model_v4 Sulfur oxidation c-type cytochrome SoxX 0.964 22 144 GO:0009055
GO:0020037
GO:0046872
AF-A0A3N1KR94-F1-model_v4 Sulfur-oxidizing protein SoxX 0.9568 23 144 GO:0009055
GO:0020037
GO:0046872
AF-A0A2N3PPW5-F1-model_v4 Sulfur oxidation c-type cytochrome SoxX 0.9556 23 144 GO:0009055
GO:0020037
GO:0046872
AF-W3REU5-F1-model_v4 Cytochrome C 0.955 23 143 GO:0009055
GO:0020037
GO:0046872
AF-A0A0F2R7D9-F1-model_v4 Cytochrome c domain-containing protein 0.9546 24 144 GO:0009055
GO:0020037
GO:0046872

Feature Viewer

pLDDT pTM Quality
82.4 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map