F312168

General Info

Members Datasets Scaffolds Average Seq Length
204 83 408 109

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100005262|Ga0070667_1000052628
Length 129
Sequence MSDAESPAPDVHAAALAFNAAIELTSFPEVAEQLGMVVTNVHQLVRDGHLVAIRDAEGIRRIPSLLIQDGVIVKGVTGVITVLRDAKFTDEEIVDWLHRADDSLPGTPIQALRENRGTEVKRRAQVAGY

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
26 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
27 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
46 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
47 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
55 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
56 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
57 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
58 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
59 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
60 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
61 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
64 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
65 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
66 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
67 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
68 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
69 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
70 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
71 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
72 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
73 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
74 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
75 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
76 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
77 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
78 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
80 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
81 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
82 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
83 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 8.82
Rhizosphere 89.22
Stem 0
Stem Tuber 0
Unclassified 10.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100005262 3300005367 Bacteria 10821
2 JGI24737J22298_10022947 3300001990 Bacteria 1981
3 rootH1_10276947 3300003323 Bacteria 2572
4 Ga0070658_10135686 3300005327 Bacteria 2053
5 Ga0070683_100063912 3300005329 Bacteria 3425
6 Ga0070683_101552490 3300005329 Unclassified 636
7 Ga0070661_100784063 3300005344 Bacteria 781
8 Ga0070674_100624488 3300005356 Bacteria 913
9 Ga0070659_100980669 3300005366 Unclassified 741
10 Ga0070714_100111169 3300005435 Bacteria 2426
11 Ga0070714_100791816 3300005435 Bacteria 918
12 Ga0070714_101099479 3300005435 Bacteria 775
13 Ga0070714_101592448 3300005435 Bacteria 638
14 Ga0070713_101010542 3300005436 Unclassified 802
15 Ga0070713_101123942 3300005436 Bacteria 760
16 Ga0070663_100099266 3300005455 Bacteria 2170
17 Ga0070679_101822073 3300005530 Unclassified 557
18 Ga0070679_102082822 3300005530 Bacteria 517
19 Ga0070684_100506549 3300005535 Bacteria 1118
20 Ga0068853_102207506 3300005539 Bacteria 534
21 Ga0068855_100061895 3300005563 Bacteria 4371
22 Ga0068855_100101938 3300005563 Bacteria 3304
23 Ga0068855_100180089 3300005563 Bacteria 2390
24 Ga0068855_101347628 3300005563 Unclassified 737
25 Ga0068856_100159476 3300005614 Bacteria 2266
26 Ga0068856_100987280 3300005614 Bacteria 860
27 Ga0068856_102048276 3300005614 Bacteria 582
28 Ga0068852_100344578 3300005616 Bacteria 1453
29 Ga0068852_100530098 3300005616 Unclassified 1176
30 Ga0068852_101366928 3300005616 Bacteria 730
31 Ga0068852_101763684 3300005616 Unclassified 641
32 Ga0081455_10068877 3300005937 Bacteria 2944
33 Ga0105240_10026541 3300009093 Bacteria 7599
34 Ga0105245_10059087 3300009098 Bacteria 3452
35 Ga0105241_10046560 3300009174 Bacteria 3294
36 Ga0105241_10102924 3300009174 Bacteria 2273
37 Ga0105237_10045618 3300009545 Bacteria 4410
38 Ga0157369_12535313 3300013105 Bacteria 519
39 Ga0157374_11791113 3300013296 Bacteria 639
40 Ga0157372_10506367 3300013307 Bacteria 1408
41 Ga0163163_11879863 3300014325 Unclassified 659
42 Ga0206354_10636025 3300020081 Bacteria 786
43 Ga0206353_10207754 3300020082 Bacteria 2463
44 Ga0207647_10029069 3300025904 Bacteria 3582
45 Ga0207647_10044849 3300025904 Bacteria 2761
46 Ga0207705_10106588 3300025909 Bacteria 2067
47 Ga0207654_10880240 3300025911 Bacteria 649
48 Ga0207707_10316318 3300025912 Bacteria 1348
49 Ga0207695_10209106 3300025913 Bacteria 1863
50 Ga0207671_10527113 3300025914 Bacteria 942
51 Ga0207693_10914511 3300025915 Bacteria 673
52 Ga0207652_10557614 3300025921 Bacteria 1029
53 Ga0207700_10389987 3300025928 Bacteria 1219
54 Ga0207664_10789941 3300025929 Bacteria 854
55 Ga0207664_11203938 3300025929 Bacteria 676
56 Ga0207669_10589688 3300025937 Bacteria 902
57 Ga0207667_10005404 3300025949 Bacteria 15576
58 Ga0207667_10194655 3300025949 Bacteria 2080
59 Ga0207667_10614804 3300025949 Bacteria 1095
60 Ga0207667_10660601 3300025949 Unclassified 1050
61 Ga0207658_10003346 3300025986 Bacteria 11370
62 Ga0207639_11098742 3300026041 Bacteria 746
63 Ga0207702_10378314 3300026078 Bacteria 1361
64 Ga0207702_10773375 3300026078 Bacteria 948
65 Ga0207702_12181801 3300026078 Bacteria 543
66 Ga0207698_10187450 3300026142 Bacteria 1839
67 Ga0207698_11126344 3300026142 Bacteria 798
68 Ga0373927_0383162 3300035695 Bacteria 927
69 Ga0373937_0435329 3300036401 Bacteria 1245
70 Ga0436365_1305531 3300039437 Unclassified 587
71 Ga0466969_0068021 3300044656 Bacteria 1717
72 Ga0466969_0106464 3300044656 Bacteria 1316
73 Ga0466969_0134933 3300044656 Bacteria 1143
74 Ga0466969_0239735 3300044656 Bacteria 823
75 Ga0466969_0249337 3300044656 Bacteria 805
76 Ga0466969_0284094 3300044656 Unclassified 749
77 Ga0466972_0037448 3300044658 Bacteria 2372
78 Ga0466972_0040234 3300044658 Bacteria 2278
79 Ga0466972_0164963 3300044658 Bacteria 1040
80 Ga0466972_0252523 3300044658 Bacteria 824
81 Ga0466965_0070722 3300044683 Bacteria 1754
82 Ga0466965_0452654 3300044683 Bacteria 715
83 Ga0466966_0000651 3300044684 Bacteria 22101
84 Ga0466966_0012411 3300044684 Bacteria 5644
85 Ga0466966_0035692 3300044684 Bacteria 3211
86 Ga0466966_0036864 3300044684 Bacteria 3156
87 Ga0466966_0037281 3300044684 Bacteria 3136
88 Ga0466966_0049662 3300044684 Bacteria 2672
89 Ga0466966_0053832 3300044684 Bacteria 2552
90 Ga0466966_0089894 3300044684 Bacteria 1907
91 Ga0466966_0210202 3300044684 Bacteria 1176
92 Ga0466966_0317510 3300044684 Bacteria 936
93 Ga0466966_0407287 3300044684 Bacteria 817
94 Ga0466966_0678689 3300044684 Bacteria 621
95 Ga0466961_0004797 3300044693 Bacteria 8510
96 Ga0466961_0007409 3300044693 Bacteria 6984
97 Ga0466961_0008336 3300044693 Bacteria 6598
98 Ga0466961_0033568 3300044693 Bacteria 3296
99 Ga0466961_0063850 3300044693 Bacteria 2340
100 Ga0466961_0066527 3300044693 Bacteria 2289
101 Ga0466961_0181922 3300044693 Bacteria 1305
102 Ga0466961_0433530 3300044693 Unclassified 796
103 Ga0466961_0438805 3300044693 Bacteria 791
104 Ga0466961_0645183 3300044693 Bacteria 635
105 Ga0466963_0001365 3300044694 Bacteria 13060
106 Ga0466963_0020989 3300044694 Bacteria 4115
107 Ga0466963_0030153 3300044694 Bacteria 3497
108 Ga0466963_0045418 3300044694 Bacteria 2893
109 Ga0466963_0058449 3300044694 Bacteria 2571
110 Ga0466963_0146978 3300044694 Bacteria 1636
111 Ga0466963_0257561 3300044694 Bacteria 1225
112 Ga0466963_0320029 3300044694 Bacteria 1092
113 Ga0466963_0972295 3300044694 Bacteria 598
114 Ga0466964_0038962 3300044706 Bacteria 1912
115 Ga0466964_0237669 3300044706 Bacteria 892
116 Ga0466964_0573345 3300044706 Unclassified 615
117 Ga0466971_0068055 3300044719 Bacteria 1614
118 Ga0466971_0122218 3300044719 Bacteria 1206
119 Ga0466971_0165098 3300044719 Bacteria 1037
120 Ga0466971_0700584 3300044719 Bacteria 509
121 Ga0466968_0133480 3300044735 Bacteria 1131
122 Ga0466968_0212097 3300044735 Bacteria 910
123 Ga0466968_0454450 3300044735 Bacteria 634
124 Ga0466970_0022406 3300044765 Bacteria 3297
125 Ga0466970_0023776 3300044765 Bacteria 3203
126 Ga0466970_0032176 3300044765 Bacteria 2771
127 Ga0466970_0061922 3300044765 Bacteria 2005
128 Ga0466970_0151056 3300044765 Bacteria 1282
129 Ga0466970_0166915 3300044765 Bacteria 1219
130 Ga0466970_0226999 3300044765 Bacteria 1043
131 Ga0466970_0308002 3300044765 Unclassified 894
132 Ga0466957_0028670 3300044842 Bacteria 3315
133 Ga0466957_0044601 3300044842 Bacteria 2687
134 Ga0466957_0699730 3300044842 Unclassified 715
135 Ga0466960_0002912 3300044901 Bacteria 6510
136 Ga0466960_0067492 3300044901 Bacteria 1771
137 Ga0466960_0678826 3300044901 Bacteria 616
138 Ga0466960_0698115 3300044901 Bacteria 608
139 Ga0466960_1022878 3300044901 Unclassified 508
140 Ga0466959_0011962 3300045049 Bacteria 6257
141 Ga0466959_0044583 3300045049 Bacteria 3268
142 Ga0466959_0047805 3300045049 Bacteria 3146
143 Ga0466959_0101637 3300045049 Bacteria 2058
144 Ga0466959_0157091 3300045049 Bacteria 1600
145 Ga0466959_0193550 3300045049 Bacteria 1418
146 Ga0466959_0247237 3300045049 Bacteria 1231
147 Ga0466959_0258872 3300045049 Bacteria 1198
148 Ga0466959_0420405 3300045049 Bacteria 907
149 Ga0466959_0527298 3300045049 Bacteria 797
150 Ga0466959_0912637 3300045049 Bacteria 586
151 Ga0466959_0914642 3300045049 Unclassified 585
152 Ga0466959_1190819 3300045049 Bacteria 506
153 Ga0466958_0002077 3300045836 Bacteria 9909
154 Ga0466958_0006227 3300045836 Bacteria 6475
155 Ga0466958_0010398 3300045836 Bacteria 5210
156 Ga0466958_0036722 3300045836 Bacteria 2934
157 Ga0466958_0129461 3300045836 Bacteria 1584
158 Ga0466958_0145480 3300045836 Bacteria 1494
159 Ga0466958_0204446 3300045836 Bacteria 1257
160 Ga0466958_0425266 3300045836 Unclassified 859
161 Ga0466958_0463735 3300045836 Bacteria 821
162 Ga0466958_0988993 3300045836 Bacteria 549
163 Ga0466967_0001830 3300045976 Bacteria 12798
164 Ga0466967_0075386 3300045976 Bacteria 3032
165 Ga0466967_0089371 3300045976 Bacteria 2797
166 Ga0466967_0199761 3300045976 Unclassified 1893
167 Ga0466967_0208046 3300045976 Bacteria 1855
168 Ga0466967_0257913 3300045976 Unclassified 1667
169 Ga0466967_0268471 3300045976 Bacteria 1634
170 Ga0466967_0579734 3300045976 Bacteria 1106
171 Ga0466967_0656367 3300045976 Bacteria 1037
172 Ga0466967_0665074 3300045976 Bacteria 1030
173 Ga0495664_0504219 3300046477 Unclassified 723
174 Ga0495608_0940989 3300046511 Bacteria 504
175 Ga0496102_0004796 3300048905 Bacteria 11434
176 Ga0496102_0772765 3300048905 Bacteria 883
177 Ga0496103_0002984 3300048906 Bacteria 10469
178 Ga0496104_0381476 3300048907 Bacteria 1322
179 Ga0496105_0636554 3300048908 Bacteria 824
180 Ga0496106_1156371 3300048909 Bacteria 605
181 Ga0496108_0080051 3300048911 Bacteria 2767
182 Ga0496109_0003259 3300048912 Bacteria 13534
183 Ga0496109_0166770 3300048912 Bacteria 2065
184 Ga0496110_0128117 3300048913 Bacteria 2291
185 Ga0496110_0355611 3300048913 Bacteria 1334
186 Ga0496111_0694328 3300048914 Bacteria 740
187 Ga0496111_0865683 3300048914 Bacteria 652
188 Ga0496113_0726477 3300048916 Bacteria 792
189 Ga0496113_1221680 3300048916 Bacteria 586
190 Ga0496114_0507997 3300048917 Bacteria 1066
191 Ga0496115_0509738 3300048918 Bacteria 966
192 Ga0496115_0842151 3300048918 Unclassified 711
193 Ga0496126_0078797 3300048929 Bacteria 2918
194 Ga0501037_0263534 3300049573 Bacteria 1204
195 Ga0501080_0119626 3300049742 Bacteria 2442
196 Ga0501035_0294167 3300049822 Bacteria 1370
197 Ga0501044_0230166 3300049823 Bacteria 1801
198 Ga0500568_0206462 3300053139 Bacteria 719
199 Ga0466962_0012998 3300061719 Bacteria 4004
200 Ga0466962_0099267 3300061719 Bacteria 1398
201 Ga0466962_0186973 3300061719 Bacteria 1010
202 Ga0466962_0255594 3300061719 Bacteria 861
203 Ga0466962_0307613 3300061719 Bacteria 785
204 Ga0466962_0559512 3300061719 Bacteria 581
205 Ga0070667_100005262
206 JGI24737J22298_10022947
207 rootH1_10276947
208 Ga0070658_10135686
209 Ga0070683_100063912
210 Ga0070683_101552490
211 Ga0070661_100784063
212 Ga0070674_100624488
213 Ga0070659_100980669
214 Ga0070714_100111169
215 Ga0070714_100791816
216 Ga0070714_101099479
217 Ga0070714_101592448
218 Ga0070713_101010542
219 Ga0070713_101123942
220 Ga0070663_100099266
221 Ga0070679_101822073
222 Ga0070679_102082822
223 Ga0070684_100506549
224 Ga0068853_102207506
225 Ga0068855_100061895
226 Ga0068855_100101938
227 Ga0068855_100180089
228 Ga0068855_101347628
229 Ga0068856_100159476
230 Ga0068856_100987280
231 Ga0068856_102048276
232 Ga0068852_100344578
233 Ga0068852_100530098
234 Ga0068852_101366928
235 Ga0068852_101763684
236 Ga0081455_10068877
237 Ga0105240_10026541
238 Ga0105245_10059087
239 Ga0105241_10046560
240 Ga0105241_10102924
241 Ga0105237_10045618
242 Ga0157369_12535313
243 Ga0157374_11791113
244 Ga0157372_10506367
245 Ga0163163_11879863
246 Ga0206354_10636025
247 Ga0206353_10207754
248 Ga0207647_10029069
249 Ga0207647_10044849
250 Ga0207705_10106588
251 Ga0207654_10880240
252 Ga0207707_10316318
253 Ga0207695_10209106
254 Ga0207671_10527113
255 Ga0207693_10914511
256 Ga0207652_10557614
257 Ga0207700_10389987
258 Ga0207664_10789941
259 Ga0207664_11203938
260 Ga0207669_10589688
261 Ga0207667_10005404
262 Ga0207667_10194655
263 Ga0207667_10614804
264 Ga0207667_10660601
265 Ga0207658_10003346
266 Ga0207639_11098742
267 Ga0207702_10378314
268 Ga0207702_10773375
269 Ga0207702_12181801
270 Ga0207698_10187450
271 Ga0207698_11126344
272 Ga0373927_0383162
273 Ga0373937_0435329
274 Ga0436365_1305531
275 Ga0466969_0068021
276 Ga0466969_0106464
277 Ga0466969_0134933
278 Ga0466969_0239735
279 Ga0466969_0249337
280 Ga0466969_0284094
281 Ga0466972_0037448
282 Ga0466972_0040234
283 Ga0466972_0164963
284 Ga0466972_0252523
285 Ga0466965_0070722
286 Ga0466965_0452654
287 Ga0466966_0000651
288 Ga0466966_0012411
289 Ga0466966_0035692
290 Ga0466966_0036864
291 Ga0466966_0037281
292 Ga0466966_0049662
293 Ga0466966_0053832
294 Ga0466966_0089894
295 Ga0466966_0210202
296 Ga0466966_0317510
297 Ga0466966_0407287
298 Ga0466966_0678689
299 Ga0466961_0004797
300 Ga0466961_0007409
301 Ga0466961_0008336
302 Ga0466961_0033568
303 Ga0466961_0063850
304 Ga0466961_0066527
305 Ga0466961_0181922
306 Ga0466961_0433530
307 Ga0466961_0438805
308 Ga0466961_0645183
309 Ga0466963_0001365
310 Ga0466963_0020989
311 Ga0466963_0030153
312 Ga0466963_0045418
313 Ga0466963_0058449
314 Ga0466963_0146978
315 Ga0466963_0257561
316 Ga0466963_0320029
317 Ga0466963_0972295
318 Ga0466964_0038962
319 Ga0466964_0237669
320 Ga0466964_0573345
321 Ga0466971_0068055
322 Ga0466971_0122218
323 Ga0466971_0165098
324 Ga0466971_0700584
325 Ga0466968_0133480
326 Ga0466968_0212097
327 Ga0466968_0454450
328 Ga0466970_0022406
329 Ga0466970_0023776
330 Ga0466970_0032176
331 Ga0466970_0061922
332 Ga0466970_0151056
333 Ga0466970_0166915
334 Ga0466970_0226999
335 Ga0466970_0308002
336 Ga0466957_0028670
337 Ga0466957_0044601
338 Ga0466957_0699730
339 Ga0466960_0002912
340 Ga0466960_0067492
341 Ga0466960_0678826
342 Ga0466960_0698115
343 Ga0466960_1022878
344 Ga0466959_0011962
345 Ga0466959_0044583
346 Ga0466959_0047805
347 Ga0466959_0101637
348 Ga0466959_0157091
349 Ga0466959_0193550
350 Ga0466959_0247237
351 Ga0466959_0258872
352 Ga0466959_0420405
353 Ga0466959_0527298
354 Ga0466959_0912637
355 Ga0466959_0914642
356 Ga0466959_1190819
357 Ga0466958_0002077
358 Ga0466958_0006227
359 Ga0466958_0010398
360 Ga0466958_0036722
361 Ga0466958_0129461
362 Ga0466958_0145480
363 Ga0466958_0204446
364 Ga0466958_0425266
365 Ga0466958_0463735
366 Ga0466958_0988993
367 Ga0466967_0001830
368 Ga0466967_0075386
369 Ga0466967_0089371
370 Ga0466967_0199761
371 Ga0466967_0208046
372 Ga0466967_0257913
373 Ga0466967_0268471
374 Ga0466967_0579734
375 Ga0466967_0656367
376 Ga0466967_0665074
377 Ga0495664_0504219
378 Ga0495608_0940989
379 Ga0496102_0004796
380 Ga0496102_0772765
381 Ga0496103_0002984
382 Ga0496104_0381476
383 Ga0496105_0636554
384 Ga0496106_1156371
385 Ga0496108_0080051
386 Ga0496109_0003259
387 Ga0496109_0166770
388 Ga0496110_0128117
389 Ga0496110_0355611
390 Ga0496111_0694328
391 Ga0496111_0865683
392 Ga0496113_0726477
393 Ga0496113_1221680
394 Ga0496114_0507997
395 Ga0496115_0509738
396 Ga0496115_0842151
397 Ga0496126_0078797
398 Ga0501037_0263534
399 Ga0501080_0119626
400 Ga0501035_0294167
401 Ga0501044_0230166
402 Ga0500568_0206462
403 Ga0466962_0012998
404 Ga0466962_0099267
405 Ga0466962_0186973
406 Ga0466962_0255594
407 Ga0466962_0307613
408 Ga0466962_0559512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18367

Rv2175c_C

Rv2175c C-terminal domain of unknown function

73

128

0.97

PF21531

Rv2175c_wHTH

DNA-binding protein Rv2175c, wHTH domain

11

67

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kfs-assembly1.cif.gz_A nmr structure of rv2175c 0.9043 2 108
2kfs-assembly1.cif.gz_A nmr structure of rv2175c 0.8889 2 108
6ama-assembly1.cif.gz_A structure of s. coelicolor/s. venezuelae bldc-smea-ssfa complex to 3.09 angstrom 0.8484 1 43
4j2n-assembly1.cif.gz_A crystal structure of mycobacteriophage pukovnik xis 0.8441 1 41
6amk-assembly1.cif.gz_A structure of streptomyces venezuelae bldc-whii opt complex 0.8415 1 43
ID Description Score Start End Superfamily
af_O53509_78_145_1.10.8.10 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain 0.9445 52 106 1.10.8.10
af_I6YE30_32_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8731 4 43 1.10.10.10
af_O53807_4_54_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8619 3 43 1.10.10.10
af_P9WKT7_24_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8567 3 43 1.10.10.10
3op9A01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8293 4 26 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A5C4MFW0-F1-model_v4 DNA-binding protein 0.9759 2 108 GO:0003677
AF-A0A1H3ANC2-F1-model_v4 Rv2175c C-terminal domain-containing protein 0.9758 40 108
AF-A0A838H3P6-F1-model_v4 DNA-binding protein 0.9752 2 105 GO:0003677
AF-A0A3N0GUX8-F1-model_v4 Transcriptional regulator 0.9751 2 108 GO:0003677
AF-E3JCP4-F1-model_v4 Uncharacterized protein 0.9729 2 108 GO:0003677

Map