F312221

General Info

Members Datasets Scaffolds Average Seq Length
204 136 408 304

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100071166|Ga0070706_1000711663
Length 327
Sequence MVEITREESMTCTADVARAVLRTVSATCALILVAASARAQAPRATPPAMAPGTPLRIIAFGAHPDDCELDAAGVAAKWAAAGHKFKCVAVTNGDIGHWGSAGGPLAMRRRAETEAAAKILGIETEVLDNHDGELMVTLENRRKIARLIRDWRADIVISHRPNDYHPDHRYTGVLVMDAAYMVQVPYFTPEVPPLKRNPVFLFSEDRFQKPNPFSGDIVVSIDDVVDKKLAVVEAMPSQFYEGGCCDMPAGGLATDAAGKAARAKEVRDRFTRRFASTADRFRNRLAEWYGPEQAARIKYAEAFEVCEYGRQPSKDEIRQLFPFFGSR

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
101 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
102 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
103 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
104 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
105 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
119 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
120 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
121 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
125 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
136 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.47
Nodule 0
Rhizoplane 0.49
Rhizosphere 97.55
Stem 0
Stem Tuber 0
Unclassified 13.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100071166 3300005467 Bacteria 3216
2 Ga0065715_10031225 3300005293 Bacteria 1998
3 Ga0070690_100051874 3300005330 Bacteria 2620
4 Ga0070670_100102523 3300005331 Bacteria 2464
5 Ga0070666_10226088 3300005335 Bacteria 1321
6 Ga0070689_100000199 3300005340 Bacteria 35970
7 Ga0070689_100014069 3300005340 Bacteria 5804
8 Ga0070689_100031709 3300005340 Bacteria 4017
9 Ga0070669_100237964 3300005353 Bacteria 1445
10 Ga0070675_100060134 3300005354 Bacteria 3136
11 Ga0070688_100052582 3300005365 Bacteria 2545
12 Ga0070659_100251050 3300005366 Bacteria 1466
13 Ga0070667_100046622 3300005367 Bacteria 3647
14 Ga0070703_10017574 3300005406 Bacteria 2060
15 Ga0070713_100095333 3300005436 Bacteria 2567
16 Ga0070701_10050222 3300005438 Bacteria 2159
17 Ga0070705_100004071 3300005440 Bacteria 7138
18 Ga0070694_100004408 3300005444 Bacteria 8464
19 Ga0070694_100057018 3300005444 Bacteria 2655
20 Ga0070708_100041517 3300005445 Bacteria 4033
21 Ga0070708_100156494 3300005445 Bacteria 2122
22 Ga0070678_100027515 3300005456 Bacteria 3862
23 Ga0070685_10100991 3300005466 Bacteria 1762
24 Ga0070706_100009501 3300005467 Bacteria 9045
25 Ga0070706_100193740 3300005467 Bacteria 1899
26 Ga0070707_100024942 3300005468 Bacteria 5669
27 Ga0070707_100041448 3300005468 Bacteria 4407
28 Ga0070707_100074858 3300005468 Bacteria 3265
29 Ga0070699_100011148 3300005518 Bacteria 7769
30 Ga0070697_100013351 3300005536 Bacteria 6443
31 Ga0070672_100028827 3300005543 Bacteria 4156
32 Ga0070686_100001899 3300005544 Bacteria 11623
33 Ga0070686_100003599 3300005544 Bacteria 8502
34 Ga0070686_100039559 3300005544 Bacteria 2939
35 Ga0070695_100019751 3300005545 Bacteria 4107
36 Ga0070695_100052648 3300005545 Bacteria 2616
37 Ga0070665_100000659 3300005548 Bacteria 46546
38 Ga0070704_100002042 3300005549 Bacteria 11190
39 Ga0070664_100036579 3300005564 Bacteria 4125
40 Ga0068857_100193240 3300005577 Bacteria 1854
41 Ga0068854_100384829 3300005578 Bacteria 1157
42 Ga0068859_100009066 3300005617 Bacteria 10047
43 Ga0068859_100110131 3300005617 Bacteria 2815
44 Ga0068861_100198418 3300005719 Bacteria 1683
45 Ga0068861_100208071 3300005719 Bacteria 1646
46 Ga0068870_10110303 3300005840 Bacteria 1570
47 Ga0068863_100041097 3300005841 Bacteria 4395
48 Ga0068858_100084022 3300005842 Bacteria 2961
49 Ga0068862_100060709 3300005844 Bacteria 3248
50 Ga0081455_10054663 3300005937 Unclassified 3401
51 Ga0081540_1063088 3300005983 Unclassified 1755
52 Ga0075367_10002302 3300006178 Bacteria 8671
53 Ga0075367_10017199 3300006178 Bacteria 3964
54 Ga0075366_10001477 3300006195 Bacteria 11717
55 Ga0097621_100376745 3300006237 Bacteria 1267
56 Ga0075428_100100516 3300006844 Bacteria 3153
57 Ga0075430_100020497 3300006846 Bacteria 5624
58 Ga0075433_10012353 3300006852 Bacteria 6894
59 Ga0075433_10071471 3300006852 Bacteria 3050
60 Ga0075433_10271728 3300006852 Bacteria 1502
61 Ga0075434_100002588 3300006871 Bacteria 15973
62 Ga0075434_100083569 3300006871 Bacteria 3190
63 Ga0075434_100170220 3300006871 Bacteria 2198
64 Ga0068865_100026755 3300006881 Bacteria 3804
65 Ga0075436_100102612 3300006914 Bacteria 1992
66 Ga0097620_100009066 3300006931 Bacteria 10047
67 Ga0097620_100110130 3300006931 Bacteria 2815
68 Ga0111539_10004766 3300009094 Bacteria 17704
69 Ga0111539_10033179 3300009094 Bacteria 6269
70 Ga0114129_10018485 3300009147 Bacteria 9925
71 Ga0114129_10138095 3300009147 Bacteria 3344
72 Ga0114129_10155838 3300009147 Bacteria 3124
73 Ga0114129_10202370 3300009147 Bacteria 2689
74 Ga0114129_10662215 3300009147 Unclassified 1346
75 Ga0105243_10065425 3300009148 Bacteria 2921
76 Ga0105241_10338719 3300009174 Archaea 1302
77 Ga0105248_10018248 3300009177 Bacteria 7747
78 Ga0105238_10143230 3300009551 Unclassified 2367
79 Ga0157380_10006055 3300014326 Bacteria 8475
80 Ga0157379_10160954 3300014968 Bacteria 2026
81 Ga0207653_10008387 3300025885 Bacteria 3219
82 Ga0207642_10020961 3300025899 Bacteria 2563
83 Ga0207680_10216865 3300025903 Bacteria 1310
84 Ga0207643_10020913 3300025908 Bacteria 3592
85 Ga0207684_10001733 3300025910 Bacteria 23087
86 Ga0207684_10066216 3300025910 Bacteria 3068
87 Ga0207684_10138440 3300025910 Bacteria 2091
88 Ga0207684_10358434 3300025910 Bacteria 1255
89 Ga0207660_10093249 3300025917 Bacteria 2237
90 Ga0207662_10000440 3300025918 Bacteria 18440
91 Ga0207646_10010304 3300025922 Bacteria 9142
92 Ga0207646_10017212 3300025922 Bacteria 6770
93 Ga0207646_10045883 3300025922 Bacteria 3921
94 Ga0207646_10159408 3300025922 Bacteria 2036
95 Ga0207681_10086287 3300025923 Bacteria 2230
96 Ga0207650_10028775 3300025925 Bacteria 3988
97 Ga0207659_10021676 3300025926 Bacteria 4269
98 Ga0207687_10232436 3300025927 Bacteria 1457
99 Ga0207709_10213409 3300025935 Bacteria 1387
100 Ga0207670_10005676 3300025936 Bacteria 6871
101 Ga0207670_10007729 3300025936 Bacteria 6027
102 Ga0207691_10029469 3300025940 Bacteria 5135
103 Ga0207711_10035963 3300025941 Bacteria 4200
104 Ga0207689_10053185 3300025942 Bacteria 3336
105 Ga0207679_10033032 3300025945 Bacteria 3639
106 Ga0207712_10066143 3300025961 Bacteria 2583
107 Ga0207640_10066240 3300025981 Bacteria 2413
108 Ga0207677_10125401 3300026023 Bacteria 1940
109 Ga0207703_10466861 3300026035 Bacteria 1181
110 Ga0207708_10058298 3300026075 Bacteria 2946
111 Ga0207676_10056821 3300026095 Bacteria 3079
112 Ga0207674_10213522 3300026116 Bacteria 1878
113 Ga0207675_100055611 3300026118 Bacteria 3692
114 Ga0207675_100082207 3300026118 Bacteria 3021
115 Ga0207683_10038246 3300026121 Bacteria 4181
116 Ga0207698_10238019 3300026142 Bacteria 1657
117 Ga0207428_10000424 3300027907 Bacteria 52253
118 Ga0207428_10099453 3300027907 Unclassified 2249
119 Ga0268266_10000484 3300028379 Bacteria 57173
120 Ga0268265_10170523 3300028380 Bacteria 1859
121 Ga0268264_10110341 3300028381 Bacteria 2408
122 Ga0265320_10029881 3300031240 Unclassified 2816
123 Ga0307408_100051650 3300031548 Unclassified 2962
124 Ga0307408_100415313 3300031548 Bacteria 1159
125 Ga0307408_100428498 3300031548 Unclassified 1142
126 Ga0307405_10036897 3300031731 Unclassified 2933
127 Ga0307405_10235752 3300031731 Unclassified 1352
128 Ga0307410_10107219 3300031852 Unclassified 2014
129 Ga0307410_10179561 3300031852 Bacteria 1602
130 Ga0307407_10269357 3300031903 Bacteria 1175
131 Ga0307409_100025203 3300031995 Unclassified 4166
132 Ga0307416_100090582 3300032002 Bacteria 2623
133 Ga0307416_100328510 3300032002 Unclassified 1535
134 Ga0307416_100616817 3300032002 Bacteria 1166
135 Ga0307415_100048515 3300032126 Unclassified 2866
136 Ga0373943_0060505 3300035170 Unclassified 1891
137 Ga0373925_0101282 3300037068 Unclassified 2215
138 Ga0395905_0341284 3300037471 Unclassified 1389
139 Ga0436365_0475247 3300039437 Unclassified 3752
140 Ga0439462_0027405 3300042015 Bacteria 1504
141 Ga0450920_015985 3300042122 Bacteria 1428
142 Ga0450923_001168 3300042125 Bacteria 3359
143 Ga0439435_0011562 3300042436 Bacteria 2120
144 Ga0451577_0014125 3300042876 Bacteria 7448
145 Ga0451577_0049335 3300042876 Bacteria 3759
146 Ga0451577_0183956 3300042876 Bacteria 1884
147 Ga0451577_0223041 3300042876 Unclassified 1704
148 Ga0451577_0300555 3300042876 Bacteria 1454
149 Ga0451577_0387094 3300042876 Bacteria 1269
150 Ga0453683_0001717 3300044673 Bacteria 18210
151 Ga0453683_0169231 3300044673 Bacteria 1384
152 Ga0453683_0197154 3300044673 Bacteria 1278
153 Ga0453684_0000328 3300044712 Bacteria 199181
154 Ga0453684_0007214 3300044712 Bacteria 20610
155 Ga0453684_0023489 3300044712 Bacteria 9074
156 Ga0453684_0040130 3300044712 Bacteria 6365
157 Ga0453684_0069729 3300044712 Unclassified 4457
158 Ga0453684_0077147 3300044712 Bacteria 4180
159 Ga0453684_0085279 3300044712 Bacteria 3925
160 Ga0453684_0085856 3300044712 Bacteria 3909
161 Ga0453684_0101071 3300044712 Unclassified 3528
162 Ga0453684_0264573 3300044712 Bacteria 1968
163 Ga0451576_0000190 3300045051 Bacteria 154484
164 Ga0451576_0004151 3300045051 Bacteria 19073
165 Ga0451576_0131012 3300045051 Bacteria 2614
166 Ga0451576_0162246 3300045051 Bacteria 2333
167 Ga0495580_0210389 3300046472 Bacteria 1338
168 Ga0495586_0121783 3300046535 Bacteria 1458
169 Ga0495667_0018686 3300046559 Bacteria 4680
170 Ga0495657_0039281 3300046675 Bacteria 3253
171 Ga0495669_0005982 3300046684 Bacteria 5072
172 Ga0495684_0035566 3300047471 Bacteria 3819
173 Ga0496104_0364346 3300048907 Unclassified 1358
174 Ga0501036_0120603 3300049572 Bacteria 2215
175 Ga0501048_0209032 3300049582 Bacteria 1384
176 Ga0501071_0027802 3300049587 Bacteria 3982
177 Ga0501071_0040399 3300049587 Bacteria 3338
178 Ga0501071_0074593 3300049587 Unclassified 2476
179 Ga0501072_0039160 3300049588 Bacteria 3723
180 Ga0501075_0044248 3300049591 Bacteria 3340
181 Ga0501076_0015356 3300049592 Bacteria 5787
182 Ga0501076_0147975 3300049592 Unclassified 1910
183 Ga0501079_0075999 3300049741 Unclassified 2598
184 Ga0501079_0127248 3300049741 Bacteria 1982
185 Ga0501080_0354100 3300049742 Unclassified 1325
186 Ga0501081_0041735 3300049743 Bacteria 3143
187 Ga0501045_0265828 3300049824 Bacteria 1277
188 nmdc:mga05p37_37699_c2 3300050507 Bacteria 4679
189 nmdc:mga05p37_451062_c1 3300050507 Bacteria 1489
190 nmdc:mga06r32_81220_c1 3300050510 Bacteria 3157
191 nmdc:mga08y16_89806_c1 3300050511 Bacteria 3202
192 nmdc:mga0n895_1585_c1 3300050512 Bacteria 17095
193 nmdc:mga0n895_277405_c1 3300050512 Bacteria 1700
194 nmdc:mga0n895_87923_c1 3300050512 Bacteria 3106
195 nmdc:mga0rr50_490851_c1 3300050513 Unclassified 1043
196 nmdc:mga08x19_55621_c1 3300050514 Bacteria 2551
197 nmdc:mga0a205_17631_c2 3300050515 Bacteria 5474
198 nmdc:mga0a205_67171_c1 3300050515 Bacteria 3464
199 Ga0590071_000128 3300059421 Bacteria 21203
200 Ga0590075_000332 3300059424 Bacteria 13166
201 Ga0590075_009196 3300059424 Bacteria 2365
202 Ga0590077_000204 3300059426 Bacteria 17184
203 Ga0590077_025896 3300059426 Unclassified 1265
204 Ga0501082_0015530 3300060353 Bacteria 6556
205 Ga0070706_100071166
206 Ga0065715_10031225
207 Ga0070690_100051874
208 Ga0070670_100102523
209 Ga0070666_10226088
210 Ga0070689_100000199
211 Ga0070689_100014069
212 Ga0070689_100031709
213 Ga0070669_100237964
214 Ga0070675_100060134
215 Ga0070688_100052582
216 Ga0070659_100251050
217 Ga0070667_100046622
218 Ga0070703_10017574
219 Ga0070713_100095333
220 Ga0070701_10050222
221 Ga0070705_100004071
222 Ga0070694_100004408
223 Ga0070694_100057018
224 Ga0070708_100041517
225 Ga0070708_100156494
226 Ga0070678_100027515
227 Ga0070685_10100991
228 Ga0070706_100009501
229 Ga0070706_100193740
230 Ga0070707_100024942
231 Ga0070707_100041448
232 Ga0070707_100074858
233 Ga0070699_100011148
234 Ga0070697_100013351
235 Ga0070672_100028827
236 Ga0070686_100001899
237 Ga0070686_100003599
238 Ga0070686_100039559
239 Ga0070695_100019751
240 Ga0070695_100052648
241 Ga0070665_100000659
242 Ga0070704_100002042
243 Ga0070664_100036579
244 Ga0068857_100193240
245 Ga0068854_100384829
246 Ga0068859_100009066
247 Ga0068859_100110131
248 Ga0068861_100198418
249 Ga0068861_100208071
250 Ga0068870_10110303
251 Ga0068863_100041097
252 Ga0068858_100084022
253 Ga0068862_100060709
254 Ga0081455_10054663
255 Ga0081540_1063088
256 Ga0075367_10002302
257 Ga0075367_10017199
258 Ga0075366_10001477
259 Ga0097621_100376745
260 Ga0075428_100100516
261 Ga0075430_100020497
262 Ga0075433_10012353
263 Ga0075433_10071471
264 Ga0075433_10271728
265 Ga0075434_100002588
266 Ga0075434_100083569
267 Ga0075434_100170220
268 Ga0068865_100026755
269 Ga0075436_100102612
270 Ga0097620_100009066
271 Ga0097620_100110130
272 Ga0111539_10004766
273 Ga0111539_10033179
274 Ga0114129_10018485
275 Ga0114129_10138095
276 Ga0114129_10155838
277 Ga0114129_10202370
278 Ga0114129_10662215
279 Ga0105243_10065425
280 Ga0105241_10338719
281 Ga0105248_10018248
282 Ga0105238_10143230
283 Ga0157380_10006055
284 Ga0157379_10160954
285 Ga0207653_10008387
286 Ga0207642_10020961
287 Ga0207680_10216865
288 Ga0207643_10020913
289 Ga0207684_10001733
290 Ga0207684_10066216
291 Ga0207684_10138440
292 Ga0207684_10358434
293 Ga0207660_10093249
294 Ga0207662_10000440
295 Ga0207646_10010304
296 Ga0207646_10017212
297 Ga0207646_10045883
298 Ga0207646_10159408
299 Ga0207681_10086287
300 Ga0207650_10028775
301 Ga0207659_10021676
302 Ga0207687_10232436
303 Ga0207709_10213409
304 Ga0207670_10005676
305 Ga0207670_10007729
306 Ga0207691_10029469
307 Ga0207711_10035963
308 Ga0207689_10053185
309 Ga0207679_10033032
310 Ga0207712_10066143
311 Ga0207640_10066240
312 Ga0207677_10125401
313 Ga0207703_10466861
314 Ga0207708_10058298
315 Ga0207676_10056821
316 Ga0207674_10213522
317 Ga0207675_100055611
318 Ga0207675_100082207
319 Ga0207683_10038246
320 Ga0207698_10238019
321 Ga0207428_10000424
322 Ga0207428_10099453
323 Ga0268266_10000484
324 Ga0268265_10170523
325 Ga0268264_10110341
326 Ga0265320_10029881
327 Ga0307408_100051650
328 Ga0307408_100415313
329 Ga0307408_100428498
330 Ga0307405_10036897
331 Ga0307405_10235752
332 Ga0307410_10107219
333 Ga0307410_10179561
334 Ga0307407_10269357
335 Ga0307409_100025203
336 Ga0307416_100090582
337 Ga0307416_100328510
338 Ga0307416_100616817
339 Ga0307415_100048515
340 Ga0373943_0060505
341 Ga0373925_0101282
342 Ga0395905_0341284
343 Ga0436365_0475247
344 Ga0439462_0027405
345 Ga0450920_015985
346 Ga0450923_001168
347 Ga0439435_0011562
348 Ga0451577_0014125
349 Ga0451577_0049335
350 Ga0451577_0183956
351 Ga0451577_0223041
352 Ga0451577_0300555
353 Ga0451577_0387094
354 Ga0453683_0001717
355 Ga0453683_0169231
356 Ga0453683_0197154
357 Ga0453684_0000328
358 Ga0453684_0007214
359 Ga0453684_0023489
360 Ga0453684_0040130
361 Ga0453684_0069729
362 Ga0453684_0077147
363 Ga0453684_0085279
364 Ga0453684_0085856
365 Ga0453684_0101071
366 Ga0453684_0264573
367 Ga0451576_0000190
368 Ga0451576_0004151
369 Ga0451576_0131012
370 Ga0451576_0162246
371 Ga0495580_0210389
372 Ga0495586_0121783
373 Ga0495667_0018686
374 Ga0495657_0039281
375 Ga0495669_0005982
376 Ga0495684_0035566
377 Ga0496104_0364346
378 Ga0501036_0120603
379 Ga0501048_0209032
380 Ga0501071_0027802
381 Ga0501071_0040399
382 Ga0501071_0074593
383 Ga0501072_0039160
384 Ga0501075_0044248
385 Ga0501076_0015356
386 Ga0501076_0147975
387 Ga0501079_0075999
388 Ga0501079_0127248
389 Ga0501080_0354100
390 Ga0501081_0041735
391 Ga0501045_0265828
392 nmdc:mga05p37_37699_c2
393 nmdc:mga05p37_451062_c1
394 nmdc:mga06r32_81220_c1
395 nmdc:mga08y16_89806_c1
396 nmdc:mga0n895_1585_c1
397 nmdc:mga0n895_277405_c1
398 nmdc:mga0n895_87923_c1
399 nmdc:mga0rr50_490851_c1
400 nmdc:mga08x19_55621_c1
401 nmdc:mga0a205_17631_c2
402 nmdc:mga0a205_67171_c1
403 Ga0590071_000128
404 Ga0590075_000332
405 Ga0590075_009196
406 Ga0590077_000204
407 Ga0590077_025896
408 Ga0501082_0015530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

58

179

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ixd-assembly1.cif.gz_A crystal structure of the putative deacetylase bc1534 from bacillus cereus 0.8421 35 295
3we7-assembly1.cif.gz_A crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii 0.8389 36 284
1uan-assembly1.cif.gz_A crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.8373 36 292
2ixd-assembly1.cif.gz_A crystal structure of the putative deacetylase bc1534 from bacillus cereus 0.826 35 295
6p2t-assembly1.cif.gz_A bshb from bacillus subtilis complexed with citrate 0.8198 38 295
ID Description Score Start End Superfamily
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8421 35 295 3.40.50.10320
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8347 33 284 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8227 35 295 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.813 37 292 3.40.50.10320
af_A4HTS2_27_235_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7973 33 162 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A7Y4UA34-F1-model_v4 PIG-L family deacetylase 0.9975 35 300 GO:0016811
AF-A0A6J4KA19-F1-model_v4 LmbE family protein 0.9958 35 301 GO:0016811
AF-A0A3D3PCP4-F1-model_v4 Carbohydrate-binding protein 0.9942 45 302 GO:0016811
AF-A0A0S8E943-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9914 32 212 GO:0016811
AF-H5SCT9-F1-model_v4 Hypothetical conserved protein 0.9862 32 220 GO:0016811

Map