F312338
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 204 | 180 | 408 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300006051|Ga0075364_10153933|Ga0075364_101539332 |
| Length | 217 |
| Sequence | MDRSDGAATAEALGSETLRARPLRVEGAYEFTPKVFGDDRGMFMSPYQEPAFVATLGHGLFPVAQSNHSVSSRGVVRGVHFTVTPPGSAKYVYCARGRALDIVVDIRVGSPTFGQWDAVVLDQVDFRTMYFPLGVGHAFVALEDQTTMAYLVSSSYVPEHELALSVFDPALGLPIPTDVEPIVSPRDQVAPTLEQAREQGMLPTYERCLELERELYS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 46 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 100 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 103 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 104 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 105 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 106 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 107 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 108 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 109 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 110 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 112 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 113 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 114 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 115 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 116 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 117 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 118 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 123 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 124 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 125 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 126 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 127 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 128 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 129 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 130 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 131 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 132 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 133 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 134 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 135 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 136 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 137 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 138 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 139 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 140 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 141 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 142 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 143 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 144 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 145 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 147 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 148 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 149 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 150 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 156 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 157 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 158 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 159 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 160 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 161 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 162 | 2515154088 | Salinispora arenicola CNT800 | Isolate | Rhizosphere |
| 163 | 2515154137 | Salinispora arenicola CNX482 | Isolate | Rhizosphere |
| 164 | 2515154203 | Salinispora arenicola CNR921 | Isolate | Rhizosphere |
| 165 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 166 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 167 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 168 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 169 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 170 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 171 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 172 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 173 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 174 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 175 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 176 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 177 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 178 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 179 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 180 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.71 |
| Metatranscriptomes | 0.49 |
| Isolates | 9.8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.9 |
| Nodule | 0 |
| Rhizoplane | 9.8 |
| Rhizosphere | 73.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075364_10153933 | 3300006051 | Bacteria | 1550 |
| 2 | JGI25406J46586_10007329 | 3300003203 | Bacteria | 5043 |
| 3 | rootL2_10099245 | 3300003322 | Bacteria | 2308 |
| 4 | JGI25405J52794_10000516 | 3300003911 | Bacteria | 5586 |
| 5 | Ga0070658_10191564 | 3300005327 | Bacteria | 1723 |
| 6 | Ga0070683_101305114 | 3300005329 | Bacteria | 697 |
| 7 | Ga0070670_100043069 | 3300005331 | Bacteria | 3881 |
| 8 | Ga0068869_100136160 | 3300005334 | Bacteria | 1892 |
| 9 | Ga0070680_100160781 | 3300005336 | Bacteria | 1887 |
| 10 | Ga0070682_100042274 | 3300005337 | Bacteria | 2812 |
| 11 | Ga0068868_100198506 | 3300005338 | Bacteria | 1671 |
| 12 | Ga0070660_100199857 | 3300005339 | Bacteria | 1621 |
| 13 | Ga0070689_100014555 | 3300005340 | Bacteria | 5718 |
| 14 | Ga0070691_10076327 | 3300005341 | Bacteria | 1633 |
| 15 | Ga0070692_10242697 | 3300005345 | Bacteria | 1074 |
| 16 | Ga0070668_100134200 | 3300005347 | Bacteria | 1989 |
| 17 | Ga0070668_100465505 | 3300005347 | Bacteria | 1089 |
| 18 | Ga0070675_100007205 | 3300005354 | Bacteria | 8573 |
| 19 | Ga0070671_100001140 | 3300005355 | Bacteria | 19770 |
| 20 | Ga0070671_100047277 | 3300005355 | Bacteria | 3579 |
| 21 | Ga0070659_100058493 | 3300005366 | Bacteria | 3042 |
| 22 | Ga0070713_100014852 | 3300005436 | Bacteria | 5798 |
| 23 | Ga0070711_100304989 | 3300005439 | Bacteria | 1267 |
| 24 | Ga0070700_100020409 | 3300005441 | Bacteria | 3838 |
| 25 | Ga0070663_100010711 | 3300005455 | Bacteria | 5724 |
| 26 | Ga0070681_10218162 | 3300005458 | Bacteria | 1823 |
| 27 | Ga0070685_10143867 | 3300005466 | Bacteria | 1504 |
| 28 | Ga0070679_100168883 | 3300005530 | Bacteria | 2160 |
| 29 | Ga0068853_100032249 | 3300005539 | Bacteria | 4437 |
| 30 | Ga0070695_100134943 | 3300005545 | Bacteria | 1705 |
| 31 | Ga0070693_100001416 | 3300005547 | Bacteria | 10824 |
| 32 | Ga0070665_100035945 | 3300005548 | Bacteria | 4983 |
| 33 | Ga0070665_100040139 | 3300005548 | Bacteria | 4705 |
| 34 | Ga0068855_100036497 | 3300005563 | Bacteria | 5849 |
| 35 | Ga0068857_100493717 | 3300005577 | Bacteria | 1148 |
| 36 | Ga0068857_100680460 | 3300005577 | Bacteria | 976 |
| 37 | Ga0068856_100859274 | 3300005614 | Bacteria | 926 |
| 38 | Ga0070702_100000419 | 3300005615 | Bacteria | 15135 |
| 39 | Ga0068852_100250617 | 3300005616 | Bacteria | 1696 |
| 40 | Ga0068859_100387832 | 3300005617 | Bacteria | 1493 |
| 41 | Ga0068851_10081063 | 3300005834 | Bacteria | 1695 |
| 42 | Ga0068870_10001066 | 3300005840 | Bacteria | 10889 |
| 43 | Ga0068863_100006048 | 3300005841 | Bacteria | 11877 |
| 44 | Ga0068863_100095991 | 3300005841 | Bacteria | 2814 |
| 45 | Ga0068858_100015074 | 3300005842 | Bacteria | 7270 |
| 46 | Ga0068862_100288429 | 3300005844 | Bacteria | 1506 |
| 47 | Ga0081455_10000111 | 3300005937 | Bacteria | 92306 |
| 48 | Ga0081455_10001643 | 3300005937 | Bacteria | 27216 |
| 49 | Ga0081455_10225447 | 3300005937 | Bacteria | 1386 |
| 50 | Ga0068871_100044102 | 3300006358 | Bacteria | 3584 |
| 51 | Ga0075434_100007316 | 3300006871 | Bacteria | 10218 |
| 52 | Ga0075436_100374772 | 3300006914 | Bacteria | 1028 |
| 53 | Ga0097620_100387846 | 3300006931 | Bacteria | 1493 |
| 54 | Ga0075435_100068181 | 3300007076 | Bacteria | 2897 |
| 55 | Ga0111539_10075036 | 3300009094 | Bacteria | 3984 |
| 56 | Ga0105245_10261527 | 3300009098 | Bacteria | 1684 |
| 57 | Ga0105247_10073715 | 3300009101 | Bacteria | 2140 |
| 58 | Ga0105241_10004420 | 3300009174 | Bacteria | 10400 |
| 59 | Ga0105237_10038489 | 3300009545 | Bacteria | 4829 |
| 60 | Ga0105246_10019171 | 3300011119 | Bacteria | 4367 |
| 61 | Ga0157371_10025274 | 3300013102 | Bacteria | 4331 |
| 62 | Ga0157370_10050635 | 3300013104 | Bacteria | 3969 |
| 63 | Ga0157369_11128642 | 3300013105 | Bacteria | 801 |
| 64 | Ga0157372_10534339 | 3300013307 | Bacteria | 1367 |
| 65 | Ga0163163_10694445 | 3300014325 | Bacteria | 1081 |
| 66 | Ga0163163_10726810 | 3300014325 | Bacteria | 1056 |
| 67 | Ga0157377_10016421 | 3300014745 | Bacteria | 3808 |
| 68 | Ga0157379_10050688 | 3300014968 | Bacteria | 3706 |
| 69 | Ga0157379_10258582 | 3300014968 | Bacteria | 1582 |
| 70 | Ga0157376_10213177 | 3300014969 | Bacteria | 1784 |
| 71 | Ga0197907_10548731 | 3300020069 | Bacteria | 1706 |
| 72 | Ga0207426_1000602 | 3300025302 | Bacteria | 47055 |
| 73 | Ga0207426_1001099 | 3300025302 | Bacteria | 24885 |
| 74 | Ga0207656_10003960 | 3300025321 | Bacteria | 5131 |
| 75 | Ga0207710_10014436 | 3300025900 | Bacteria | 3331 |
| 76 | Ga0207688_10003443 | 3300025901 | Bacteria | 8630 |
| 77 | Ga0207647_10165137 | 3300025904 | Bacteria | 1290 |
| 78 | Ga0207699_10025331 | 3300025906 | Bacteria | 3255 |
| 79 | Ga0207645_10044317 | 3300025907 | Bacteria | 2847 |
| 80 | Ga0207643_10000037 | 3300025908 | Bacteria | 89297 |
| 81 | Ga0207705_10038290 | 3300025909 | Bacteria | 3433 |
| 82 | Ga0207654_10003117 | 3300025911 | Bacteria | 8398 |
| 83 | Ga0207707_10380576 | 3300025912 | Bacteria | 1213 |
| 84 | Ga0207663_10110334 | 3300025916 | Bacteria | 1866 |
| 85 | Ga0207660_10008222 | 3300025917 | Bacteria | 6752 |
| 86 | Ga0207694_10047035 | 3300025924 | Bacteria | 3337 |
| 87 | Ga0207650_10004638 | 3300025925 | Bacteria | 9399 |
| 88 | Ga0207659_10051545 | 3300025926 | Bacteria | 2927 |
| 89 | Ga0207687_10014781 | 3300025927 | Bacteria | 5112 |
| 90 | Ga0207687_10016809 | 3300025927 | Bacteria | 4809 |
| 91 | Ga0207700_10008246 | 3300025928 | Bacteria | 6439 |
| 92 | Ga0207644_10007386 | 3300025931 | Bacteria | 7160 |
| 93 | Ga0207690_10097997 | 3300025932 | Bacteria | 2087 |
| 94 | Ga0207711_10030187 | 3300025941 | Bacteria | 4571 |
| 95 | Ga0207689_10006532 | 3300025942 | Bacteria | 10288 |
| 96 | Ga0207661_10026436 | 3300025944 | Bacteria | 4422 |
| 97 | Ga0207679_10005226 | 3300025945 | Bacteria | 8140 |
| 98 | Ga0207667_10442480 | 3300025949 | Bacteria | 1321 |
| 99 | Ga0207668_10116200 | 3300025972 | Bacteria | 2017 |
| 100 | Ga0207658_10015441 | 3300025986 | Bacteria | 5240 |
| 101 | Ga0207658_10047613 | 3300025986 | Bacteria | 3139 |
| 102 | Ga0207677_10244633 | 3300026023 | Bacteria | 1453 |
| 103 | Ga0207678_10000085 | 3300026067 | Bacteria | 76854 |
| 104 | Ga0207708_10023076 | 3300026075 | Bacteria | 4700 |
| 105 | Ga0207702_10003576 | 3300026078 | Bacteria | 14131 |
| 106 | Ga0207641_10005573 | 3300026088 | Bacteria | 10729 |
| 107 | Ga0207676_10000476 | 3300026095 | Bacteria | 33717 |
| 108 | Ga0207674_10131570 | 3300026116 | Bacteria | 2464 |
| 109 | Ga0207674_10577021 | 3300026116 | Bacteria | 1086 |
| 110 | Ga0207675_100108934 | 3300026118 | Bacteria | 2613 |
| 111 | Ga0207698_10036880 | 3300026142 | Bacteria | 3594 |
| 112 | Ga0207428_10033661 | 3300027907 | Bacteria | 4206 |
| 113 | Ga0268266_10018670 | 3300028379 | Bacteria | 5909 |
| 114 | Ga0268265_10116088 | 3300028380 | Bacteria | 2196 |
| 115 | Ga0307515_10058341 | 3300028794 | Bacteria | 5561 |
| 116 | Ga0307516_10015289 | 3300031730 | Bacteria | 8081 |
| 117 | Ga0307518_10002325 | 3300031838 | Bacteria | 13884 |
| 118 | Ga0307406_10330176 | 3300031901 | Bacteria | 1183 |
| 119 | Ga0307510_10123771 | 3300033180 | Bacteria | 2282 |
| 120 | Ga0373940_0009954 | 3300035088 | Bacteria | 2223 |
| 121 | Ga0373951_0000444 | 3300035091 | Bacteria | 12015 |
| 122 | Ga0373962_0003443 | 3300035242 | Bacteria | 3799 |
| 123 | Ga0373925_0198223 | 3300037068 | Bacteria | 1596 |
| 124 | Ga0373925_0299450 | 3300037068 | Bacteria | 1298 |
| 125 | Ga0451791_0326043 | 3300041451 | Bacteria | 824 |
| 126 | Ga0439455_0087943 | 3300042012 | Bacteria | 850 |
| 127 | Ga0466972_0159436 | 3300044658 | Bacteria | 1060 |
| 128 | Ga0466961_0539778 | 3300044693 | Bacteria | 703 |
| 129 | Ga0466970_0078703 | 3300044765 | Bacteria | 1779 |
| 130 | Ga0466960_0028762 | 3300044901 | Bacteria | 2545 |
| 131 | Ga0466960_0240008 | 3300044901 | Bacteria | 1003 |
| 132 | Ga0466967_0836781 | 3300045976 | Bacteria | 914 |
| 133 | Ga0495629_0157934 | 3300046459 | Bacteria | 1575 |
| 134 | Ga0495658_0139892 | 3300046683 | Bacteria | 1480 |
| 135 | Ga0495636_0028591 | 3300047318 | Bacteria | 2275 |
| 136 | Ga0496100_0000227 | 3300048903 | Bacteria | 30068 |
| 137 | Ga0496100_0534089 | 3300048903 | Bacteria | 906 |
| 138 | Ga0496101_0014001 | 3300048904 | Bacteria | 5386 |
| 139 | Ga0496102_0000028 | 3300048905 | Bacteria | 224124 |
| 140 | Ga0496103_0000024 | 3300048906 | Bacteria | 223336 |
| 141 | Ga0496103_0320159 | 3300048906 | Bacteria | 997 |
| 142 | Ga0496104_0057683 | 3300048907 | Bacteria | 3674 |
| 143 | Ga0496104_0156671 | 3300048907 | Bacteria | 2185 |
| 144 | Ga0496105_0014028 | 3300048908 | Bacteria | 6375 |
| 145 | Ga0496105_0022332 | 3300048908 | Bacteria | 5125 |
| 146 | Ga0496106_0638521 | 3300048909 | Bacteria | 851 |
| 147 | Ga0496109_0175629 | 3300048912 | Bacteria | 2010 |
| 148 | Ga0496109_0346720 | 3300048912 | Bacteria | 1403 |
| 149 | Ga0496109_0362618 | 3300048912 | Bacteria | 1369 |
| 150 | Ga0496110_0140705 | 3300048913 | Bacteria | 2181 |
| 151 | Ga0496111_0045393 | 3300048914 | Bacteria | 3161 |
| 152 | Ga0496112_0048348 | 3300048915 | Bacteria | 4170 |
| 153 | Ga0496113_0008403 | 3300048916 | Bacteria | 6726 |
| 154 | Ga0496115_0240276 | 3300048918 | Bacteria | 1493 |
| 155 | Ga0496116_0000154 | 3300048919 | Bacteria | 141052 |
| 156 | Ga0496117_0000081 | 3300048920 | Bacteria | 223343 |
| 157 | Ga0496118_0000062 | 3300048921 | Bacteria | 219267 |
| 158 | Ga0496119_0003586 | 3300048922 | Bacteria | 16007 |
| 159 | Ga0496119_0007482 | 3300048922 | Bacteria | 9820 |
| 160 | Ga0496120_0000586 | 3300048923 | Bacteria | 55320 |
| 161 | Ga0496120_0002478 | 3300048923 | Bacteria | 18582 |
| 162 | Ga0496121_0013136 | 3300048924 | Bacteria | 8932 |
| 163 | Ga0496124_0247366 | 3300048927 | Bacteria | 1321 |
| 164 | Ga0496125_0016164 | 3300048928 | Bacteria | 7176 |
| 165 | Ga0496126_0000148 | 3300048929 | Bacteria | 163288 |
| 166 | Ga0501040_0435064 | 3300049576 | Bacteria | 944 |
| 167 | Ga0501041_0047934 | 3300049577 | Bacteria | 2602 |
| 168 | Ga0501068_0043662 | 3300049584 | Bacteria | 2698 |
| 169 | Ga0501074_0366216 | 3300049590 | Bacteria | 1023 |
| 170 | Ga0501202_055336 | 3300049652 | Bacteria | 887 |
| 171 | Ga0501079_0172105 | 3300049741 | Bacteria | 1689 |
| 172 | nmdc:mga00v17_157205_c1 | 3300050491 | Bacteria | 1462 |
| 173 | nmdc:mga06r32_896777_c1 | 3300050510 | Bacteria | 843 |
| 174 | nmdc:mga08y16_122599_c1 | 3300050511 | Bacteria | 2705 |
| 175 | nmdc:mga0n895_23611_c1 | 3300050512 | Bacteria | 5783 |
| 176 | nmdc:mga0rr50_3943_c1 | 3300050513 | Bacteria | 8633 |
| 177 | nmdc:mga08x19_18082_c1 | 3300050514 | Bacteria | 4319 |
| 178 | Ga0500646_0003785 | 3300053090 | Bacteria | 3867 |
| 179 | Ga0500583_0044260 | 3300053092 | Bacteria | 2038 |
| 180 | Ga0500566_0048590 | 3300053094 | Bacteria | 2432 |
| 181 | Ga0500650_0055969 | 3300053098 | Bacteria | 1837 |
| 182 | Ga0500577_0001594 | 3300053142 | Bacteria | 5811 |
| 183 | Ga0500577_0004628 | 3300053142 | Bacteria | 3655 |
| 184 | Ga0530510_0149692 | 3300061734 | Bacteria | 1723 |
| 185 | 2501943774 | 2501939600 | Bacteria | 6907073 |
| 186 | 2515497773 | 2515154088 | Bacteria | 5526283 |
| 187 | 2515757667 | 2515154137 | Bacteria | 5711575 |
| 188 | 2516091306 | 2515154203 | Bacteria | 5458536 |
| 189 | 2586063691 | 2585427649 | Bacteria | 9053857 |
| 190 | 2795785735 | 2795385470 | Bacteria | 8317180 |
| 191 | 2804849660 | 2802429296 | Bacteria | 7227771 |
| 192 | 2809587047 | 2808606522 | Bacteria | 9488490 |
| 193 | 2844856441 | 2844852863 | Bacteria | 3849151 |
| 194 | 2856863688 | 2856858025 | Bacteria | 7255264 |
| 195 | 2862706511 | 2862705112 | Bacteria | 6563286 |
| 196 | 2884694393 | 2884693830 | Bacteria | 11273186 |
| 197 | 2897562217 | 2897561785 | Bacteria | 3256946 |
| 198 | 2964327386 | 2964326757 | Bacteria | 3290868 |
| 199 | 649814554 | 649633069 | Bacteria | 6962533 |
| 200 | 8003831776 | 8003830390 | Bacteria | 6541657 |
| 201 | 8008489103 | 8008485437 | Bacteria | 7198341 |
| 202 | 8025528586 | 8025524527 | Bacteria | 7197316 |
| 203 | 8054474761 | 8054472261 | Bacteria | 7464355 |
| 204 | 8056040770 | 8056037122 | Bacteria | 3854319 |
| 205 | Ga0075364_10153933 | |||
| 206 | JGI25406J46586_10007329 | |||
| 207 | rootL2_10099245 | |||
| 208 | JGI25405J52794_10000516 | |||
| 209 | Ga0070658_10191564 | |||
| 210 | Ga0070683_101305114 | |||
| 211 | Ga0070670_100043069 | |||
| 212 | Ga0068869_100136160 | |||
| 213 | Ga0070680_100160781 | |||
| 214 | Ga0070682_100042274 | |||
| 215 | Ga0068868_100198506 | |||
| 216 | Ga0070660_100199857 | |||
| 217 | Ga0070689_100014555 | |||
| 218 | Ga0070691_10076327 | |||
| 219 | Ga0070692_10242697 | |||
| 220 | Ga0070668_100134200 | |||
| 221 | Ga0070668_100465505 | |||
| 222 | Ga0070675_100007205 | |||
| 223 | Ga0070671_100001140 | |||
| 224 | Ga0070671_100047277 | |||
| 225 | Ga0070659_100058493 | |||
| 226 | Ga0070713_100014852 | |||
| 227 | Ga0070711_100304989 | |||
| 228 | Ga0070700_100020409 | |||
| 229 | Ga0070663_100010711 | |||
| 230 | Ga0070681_10218162 | |||
| 231 | Ga0070685_10143867 | |||
| 232 | Ga0070679_100168883 | |||
| 233 | Ga0068853_100032249 | |||
| 234 | Ga0070695_100134943 | |||
| 235 | Ga0070693_100001416 | |||
| 236 | Ga0070665_100035945 | |||
| 237 | Ga0070665_100040139 | |||
| 238 | Ga0068855_100036497 | |||
| 239 | Ga0068857_100493717 | |||
| 240 | Ga0068857_100680460 | |||
| 241 | Ga0068856_100859274 | |||
| 242 | Ga0070702_100000419 | |||
| 243 | Ga0068852_100250617 | |||
| 244 | Ga0068859_100387832 | |||
| 245 | Ga0068851_10081063 | |||
| 246 | Ga0068870_10001066 | |||
| 247 | Ga0068863_100006048 | |||
| 248 | Ga0068863_100095991 | |||
| 249 | Ga0068858_100015074 | |||
| 250 | Ga0068862_100288429 | |||
| 251 | Ga0081455_10000111 | |||
| 252 | Ga0081455_10001643 | |||
| 253 | Ga0081455_10225447 | |||
| 254 | Ga0068871_100044102 | |||
| 255 | Ga0075434_100007316 | |||
| 256 | Ga0075436_100374772 | |||
| 257 | Ga0097620_100387846 | |||
| 258 | Ga0075435_100068181 | |||
| 259 | Ga0111539_10075036 | |||
| 260 | Ga0105245_10261527 | |||
| 261 | Ga0105247_10073715 | |||
| 262 | Ga0105241_10004420 | |||
| 263 | Ga0105237_10038489 | |||
| 264 | Ga0105246_10019171 | |||
| 265 | Ga0157371_10025274 | |||
| 266 | Ga0157370_10050635 | |||
| 267 | Ga0157369_11128642 | |||
| 268 | Ga0157372_10534339 | |||
| 269 | Ga0163163_10694445 | |||
| 270 | Ga0163163_10726810 | |||
| 271 | Ga0157377_10016421 | |||
| 272 | Ga0157379_10050688 | |||
| 273 | Ga0157379_10258582 | |||
| 274 | Ga0157376_10213177 | |||
| 275 | Ga0197907_10548731 | |||
| 276 | Ga0207426_1000602 | |||
| 277 | Ga0207426_1001099 | |||
| 278 | Ga0207656_10003960 | |||
| 279 | Ga0207710_10014436 | |||
| 280 | Ga0207688_10003443 | |||
| 281 | Ga0207647_10165137 | |||
| 282 | Ga0207699_10025331 | |||
| 283 | Ga0207645_10044317 | |||
| 284 | Ga0207643_10000037 | |||
| 285 | Ga0207705_10038290 | |||
| 286 | Ga0207654_10003117 | |||
| 287 | Ga0207707_10380576 | |||
| 288 | Ga0207663_10110334 | |||
| 289 | Ga0207660_10008222 | |||
| 290 | Ga0207694_10047035 | |||
| 291 | Ga0207650_10004638 | |||
| 292 | Ga0207659_10051545 | |||
| 293 | Ga0207687_10014781 | |||
| 294 | Ga0207687_10016809 | |||
| 295 | Ga0207700_10008246 | |||
| 296 | Ga0207644_10007386 | |||
| 297 | Ga0207690_10097997 | |||
| 298 | Ga0207711_10030187 | |||
| 299 | Ga0207689_10006532 | |||
| 300 | Ga0207661_10026436 | |||
| 301 | Ga0207679_10005226 | |||
| 302 | Ga0207667_10442480 | |||
| 303 | Ga0207668_10116200 | |||
| 304 | Ga0207658_10015441 | |||
| 305 | Ga0207658_10047613 | |||
| 306 | Ga0207677_10244633 | |||
| 307 | Ga0207678_10000085 | |||
| 308 | Ga0207708_10023076 | |||
| 309 | Ga0207702_10003576 | |||
| 310 | Ga0207641_10005573 | |||
| 311 | Ga0207676_10000476 | |||
| 312 | Ga0207674_10131570 | |||
| 313 | Ga0207674_10577021 | |||
| 314 | Ga0207675_100108934 | |||
| 315 | Ga0207698_10036880 | |||
| 316 | Ga0207428_10033661 | |||
| 317 | Ga0268266_10018670 | |||
| 318 | Ga0268265_10116088 | |||
| 319 | Ga0307515_10058341 | |||
| 320 | Ga0307516_10015289 | |||
| 321 | Ga0307518_10002325 | |||
| 322 | Ga0307406_10330176 | |||
| 323 | Ga0307510_10123771 | |||
| 324 | Ga0373940_0009954 | |||
| 325 | Ga0373951_0000444 | |||
| 326 | Ga0373962_0003443 | |||
| 327 | Ga0373925_0198223 | |||
| 328 | Ga0373925_0299450 | |||
| 329 | Ga0451791_0326043 | |||
| 330 | Ga0439455_0087943 | |||
| 331 | Ga0466972_0159436 | |||
| 332 | Ga0466961_0539778 | |||
| 333 | Ga0466970_0078703 | |||
| 334 | Ga0466960_0028762 | |||
| 335 | Ga0466960_0240008 | |||
| 336 | Ga0466967_0836781 | |||
| 337 | Ga0495629_0157934 | |||
| 338 | Ga0495658_0139892 | |||
| 339 | Ga0495636_0028591 | |||
| 340 | Ga0496100_0000227 | |||
| 341 | Ga0496100_0534089 | |||
| 342 | Ga0496101_0014001 | |||
| 343 | Ga0496102_0000028 | |||
| 344 | Ga0496103_0000024 | |||
| 345 | Ga0496103_0320159 | |||
| 346 | Ga0496104_0057683 | |||
| 347 | Ga0496104_0156671 | |||
| 348 | Ga0496105_0014028 | |||
| 349 | Ga0496105_0022332 | |||
| 350 | Ga0496106_0638521 | |||
| 351 | Ga0496109_0175629 | |||
| 352 | Ga0496109_0346720 | |||
| 353 | Ga0496109_0362618 | |||
| 354 | Ga0496110_0140705 | |||
| 355 | Ga0496111_0045393 | |||
| 356 | Ga0496112_0048348 | |||
| 357 | Ga0496113_0008403 | |||
| 358 | Ga0496115_0240276 | |||
| 359 | Ga0496116_0000154 | |||
| 360 | Ga0496117_0000081 | |||
| 361 | Ga0496118_0000062 | |||
| 362 | Ga0496119_0003586 | |||
| 363 | Ga0496119_0007482 | |||
| 364 | Ga0496120_0000586 | |||
| 365 | Ga0496120_0002478 | |||
| 366 | Ga0496121_0013136 | |||
| 367 | Ga0496124_0247366 | |||
| 368 | Ga0496125_0016164 | |||
| 369 | Ga0496126_0000148 | |||
| 370 | Ga0501040_0435064 | |||
| 371 | Ga0501041_0047934 | |||
| 372 | Ga0501068_0043662 | |||
| 373 | Ga0501074_0366216 | |||
| 374 | Ga0501202_055336 | |||
| 375 | Ga0501079_0172105 | |||
| 376 | nmdc:mga00v17_157205_c1 | |||
| 377 | nmdc:mga06r32_896777_c1 | |||
| 378 | nmdc:mga08y16_122599_c1 | |||
| 379 | nmdc:mga0n895_23611_c1 | |||
| 380 | nmdc:mga0rr50_3943_c1 | |||
| 381 | nmdc:mga08x19_18082_c1 | |||
| 382 | Ga0500646_0003785 | |||
| 383 | Ga0500583_0044260 | |||
| 384 | Ga0500566_0048590 | |||
| 385 | Ga0500650_0055969 | |||
| 386 | Ga0500577_0001594 | |||
| 387 | Ga0500577_0004628 | |||
| 388 | Ga0530510_0149692 | |||
| 389 | 2501943774 | |||
| 390 | 2515497773 | |||
| 391 | 2515757667 | |||
| 392 | 2516091306 | |||
| 393 | 2586063691 | |||
| 394 | 2795785735 | |||
| 395 | 2804849660 | |||
| 396 | 2809587047 | |||
| 397 | 2844856441 | |||
| 398 | 2856863688 | |||
| 399 | 2862706511 | |||
| 400 | 2884694393 | |||
| 401 | 2897562217 | |||
| 402 | 2964327386 | |||
| 403 | 649814554 | |||
| 404 | 8003831776 | |||
| 405 | 8008489103 | |||
| 406 | 8025528586 | |||
| 407 | 8054474761 | |||
| 408 | 8056040770 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2c0z-assembly1.cif.gz_A-2 | the 1.6 a resolution crystal structure of novw: a 4-keto-6-deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of streptomyces spheroides | 0.9787 | 17 | 221 |
| 4hn1-assembly1.cif.gz_B | crystal structure of h60n/y130f double mutant of chmj, a 3'-monoepimerase from streptomyces bikiniensis in complex with dtdp | 0.9747 | 24 | 231 |
| 1upi-assembly1.cif.gz_A | mycobacterium tuberculosis rmlc epimerase (rv3465) | 0.9724 | 20 | 228 |
| 4hn0-assembly1.cif.gz_B | crystal structure of chmj, a 3'-monoepimerase apoenzyme from streptomyces bikiniensis | 0.9667 | 23 | 230 |
| 1upi-assembly1.cif.gz_A | mycobacterium tuberculosis rmlc epimerase (rv3465) | 0.9582 | 20 | 228 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2c0zA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.984 | 20 | 221 | 2.60.120.10 |
| 2c0zA01 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9687 | 20 | 221 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9578 | 17 | 205 | 2.60.120.10 |
| 2ixcB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9526 | 20 | 226 | 2.60.120.10 |
| 5buvB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9471 | 17 | 205 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3XJV0-F1-model_v4 | dTDP-4-keto-6-deoxy-D-glucose epimerase | 0.9951 | 20 | 155 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-B0LJ33-F1-model_v4 | Lct50 | 0.9894 | 20 | 169 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A3N1L4I9-F1-model_v4 | deleted | 0.9879 | 20 | 229 |
|
| AF-A0A2S4YMB9-F1-model_v4 | dTDP-4-dehydrorhamnose 3,5-epimerase | 0.9874 | 22 | 232 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |
| AF-A0A4Y8Y1E2-F1-model_v4 | dTDP-4-keto-6-deoxy-D-glucose epimerase | 0.9862 | 20 | 225 |
GO:0005829
GO:0008830 GO:0019305 GO:0045226 |