F312230

General Info

Members Datasets Scaffolds Average Seq Length
204 114 402 108

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100736941|Ga0070707_1007369411
Length 126
Sequence MVSDRRLQDKVKKSAQPACPTPGKDRPNVLPLEGEIDLHVSANIAASLQMMIEKKPAKLIVDLSRVTYIDSSGLAVLIEGMQNVEEYGGTFALVGLQETVRAIFEIARLDQVFRIFPDTEAALAAS

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
98 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
99 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
102 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
103 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
104 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
105 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.37
Rhizosphere 92.16
Stem 0
Stem Tuber 0
Unclassified 39.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100736941 3300005468 Bacteria 949
2 JGI25406J46586_10011100 3300003203 Unclassified 3962
3 Ga0065712_10237670 3300005290 Unclassified 993
4 Ga0065715_10095465 3300005293 Bacteria 4077
5 Ga0070658_11275517 3300005327 Unclassified 638
6 Ga0070676_10016296 3300005328 Unclassified 4107
7 Ga0070670_100001583 3300005331 Bacteria 18353
8 Ga0070689_101984914 3300005340 Unclassified 532
9 Ga0070675_100550569 3300005354 Unclassified 1043
10 Ga0070671_100024443 3300005355 Unclassified 4945
11 Ga0070671_100265368 3300005355 Unclassified 1459
12 Ga0070674_101786511 3300005356 Bacteria 557
13 Ga0070673_100061589 3300005364 Bacteria 2977
14 Ga0070673_100196576 3300005364 Unclassified 1735
15 Ga0070688_101048709 3300005365 Unclassified 650
16 Ga0070659_100397429 3300005366 Bacteria 1163
17 Ga0070709_10995467 3300005434 Bacteria 667
18 Ga0070709_11193857 3300005434 Unclassified 611
19 Ga0070714_100145252 3300005435 Unclassified 2133
20 Ga0070714_102290116 3300005435 Unclassified 525
21 Ga0070710_10140819 3300005437 Bacteria 1479
22 Ga0070711_100010349 3300005439 Bacteria 5772
23 Ga0070705_100020837 3300005440 Bacteria 3478
24 Ga0070705_100031450 3300005440 Bacteria 2939
25 Ga0070705_100311590 3300005440 Bacteria 1132
26 Ga0070694_101082824 3300005444 Bacteria 668
27 Ga0070708_100002564 3300005445 Bacteria 14059
28 Ga0070708_100095452 3300005445 Bacteria 2715
29 Ga0070708_100096014 3300005445 Bacteria 2707
30 Ga0070708_100145662 3300005445 Unclassified 2200
31 Ga0070708_100855083 3300005445 Bacteria 854
32 Ga0070708_101214364 3300005445 Unclassified 705
33 Ga0070663_100925668 3300005455 Unclassified 754
34 Ga0070663_101962202 3300005455 Unclassified 526
35 Ga0070678_100558712 3300005456 Unclassified 1017
36 Ga0070678_101369112 3300005456 Unclassified 660
37 Ga0070662_101044360 3300005457 Unclassified 700
38 Ga0070685_10020701 3300005466 Bacteria 3563
39 Ga0070706_100000012 3300005467 Bacteria 195040
40 Ga0070706_100026488 3300005467 Bacteria 5334
41 Ga0070706_100048939 3300005467 Bacteria 3901
42 Ga0070706_100059310 3300005467 Bacteria 3531
43 Ga0070706_100060265 3300005467 Bacteria 3503
44 Ga0070706_100273163 3300005467 Bacteria 1577
45 Ga0070706_101061784 3300005467 Bacteria 746
46 Ga0070707_100007221 3300005468 Bacteria 10309
47 Ga0070707_100018091 3300005468 Bacteria 6629
48 Ga0070707_100023453 3300005468 Bacteria 5837
49 Ga0070707_100065239 3300005468 Bacteria 3497
50 Ga0070707_100291874 3300005468 Bacteria 1585
51 Ga0070707_100513709 3300005468 Bacteria 1160
52 Ga0070698_100019622 3300005471 Bacteria 7091
53 Ga0070698_100020883 3300005471 Bacteria 6863
54 Ga0070698_100956973 3300005471 Bacteria 803
55 Ga0070698_102117945 3300005471 Unclassified 516
56 Ga0070699_100085637 3300005518 Bacteria 2750
57 Ga0070699_100132718 3300005518 Bacteria 2196
58 Ga0070699_100199798 3300005518 Unclassified 1777
59 Ga0070699_100228349 3300005518 Bacteria 1660
60 Ga0070697_100006608 3300005536 Bacteria 8989
61 Ga0070697_100020842 3300005536 Bacteria 5190
62 Ga0070697_100034671 3300005536 Bacteria 4070
63 Ga0070697_100043090 3300005536 Bacteria 3653
64 Ga0070697_100143671 3300005536 Unclassified 2008
65 Ga0070697_100167840 3300005536 Unclassified 1856
66 Ga0070697_100580999 3300005536 Archaea 984
67 Ga0070697_100845487 3300005536 Bacteria 811
68 Ga0070672_100010146 3300005543 Bacteria 6521
69 Ga0070672_100363101 3300005543 Bacteria 1236
70 Ga0070672_100406708 3300005543 Unclassified 1167
71 Ga0070695_100016874 3300005545 Bacteria 4426
72 Ga0070696_101236425 3300005546 Unclassified 632
73 Ga0070665_100595610 3300005548 Bacteria 1118
74 Ga0068866_10183243 3300005718 Bacteria 1238
75 Ga0068863_101431321 3300005841 Unclassified 699
76 Ga0068858_102312316 3300005842 Unclassified 531
77 Ga0068860_100213471 3300005843 Bacteria 1872
78 Ga0081455_10931330 3300005937 Unclassified 539
79 Ga0081540_1293642 3300005983 Unclassified 559
80 Ga0081539_10008008 3300005985 Bacteria 9377
81 Ga0081539_10109778 3300005985 Bacteria 1391
82 Ga0070717_10003082 3300006028 Bacteria 11888
83 Ga0070717_10003150 3300006028 Bacteria 11788
84 Ga0070717_10026380 3300006028 Bacteria 4633
85 Ga0070717_10530166 3300006028 Unclassified 1066
86 Ga0070715_10034438 3300006163 Unclassified 2076
87 Ga0070716_100086929 3300006173 Unclassified 1882
88 Ga0070716_100255799 3300006173 Bacteria 1196
89 Ga0070716_101087399 3300006173 Bacteria 637
90 Ga0070716_101437163 3300006173 Unclassified 562
91 Ga0070712_100049541 3300006175 Bacteria 2917
92 Ga0070712_100832563 3300006175 Bacteria 793
93 Ga0068871_100010220 3300006358 Bacteria 6837
94 Ga0075434_100298567 3300006871 Unclassified 1631
95 Ga0068865_100009728 3300006881 Bacteria 5965
96 Ga0068865_100119872 3300006881 Bacteria 1954
97 Ga0075436_100443060 3300006914 Unclassified 945
98 Ga0075435_101028608 3300007076 Unclassified 719
99 Ga0075435_101196931 3300007076 Unclassified 665
100 Ga0105245_10185714 3300009098 Bacteria 1989
101 Ga0105245_13065655 3300009098 Bacteria 518
102 Ga0105242_11468385 3300009176 Unclassified 711
103 Ga0105246_10563466 3300011119 Unclassified 978
104 Ga0157373_10100403 3300013100 Bacteria 2037
105 Ga0157374_10037007 3300013296 Bacteria 4475
106 Ga0157374_10047683 3300013296 Bacteria 3973
107 Ga0157374_10419219 3300013296 Bacteria 1337
108 Ga0157378_10070257 3300013297 Unclassified 3143
109 Ga0157378_10684901 3300013297 Unclassified 1043
110 Ga0157378_11594555 3300013297 Bacteria 698
111 Ga0157378_11670087 3300013297 Unclassified 684
112 Ga0157378_12462488 3300013297 Bacteria 572
113 Ga0163162_10013692 3300013306 Bacteria 7924
114 Ga0163162_10293864 3300013306 Bacteria 1756
115 Ga0157372_10784923 3300013307 Unclassified 1107
116 Ga0157375_10466975 3300013308 Bacteria 1427
117 Ga0157377_10650304 3300014745 Unclassified 759
118 Ga0157376_10130064 3300014969 Bacteria 2245
119 Ga0207697_10000522 3300025315 Bacteria 21681
120 Ga0207697_10301060 3300025315 Unclassified 711
121 Ga0207682_10065577 3300025893 Unclassified 1529
122 Ga0207642_10233675 3300025899 Bacteria 1034
123 Ga0207685_10060578 3300025905 Unclassified 1497
124 Ga0207684_10000028 3300025910 Bacteria 306450
125 Ga0207684_10010255 3300025910 Bacteria 8247
126 Ga0207684_10014633 3300025910 Bacteria 6760
127 Ga0207684_10074552 3300025910 Bacteria 2883
128 Ga0207684_10134943 3300025910 Bacteria 2119
129 Ga0207684_10402103 3300025910 Bacteria 1177
130 Ga0207684_11286171 3300025910 Unclassified 603
131 Ga0207671_10419751 3300025914 Unclassified 1064
132 Ga0207693_10030122 3300025915 Bacteria 4285
133 Ga0207693_10632999 3300025915 Bacteria 831
134 Ga0207663_10008980 3300025916 Bacteria 5261
135 Ga0207657_11389320 3300025919 Unclassified 528
136 Ga0207646_10044103 3300025922 Bacteria 4003
137 Ga0207646_10047849 3300025922 Bacteria 3834
138 Ga0207646_10068320 3300025922 Unclassified 3173
139 Ga0207646_10308451 3300025922 Bacteria 1430
140 Ga0207646_11353808 3300025922 Unclassified 620
141 Ga0207681_10033671 3300025923 Bacteria 3361
142 Ga0207650_10332885 3300025925 Bacteria 1246
143 Ga0207659_10047161 3300025926 Unclassified 3047
144 Ga0207659_10459969 3300025926 Unclassified 1073
145 Ga0207687_10462080 3300025927 Bacteria 1054
146 Ga0207664_10080251 3300025929 Bacteria 2651
147 Ga0207644_10104325 3300025931 Bacteria 2134
148 Ga0207644_10543510 3300025931 Bacteria 961
149 Ga0207706_11107522 3300025933 Unclassified 661
150 Ga0207670_10850977 3300025936 Unclassified 762
151 Ga0207669_10029185 3300025937 Bacteria 3046
152 Ga0207669_10261362 3300025937 Bacteria 1295
153 Ga0207704_10012856 3300025938 Bacteria 4167
154 Ga0207665_10108479 3300025939 Bacteria 1948
155 Ga0207665_10663261 3300025939 Unclassified 818
156 Ga0207665_11541198 3300025939 Bacteria 528
157 Ga0207691_10003407 3300025940 Bacteria 15455
158 Ga0207691_10528522 3300025940 Bacteria 1001
159 Ga0207691_10531867 3300025940 Unclassified 997
160 Ga0207651_10107220 3300025960 Bacteria 2088
161 Ga0207651_10159882 3300025960 Bacteria 1765
162 Ga0207651_10606137 3300025960 Unclassified 958
163 Ga0207668_10046030 3300025972 Bacteria 2978
164 Ga0207677_11682567 3300026023 Unclassified 588
165 Ga0207678_10718179 3300026067 Unclassified 880
166 Ga0207678_11507654 3300026067 Unclassified 593
167 Ga0207648_10020659 3300026089 Bacteria 5927
168 Ga0207676_10677812 3300026095 Unclassified 997
169 Ga0207683_10012576 3300026121 Bacteria 7221
170 Ga0207683_10856344 3300026121 Bacteria 844
171 Ga0307513_10106352 3300031456 Bacteria 2812
172 Ga0373952_0157350 3300035092 Bacteria 641
173 Ga0373943_0370797 3300035170 Bacteria 823
174 Ga0373943_0762942 3300035170 Unclassified 575
175 Ga0373927_0521199 3300035695 Bacteria 786
176 Ga0373927_0919659 3300035695 Unclassified 577
177 Ga0373947_0028392 3300035725 Unclassified 3280
178 Ga0373947_0699579 3300035725 Bacteria 691
179 Ga0373925_1618581 3300037068 Unclassified 529
180 Ga0395899_0715518 3300037312 Unclassified 627
181 Ga0451807_1059004 3300041486 Bacteria 515
182 Ga0451835_0551846 3300041492 Bacteria 712
183 Ga0451839_0386571 3300041496 Bacteria 524
184 Ga0466967_0409356 3300045976 Unclassified 1320
185 Ga0495580_0472858 3300046472 Bacteria 839
186 Ga0495598_0199873 3300046537 Bacteria 721
187 Ga0495588_0265281 3300046674 Bacteria 905
188 Ga0495684_0844881 3300047471 Bacteria 594
189 Ga0496101_0798852 3300048904 Unclassified 744
190 Ga0496104_0104670 3300048907 Bacteria 2712
191 Ga0496104_0872814 3300048907 Unclassified 805
192 Ga0496104_1441301 3300048907 Unclassified 592
193 Ga0496106_1098009 3300048909 Unclassified 623
194 Ga0496108_0779152 3300048911 Bacteria 826
195 Ga0496109_0095537 3300048912 Unclassified 2752
196 Ga0496109_0329357 3300048912 Unclassified 1442
197 Ga0496110_0143897 3300048913 Unclassified 2156
198 Ga0496111_0203142 3300048914 Unclassified 1473
199 Ga0496112_0113353 3300048915 Unclassified 2682
200 Ga0496115_0017827 3300048918 Bacteria 5437
201 nmdc:mga0rr50_503443_c1 3300050513 Bacteria 1030
202 Ga0070707_100736941
203 JGI25406J46586_10011100
204 Ga0065712_10237670
205 Ga0065715_10095465
206 Ga0070658_11275517
207 Ga0070676_10016296
208 Ga0070670_100001583
209 Ga0070689_101984914
210 Ga0070675_100550569
211 Ga0070671_100024443
212 Ga0070671_100265368
213 Ga0070674_101786511
214 Ga0070673_100061589
215 Ga0070673_100196576
216 Ga0070688_101048709
217 Ga0070659_100397429
218 Ga0070709_10995467
219 Ga0070709_11193857
220 Ga0070714_100145252
221 Ga0070714_102290116
222 Ga0070710_10140819
223 Ga0070711_100010349
224 Ga0070705_100020837
225 Ga0070705_100031450
226 Ga0070705_100311590
227 Ga0070694_101082824
228 Ga0070708_100002564
229 Ga0070708_100095452
230 Ga0070708_100096014
231 Ga0070708_100145662
232 Ga0070708_100855083
233 Ga0070708_101214364
234 Ga0070663_100925668
235 Ga0070663_101962202
236 Ga0070678_100558712
237 Ga0070678_101369112
238 Ga0070662_101044360
239 Ga0070685_10020701
240 Ga0070706_100000012
241 Ga0070706_100026488
242 Ga0070706_100048939
243 Ga0070706_100059310
244 Ga0070706_100060265
245 Ga0070706_100273163
246 Ga0070706_101061784
247 Ga0070707_100007221
248 Ga0070707_100018091
249 Ga0070707_100023453
250 Ga0070707_100065239
251 Ga0070707_100291874
252 Ga0070707_100513709
253 Ga0070698_100019622
254 Ga0070698_100020883
255 Ga0070698_100956973
256 Ga0070698_102117945
257 Ga0070699_100085637
258 Ga0070699_100132718
259 Ga0070699_100199798
260 Ga0070699_100228349
261 Ga0070697_100006608
262 Ga0070697_100020842
263 Ga0070697_100034671
264 Ga0070697_100043090
265 Ga0070697_100143671
266 Ga0070697_100167840
267 Ga0070697_100580999
268 Ga0070697_100845487
269 Ga0070672_100010146
270 Ga0070672_100363101
271 Ga0070672_100406708
272 Ga0070695_100016874
273 Ga0070696_101236425
274 Ga0070665_100595610
275 Ga0068866_10183243
276 Ga0068863_101431321
277 Ga0068858_102312316
278 Ga0068860_100213471
279 Ga0081455_10931330
280 Ga0081540_1293642
281 Ga0081539_10008008
282 Ga0081539_10109778
283 Ga0070717_10003082
284 Ga0070717_10003150
285 Ga0070717_10026380
286 Ga0070717_10530166
287 Ga0070715_10034438
288 Ga0070716_100086929
289 Ga0070716_100255799
290 Ga0070716_101087399
291 Ga0070716_101437163
292 Ga0070712_100049541
293 Ga0070712_100832563
294 Ga0068871_100010220
295 Ga0075434_100298567
296 Ga0068865_100009728
297 Ga0068865_100119872
298 Ga0075436_100443060
299 Ga0075435_101028608
300 Ga0075435_101196931
301 Ga0105245_10185714
302 Ga0105245_13065655
303 Ga0105242_11468385
304 Ga0105246_10563466
305 Ga0157373_10100403
306 Ga0157374_10037007
307 Ga0157374_10047683
308 Ga0157374_10419219
309 Ga0157378_10070257
310 Ga0157378_10684901
311 Ga0157378_11594555
312 Ga0157378_11670087
313 Ga0157378_12462488
314 Ga0163162_10013692
315 Ga0163162_10293864
316 Ga0157372_10784923
317 Ga0157375_10466975
318 Ga0157377_10650304
319 Ga0157376_10130064
320 Ga0207697_10000522
321 Ga0207697_10301060
322 Ga0207682_10065577
323 Ga0207642_10233675
324 Ga0207685_10060578
325 Ga0207684_10000028
326 Ga0207684_10010255
327 Ga0207684_10014633
328 Ga0207684_10074552
329 Ga0207684_10134943
330 Ga0207684_10402103
331 Ga0207684_11286171
332 Ga0207671_10419751
333 Ga0207693_10030122
334 Ga0207693_10632999
335 Ga0207663_10008980
336 Ga0207657_11389320
337 Ga0207646_10044103
338 Ga0207646_10047849
339 Ga0207646_10068320
340 Ga0207646_10308451
341 Ga0207646_11353808
342 Ga0207681_10033671
343 Ga0207650_10332885
344 Ga0207659_10047161
345 Ga0207659_10459969
346 Ga0207687_10462080
347 Ga0207664_10080251
348 Ga0207644_10104325
349 Ga0207644_10543510
350 Ga0207706_11107522
351 Ga0207670_10850977
352 Ga0207669_10029185
353 Ga0207669_10261362
354 Ga0207704_10012856
355 Ga0207665_10108479
356 Ga0207665_10663261
357 Ga0207665_11541198
358 Ga0207691_10003407
359 Ga0207691_10528522
360 Ga0207691_10531867
361 Ga0207651_10107220
362 Ga0207651_10159882
363 Ga0207651_10606137
364 Ga0207668_10046030
365 Ga0207677_11682567
366 Ga0207678_10718179
367 Ga0207678_11507654
368 Ga0207648_10020659
369 Ga0207676_10677812
370 Ga0207683_10012576
371 Ga0207683_10856344
372 Ga0307513_10106352
373 Ga0373952_0157350
374 Ga0373943_0370797
375 Ga0373943_0762942
376 Ga0373927_0521199
377 Ga0373927_0919659
378 Ga0373947_0028392
379 Ga0373947_0699579
380 Ga0373925_1618581
381 Ga0395899_0715518
382 Ga0451807_1059004
383 Ga0451835_0551846
384 Ga0451839_0386571
385 Ga0466967_0409356
386 Ga0495580_0472858
387 Ga0495598_0199873
388 Ga0495588_0265281
389 Ga0495684_0844881
390 Ga0496101_0798852
391 Ga0496104_0104670
392 Ga0496104_0872814
393 Ga0496104_1441301
394 Ga0496106_1098009
395 Ga0496108_0779152
396 Ga0496109_0095537
397 Ga0496109_0329357
398 Ga0496110_0143897
399 Ga0496111_0203142
400 Ga0496112_0113353
401 Ga0496115_0017827
402 nmdc:mga0rr50_503443_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

19

122

0.95

PF13466

STAS_2

STAS domain

30

110

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vc1-assembly1.cif.gz_B crystal structure of the tm1442 protein from thermotoga maritima, a homolog of the bacillus subtilis general stress response anti-anti-sigma factor rsbv 0.9497 20 113
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9465 20 108
6m36-assembly1.cif.gz_F the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9409 20 104
1th8-assembly1.cif.gz_B crystal structures of the adp and atp bound forms of the bacillus anti-sigma factor spoiiab in complex with the anti-anti-sigma spoiiaa: inhibitory complex with adp, crystal form ii 0.9264 20 116
4qtp-assembly3.cif.gz_C crystal structure of an anti-sigma factor antagonist from mycobacterium paratuberculosis 0.9258 20 116
ID Description Score Start End Superfamily
af_I1KA21_504_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9265 20 116 3.30.750.24
af_P60070_1_106_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9252 20 106 3.30.750.24
4qtpB00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.921 20 116 3.30.750.24
af_A0A0N7KGR6_2_88_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9189 48 116 3.30.750.24
1tidD00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.9187 20 116 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A2V6GXU5-F1-model_v4 Anti-sigma factor antagonist 0.9939 20 116 GO:0043856
AF-A0A2V5P1S2-F1-model_v4 Anti-sigma factor antagonist 0.9931 20 114 GO:0043856
AF-A0A7C3PED9-F1-model_v4 Anti-sigma factor antagonist 0.9931 20 116 GO:0043856
AF-A0A1Q8A2H4-F1-model_v4 Anti-sigma factor antagonist 0.9921 19 106 GO:0043856
AF-A0A483CS17-F1-model_v4 Anti-sigma factor antagonist 0.9917 20 117 GO:0043856

Map