F312338

General Info

Members Datasets Scaffolds Average Seq Length
204 180 408 196

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10153933|Ga0075364_101539332
Length 217
Sequence MDRSDGAATAEALGSETLRARPLRVEGAYEFTPKVFGDDRGMFMSPYQEPAFVATLGHGLFPVAQSNHSVSSRGVVRGVHFTVTPPGSAKYVYCARGRALDIVVDIRVGSPTFGQWDAVVLDQVDFRTMYFPLGVGHAFVALEDQTTMAYLVSSSYVPEHELALSVFDPALGLPIPTDVEPIVSPRDQVAPTLEQAREQGMLPTYERCLELERELYS

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
105 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
108 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
109 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
112 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
127 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
135 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
136 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
139 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
156 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
157 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
158 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
159 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
161 2501939600 Micromonospora sp. L5 Isolate Unclassified
162 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
163 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
164 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
165 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
166 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
167 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
168 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
169 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
170 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
171 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
172 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
173 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
174 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
175 649633069 Micromonospora sp. L5 Isolate Unclassified
176 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
177 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
178 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
179 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
180 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.71
Metatranscriptomes 0.49
Isolates 9.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.9
Nodule 0
Rhizoplane 9.8
Rhizosphere 73.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10153933 3300006051 Bacteria 1550
2 JGI25406J46586_10007329 3300003203 Bacteria 5043
3 rootL2_10099245 3300003322 Bacteria 2308
4 JGI25405J52794_10000516 3300003911 Bacteria 5586
5 Ga0070658_10191564 3300005327 Bacteria 1723
6 Ga0070683_101305114 3300005329 Bacteria 697
7 Ga0070670_100043069 3300005331 Bacteria 3881
8 Ga0068869_100136160 3300005334 Bacteria 1892
9 Ga0070680_100160781 3300005336 Bacteria 1887
10 Ga0070682_100042274 3300005337 Bacteria 2812
11 Ga0068868_100198506 3300005338 Bacteria 1671
12 Ga0070660_100199857 3300005339 Bacteria 1621
13 Ga0070689_100014555 3300005340 Bacteria 5718
14 Ga0070691_10076327 3300005341 Bacteria 1633
15 Ga0070692_10242697 3300005345 Bacteria 1074
16 Ga0070668_100134200 3300005347 Bacteria 1989
17 Ga0070668_100465505 3300005347 Bacteria 1089
18 Ga0070675_100007205 3300005354 Bacteria 8573
19 Ga0070671_100001140 3300005355 Bacteria 19770
20 Ga0070671_100047277 3300005355 Bacteria 3579
21 Ga0070659_100058493 3300005366 Bacteria 3042
22 Ga0070713_100014852 3300005436 Bacteria 5798
23 Ga0070711_100304989 3300005439 Bacteria 1267
24 Ga0070700_100020409 3300005441 Bacteria 3838
25 Ga0070663_100010711 3300005455 Bacteria 5724
26 Ga0070681_10218162 3300005458 Bacteria 1823
27 Ga0070685_10143867 3300005466 Bacteria 1504
28 Ga0070679_100168883 3300005530 Bacteria 2160
29 Ga0068853_100032249 3300005539 Bacteria 4437
30 Ga0070695_100134943 3300005545 Bacteria 1705
31 Ga0070693_100001416 3300005547 Bacteria 10824
32 Ga0070665_100035945 3300005548 Bacteria 4983
33 Ga0070665_100040139 3300005548 Bacteria 4705
34 Ga0068855_100036497 3300005563 Bacteria 5849
35 Ga0068857_100493717 3300005577 Bacteria 1148
36 Ga0068857_100680460 3300005577 Bacteria 976
37 Ga0068856_100859274 3300005614 Bacteria 926
38 Ga0070702_100000419 3300005615 Bacteria 15135
39 Ga0068852_100250617 3300005616 Bacteria 1696
40 Ga0068859_100387832 3300005617 Bacteria 1493
41 Ga0068851_10081063 3300005834 Bacteria 1695
42 Ga0068870_10001066 3300005840 Bacteria 10889
43 Ga0068863_100006048 3300005841 Bacteria 11877
44 Ga0068863_100095991 3300005841 Bacteria 2814
45 Ga0068858_100015074 3300005842 Bacteria 7270
46 Ga0068862_100288429 3300005844 Bacteria 1506
47 Ga0081455_10000111 3300005937 Bacteria 92306
48 Ga0081455_10001643 3300005937 Bacteria 27216
49 Ga0081455_10225447 3300005937 Bacteria 1386
50 Ga0068871_100044102 3300006358 Bacteria 3584
51 Ga0075434_100007316 3300006871 Bacteria 10218
52 Ga0075436_100374772 3300006914 Bacteria 1028
53 Ga0097620_100387846 3300006931 Bacteria 1493
54 Ga0075435_100068181 3300007076 Bacteria 2897
55 Ga0111539_10075036 3300009094 Bacteria 3984
56 Ga0105245_10261527 3300009098 Bacteria 1684
57 Ga0105247_10073715 3300009101 Bacteria 2140
58 Ga0105241_10004420 3300009174 Bacteria 10400
59 Ga0105237_10038489 3300009545 Bacteria 4829
60 Ga0105246_10019171 3300011119 Bacteria 4367
61 Ga0157371_10025274 3300013102 Bacteria 4331
62 Ga0157370_10050635 3300013104 Bacteria 3969
63 Ga0157369_11128642 3300013105 Bacteria 801
64 Ga0157372_10534339 3300013307 Bacteria 1367
65 Ga0163163_10694445 3300014325 Bacteria 1081
66 Ga0163163_10726810 3300014325 Bacteria 1056
67 Ga0157377_10016421 3300014745 Bacteria 3808
68 Ga0157379_10050688 3300014968 Bacteria 3706
69 Ga0157379_10258582 3300014968 Bacteria 1582
70 Ga0157376_10213177 3300014969 Bacteria 1784
71 Ga0197907_10548731 3300020069 Bacteria 1706
72 Ga0207426_1000602 3300025302 Bacteria 47055
73 Ga0207426_1001099 3300025302 Bacteria 24885
74 Ga0207656_10003960 3300025321 Bacteria 5131
75 Ga0207710_10014436 3300025900 Bacteria 3331
76 Ga0207688_10003443 3300025901 Bacteria 8630
77 Ga0207647_10165137 3300025904 Bacteria 1290
78 Ga0207699_10025331 3300025906 Bacteria 3255
79 Ga0207645_10044317 3300025907 Bacteria 2847
80 Ga0207643_10000037 3300025908 Bacteria 89297
81 Ga0207705_10038290 3300025909 Bacteria 3433
82 Ga0207654_10003117 3300025911 Bacteria 8398
83 Ga0207707_10380576 3300025912 Bacteria 1213
84 Ga0207663_10110334 3300025916 Bacteria 1866
85 Ga0207660_10008222 3300025917 Bacteria 6752
86 Ga0207694_10047035 3300025924 Bacteria 3337
87 Ga0207650_10004638 3300025925 Bacteria 9399
88 Ga0207659_10051545 3300025926 Bacteria 2927
89 Ga0207687_10014781 3300025927 Bacteria 5112
90 Ga0207687_10016809 3300025927 Bacteria 4809
91 Ga0207700_10008246 3300025928 Bacteria 6439
92 Ga0207644_10007386 3300025931 Bacteria 7160
93 Ga0207690_10097997 3300025932 Bacteria 2087
94 Ga0207711_10030187 3300025941 Bacteria 4571
95 Ga0207689_10006532 3300025942 Bacteria 10288
96 Ga0207661_10026436 3300025944 Bacteria 4422
97 Ga0207679_10005226 3300025945 Bacteria 8140
98 Ga0207667_10442480 3300025949 Bacteria 1321
99 Ga0207668_10116200 3300025972 Bacteria 2017
100 Ga0207658_10015441 3300025986 Bacteria 5240
101 Ga0207658_10047613 3300025986 Bacteria 3139
102 Ga0207677_10244633 3300026023 Bacteria 1453
103 Ga0207678_10000085 3300026067 Bacteria 76854
104 Ga0207708_10023076 3300026075 Bacteria 4700
105 Ga0207702_10003576 3300026078 Bacteria 14131
106 Ga0207641_10005573 3300026088 Bacteria 10729
107 Ga0207676_10000476 3300026095 Bacteria 33717
108 Ga0207674_10131570 3300026116 Bacteria 2464
109 Ga0207674_10577021 3300026116 Bacteria 1086
110 Ga0207675_100108934 3300026118 Bacteria 2613
111 Ga0207698_10036880 3300026142 Bacteria 3594
112 Ga0207428_10033661 3300027907 Bacteria 4206
113 Ga0268266_10018670 3300028379 Bacteria 5909
114 Ga0268265_10116088 3300028380 Bacteria 2196
115 Ga0307515_10058341 3300028794 Bacteria 5561
116 Ga0307516_10015289 3300031730 Bacteria 8081
117 Ga0307518_10002325 3300031838 Bacteria 13884
118 Ga0307406_10330176 3300031901 Bacteria 1183
119 Ga0307510_10123771 3300033180 Bacteria 2282
120 Ga0373940_0009954 3300035088 Bacteria 2223
121 Ga0373951_0000444 3300035091 Bacteria 12015
122 Ga0373962_0003443 3300035242 Bacteria 3799
123 Ga0373925_0198223 3300037068 Bacteria 1596
124 Ga0373925_0299450 3300037068 Bacteria 1298
125 Ga0451791_0326043 3300041451 Bacteria 824
126 Ga0439455_0087943 3300042012 Bacteria 850
127 Ga0466972_0159436 3300044658 Bacteria 1060
128 Ga0466961_0539778 3300044693 Bacteria 703
129 Ga0466970_0078703 3300044765 Bacteria 1779
130 Ga0466960_0028762 3300044901 Bacteria 2545
131 Ga0466960_0240008 3300044901 Bacteria 1003
132 Ga0466967_0836781 3300045976 Bacteria 914
133 Ga0495629_0157934 3300046459 Bacteria 1575
134 Ga0495658_0139892 3300046683 Bacteria 1480
135 Ga0495636_0028591 3300047318 Bacteria 2275
136 Ga0496100_0000227 3300048903 Bacteria 30068
137 Ga0496100_0534089 3300048903 Bacteria 906
138 Ga0496101_0014001 3300048904 Bacteria 5386
139 Ga0496102_0000028 3300048905 Bacteria 224124
140 Ga0496103_0000024 3300048906 Bacteria 223336
141 Ga0496103_0320159 3300048906 Bacteria 997
142 Ga0496104_0057683 3300048907 Bacteria 3674
143 Ga0496104_0156671 3300048907 Bacteria 2185
144 Ga0496105_0014028 3300048908 Bacteria 6375
145 Ga0496105_0022332 3300048908 Bacteria 5125
146 Ga0496106_0638521 3300048909 Bacteria 851
147 Ga0496109_0175629 3300048912 Bacteria 2010
148 Ga0496109_0346720 3300048912 Bacteria 1403
149 Ga0496109_0362618 3300048912 Bacteria 1369
150 Ga0496110_0140705 3300048913 Bacteria 2181
151 Ga0496111_0045393 3300048914 Bacteria 3161
152 Ga0496112_0048348 3300048915 Bacteria 4170
153 Ga0496113_0008403 3300048916 Bacteria 6726
154 Ga0496115_0240276 3300048918 Bacteria 1493
155 Ga0496116_0000154 3300048919 Bacteria 141052
156 Ga0496117_0000081 3300048920 Bacteria 223343
157 Ga0496118_0000062 3300048921 Bacteria 219267
158 Ga0496119_0003586 3300048922 Bacteria 16007
159 Ga0496119_0007482 3300048922 Bacteria 9820
160 Ga0496120_0000586 3300048923 Bacteria 55320
161 Ga0496120_0002478 3300048923 Bacteria 18582
162 Ga0496121_0013136 3300048924 Bacteria 8932
163 Ga0496124_0247366 3300048927 Bacteria 1321
164 Ga0496125_0016164 3300048928 Bacteria 7176
165 Ga0496126_0000148 3300048929 Bacteria 163288
166 Ga0501040_0435064 3300049576 Bacteria 944
167 Ga0501041_0047934 3300049577 Bacteria 2602
168 Ga0501068_0043662 3300049584 Bacteria 2698
169 Ga0501074_0366216 3300049590 Bacteria 1023
170 Ga0501202_055336 3300049652 Bacteria 887
171 Ga0501079_0172105 3300049741 Bacteria 1689
172 nmdc:mga00v17_157205_c1 3300050491 Bacteria 1462
173 nmdc:mga06r32_896777_c1 3300050510 Bacteria 843
174 nmdc:mga08y16_122599_c1 3300050511 Bacteria 2705
175 nmdc:mga0n895_23611_c1 3300050512 Bacteria 5783
176 nmdc:mga0rr50_3943_c1 3300050513 Bacteria 8633
177 nmdc:mga08x19_18082_c1 3300050514 Bacteria 4319
178 Ga0500646_0003785 3300053090 Bacteria 3867
179 Ga0500583_0044260 3300053092 Bacteria 2038
180 Ga0500566_0048590 3300053094 Bacteria 2432
181 Ga0500650_0055969 3300053098 Bacteria 1837
182 Ga0500577_0001594 3300053142 Bacteria 5811
183 Ga0500577_0004628 3300053142 Bacteria 3655
184 Ga0530510_0149692 3300061734 Bacteria 1723
185 2501943774 2501939600 Bacteria 6907073
186 2515497773 2515154088 Bacteria 5526283
187 2515757667 2515154137 Bacteria 5711575
188 2516091306 2515154203 Bacteria 5458536
189 2586063691 2585427649 Bacteria 9053857
190 2795785735 2795385470 Bacteria 8317180
191 2804849660 2802429296 Bacteria 7227771
192 2809587047 2808606522 Bacteria 9488490
193 2844856441 2844852863 Bacteria 3849151
194 2856863688 2856858025 Bacteria 7255264
195 2862706511 2862705112 Bacteria 6563286
196 2884694393 2884693830 Bacteria 11273186
197 2897562217 2897561785 Bacteria 3256946
198 2964327386 2964326757 Bacteria 3290868
199 649814554 649633069 Bacteria 6962533
200 8003831776 8003830390 Bacteria 6541657
201 8008489103 8008485437 Bacteria 7198341
202 8025528586 8025524527 Bacteria 7197316
203 8054474761 8054472261 Bacteria 7464355
204 8056040770 8056037122 Bacteria 3854319
205 Ga0075364_10153933
206 JGI25406J46586_10007329
207 rootL2_10099245
208 JGI25405J52794_10000516
209 Ga0070658_10191564
210 Ga0070683_101305114
211 Ga0070670_100043069
212 Ga0068869_100136160
213 Ga0070680_100160781
214 Ga0070682_100042274
215 Ga0068868_100198506
216 Ga0070660_100199857
217 Ga0070689_100014555
218 Ga0070691_10076327
219 Ga0070692_10242697
220 Ga0070668_100134200
221 Ga0070668_100465505
222 Ga0070675_100007205
223 Ga0070671_100001140
224 Ga0070671_100047277
225 Ga0070659_100058493
226 Ga0070713_100014852
227 Ga0070711_100304989
228 Ga0070700_100020409
229 Ga0070663_100010711
230 Ga0070681_10218162
231 Ga0070685_10143867
232 Ga0070679_100168883
233 Ga0068853_100032249
234 Ga0070695_100134943
235 Ga0070693_100001416
236 Ga0070665_100035945
237 Ga0070665_100040139
238 Ga0068855_100036497
239 Ga0068857_100493717
240 Ga0068857_100680460
241 Ga0068856_100859274
242 Ga0070702_100000419
243 Ga0068852_100250617
244 Ga0068859_100387832
245 Ga0068851_10081063
246 Ga0068870_10001066
247 Ga0068863_100006048
248 Ga0068863_100095991
249 Ga0068858_100015074
250 Ga0068862_100288429
251 Ga0081455_10000111
252 Ga0081455_10001643
253 Ga0081455_10225447
254 Ga0068871_100044102
255 Ga0075434_100007316
256 Ga0075436_100374772
257 Ga0097620_100387846
258 Ga0075435_100068181
259 Ga0111539_10075036
260 Ga0105245_10261527
261 Ga0105247_10073715
262 Ga0105241_10004420
263 Ga0105237_10038489
264 Ga0105246_10019171
265 Ga0157371_10025274
266 Ga0157370_10050635
267 Ga0157369_11128642
268 Ga0157372_10534339
269 Ga0163163_10694445
270 Ga0163163_10726810
271 Ga0157377_10016421
272 Ga0157379_10050688
273 Ga0157379_10258582
274 Ga0157376_10213177
275 Ga0197907_10548731
276 Ga0207426_1000602
277 Ga0207426_1001099
278 Ga0207656_10003960
279 Ga0207710_10014436
280 Ga0207688_10003443
281 Ga0207647_10165137
282 Ga0207699_10025331
283 Ga0207645_10044317
284 Ga0207643_10000037
285 Ga0207705_10038290
286 Ga0207654_10003117
287 Ga0207707_10380576
288 Ga0207663_10110334
289 Ga0207660_10008222
290 Ga0207694_10047035
291 Ga0207650_10004638
292 Ga0207659_10051545
293 Ga0207687_10014781
294 Ga0207687_10016809
295 Ga0207700_10008246
296 Ga0207644_10007386
297 Ga0207690_10097997
298 Ga0207711_10030187
299 Ga0207689_10006532
300 Ga0207661_10026436
301 Ga0207679_10005226
302 Ga0207667_10442480
303 Ga0207668_10116200
304 Ga0207658_10015441
305 Ga0207658_10047613
306 Ga0207677_10244633
307 Ga0207678_10000085
308 Ga0207708_10023076
309 Ga0207702_10003576
310 Ga0207641_10005573
311 Ga0207676_10000476
312 Ga0207674_10131570
313 Ga0207674_10577021
314 Ga0207675_100108934
315 Ga0207698_10036880
316 Ga0207428_10033661
317 Ga0268266_10018670
318 Ga0268265_10116088
319 Ga0307515_10058341
320 Ga0307516_10015289
321 Ga0307518_10002325
322 Ga0307406_10330176
323 Ga0307510_10123771
324 Ga0373940_0009954
325 Ga0373951_0000444
326 Ga0373962_0003443
327 Ga0373925_0198223
328 Ga0373925_0299450
329 Ga0451791_0326043
330 Ga0439455_0087943
331 Ga0466972_0159436
332 Ga0466961_0539778
333 Ga0466970_0078703
334 Ga0466960_0028762
335 Ga0466960_0240008
336 Ga0466967_0836781
337 Ga0495629_0157934
338 Ga0495658_0139892
339 Ga0495636_0028591
340 Ga0496100_0000227
341 Ga0496100_0534089
342 Ga0496101_0014001
343 Ga0496102_0000028
344 Ga0496103_0000024
345 Ga0496103_0320159
346 Ga0496104_0057683
347 Ga0496104_0156671
348 Ga0496105_0014028
349 Ga0496105_0022332
350 Ga0496106_0638521
351 Ga0496109_0175629
352 Ga0496109_0346720
353 Ga0496109_0362618
354 Ga0496110_0140705
355 Ga0496111_0045393
356 Ga0496112_0048348
357 Ga0496113_0008403
358 Ga0496115_0240276
359 Ga0496116_0000154
360 Ga0496117_0000081
361 Ga0496118_0000062
362 Ga0496119_0003586
363 Ga0496119_0007482
364 Ga0496120_0000586
365 Ga0496120_0002478
366 Ga0496121_0013136
367 Ga0496124_0247366
368 Ga0496125_0016164
369 Ga0496126_0000148
370 Ga0501040_0435064
371 Ga0501041_0047934
372 Ga0501068_0043662
373 Ga0501074_0366216
374 Ga0501202_055336
375 Ga0501079_0172105
376 nmdc:mga00v17_157205_c1
377 nmdc:mga06r32_896777_c1
378 nmdc:mga08y16_122599_c1
379 nmdc:mga0n895_23611_c1
380 nmdc:mga0rr50_3943_c1
381 nmdc:mga08x19_18082_c1
382 Ga0500646_0003785
383 Ga0500583_0044260
384 Ga0500566_0048590
385 Ga0500650_0055969
386 Ga0500577_0001594
387 Ga0500577_0004628
388 Ga0530510_0149692
389 2501943774
390 2515497773
391 2515757667
392 2516091306
393 2586063691
394 2795785735
395 2804849660
396 2809587047
397 2844856441
398 2856863688
399 2862706511
400 2884694393
401 2897562217
402 2964327386
403 649814554
404 8003831776
405 8008489103
406 8025528586
407 8054474761
408 8056040770

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00908

dTDP_sugar_isom

dTDP-4-dehydrorhamnose 3,5-epimerase

22

195

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c0z-assembly1.cif.gz_A-2 the 1.6 a resolution crystal structure of novw: a 4-keto-6-deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of streptomyces spheroides 0.9787 17 221
4hn1-assembly1.cif.gz_B crystal structure of h60n/y130f double mutant of chmj, a 3'-monoepimerase from streptomyces bikiniensis in complex with dtdp 0.9747 24 231
1upi-assembly1.cif.gz_A mycobacterium tuberculosis rmlc epimerase (rv3465) 0.9724 20 228
4hn0-assembly1.cif.gz_B crystal structure of chmj, a 3'-monoepimerase apoenzyme from streptomyces bikiniensis 0.9667 23 230
1upi-assembly1.cif.gz_A mycobacterium tuberculosis rmlc epimerase (rv3465) 0.9582 20 228
ID Description Score Start End Superfamily
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.984 20 221 2.60.120.10
2c0zA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9687 20 221 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9578 17 205 2.60.120.10
2ixcB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9526 20 226 2.60.120.10
5buvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9471 17 205 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A4Q3XJV0-F1-model_v4 dTDP-4-keto-6-deoxy-D-glucose epimerase 0.9951 20 155 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-B0LJ33-F1-model_v4 Lct50 0.9894 20 169 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A3N1L4I9-F1-model_v4 deleted 0.9879 20 229
AF-A0A2S4YMB9-F1-model_v4 dTDP-4-dehydrorhamnose 3,5-epimerase 0.9874 22 232 GO:0005829
GO:0008830
GO:0019305
GO:0045226
AF-A0A4Y8Y1E2-F1-model_v4 dTDP-4-keto-6-deoxy-D-glucose epimerase 0.9862 20 225 GO:0005829
GO:0008830
GO:0019305
GO:0045226

Map