F312130

General Info

Members Datasets Scaffolds Average Seq Length
204 148 408 145

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100496030|Ga0070689_1004960302
Length 154
Sequence MAELVREIVIDAEPQTIWPFLTDPARHVEWMGSVADIDPRPGGVYRVLVGGQNQSAGTYLEVVPMKKVLFTFGWEQDAHSIPPGTTTVEISLHPEGDKTRVRLVHRGLPDDAVSDHGHGWAHYLGRLAIAATGGDAGADIPTTHETKPGGPNDD

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
20 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
56 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
57 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
58 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
59 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
60 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
61 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
68 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
69 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
74 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
75 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
78 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
79 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
80 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
87 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
88 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
91 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
92 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
93 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
94 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
95 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
96 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
97 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
109 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
112 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
124 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
143 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
144 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
145 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
146 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 14.22
Rhizosphere 84.8
Stem 0
Stem Tuber 0
Unclassified 16.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100496030 3300005340 Bacteria 1045
2 Ga0070676_10392103 3300005328 Unclassified 964
3 Ga0070676_11193992 3300005328 Bacteria 578
4 Ga0070683_101030514 3300005329 Bacteria 790
5 Ga0068868_101109235 3300005338 Bacteria 728
6 Ga0068868_101541001 3300005338 Bacteria 623
7 Ga0070669_100183612 3300005353 Bacteria 1638
8 Ga0070669_101095054 3300005353 Unclassified 686
9 Ga0070709_10183205 3300005434 Bacteria 1472
10 Ga0070714_101175732 3300005435 Bacteria 748
11 Ga0070713_100980355 3300005436 Bacteria 815
12 Ga0070710_10035175 3300005437 Bacteria 2730
13 Ga0070694_101570426 3300005444 Unclassified 558
14 Ga0070708_100022379 3300005445 Bacteria 5360
15 Ga0070708_101005837 3300005445 Bacteria 782
16 Ga0070678_100748079 3300005456 Bacteria 884
17 Ga0070706_100065685 3300005467 Bacteria 3356
18 Ga0070707_100223497 3300005468 Unclassified 1834
19 Ga0070707_100889951 3300005468 Bacteria 855
20 Ga0070707_101264316 3300005468 Bacteria 704
21 Ga0070699_100337961 3300005518 Bacteria 1355
22 Ga0070696_100355084 3300005546 Bacteria 1136
23 Ga0070665_100279818 3300005548 Bacteria 1670
24 Ga0070704_101119750 3300005549 Bacteria 716
25 Ga0068858_101212254 3300005842 Bacteria 742
26 Ga0068860_102592897 3300005843 Bacteria 526
27 Ga0068862_100545025 3300005844 Unclassified 1107
28 Ga0070716_100227032 3300006173 Bacteria 1258
29 Ga0070712_100049561 3300006175 Bacteria 2917
30 Ga0075428_101305619 3300006844 Bacteria 763
31 Ga0075430_100209443 3300006846 Bacteria 1617
32 Ga0075430_100674719 3300006846 Bacteria 852
33 Ga0075434_101050756 3300006871 Unclassified 828
34 Ga0099794_10312881 3300007265 Bacteria 814
35 Ga0105240_10712309 3300009093 Bacteria 1095
36 Ga0111539_10886270 3300009094 Bacteria 1038
37 Ga0111539_12588438 3300009094 Bacteria 588
38 Ga0105245_12125925 3300009098 Bacteria 615
39 Ga0105247_10700614 3300009101 Bacteria 762
40 Ga0114129_10675871 3300009147 Unclassified 1330
41 Ga0105242_10651222 3300009176 Bacteria 1024
42 Ga0105242_11408853 3300009176 Bacteria 725
43 Ga0105246_11692621 3300011119 Bacteria 601
44 Ga0163163_10460204 3300014325 Bacteria 1332
45 Ga0157379_10494912 3300014968 Bacteria 1133
46 Ga0157376_11797918 3300014969 Bacteria 649
47 Ga0213873_10126490 3300021358 Bacteria 754
48 Ga0207699_10459421 3300025906 Bacteria 914
49 Ga0207645_10647553 3300025907 Unclassified 718
50 Ga0207684_10051791 3300025910 Bacteria 3483
51 Ga0207684_10684487 3300025910 Bacteria 872
52 Ga0207695_10491062 3300025913 Bacteria 1110
53 Ga0207693_10240822 3300025915 Bacteria 1420
54 Ga0207663_10986758 3300025916 Bacteria 675
55 Ga0207646_10242915 3300025922 Unclassified 1627
56 Ga0207681_10140504 3300025923 Bacteria 1798
57 Ga0207687_10710976 3300025927 Unclassified 853
58 Ga0207670_10484627 3300025936 Bacteria 1002
59 Ga0207670_11026589 3300025936 Unclassified 694
60 Ga0207704_10852642 3300025938 Bacteria 764
61 Ga0207665_10223908 3300025939 Bacteria 1380
62 Ga0207661_11086067 3300025944 Bacteria 737
63 Ga0207677_11186521 3300026023 Bacteria 698
64 Ga0207683_10326691 3300026121 Bacteria 1406
65 Ga0268264_10091814 3300028381 Bacteria 2620
66 Ga0268264_10720175 3300028381 Bacteria 992
67 Ga0373930_0137044 3300034816 Bacteria 606
68 Ga0373928_0000495 3300035084 Bacteria 7763
69 Ga0373932_0000164 3300035112 Bacteria 19470
70 Ga0373954_0165371 3300035118 Bacteria 1083
71 Ga0373942_0238185 3300035207 Bacteria 615
72 Ga0373961_0123668 3300035241 Bacteria 860
73 Ga0373931_0000010 3300035691 Bacteria 334069
74 Ga0373931_0120008 3300035691 Bacteria 1502
75 Ga0373937_0108462 3300036401 Bacteria 2582
76 Ga0395900_0015572 3300037418 Bacteria 7752
77 Ga0395898_0030396 3300037466 Bacteria 5405
78 Ga0395905_0043492 3300037471 Bacteria 4214
79 Ga0395901_0019764 3300038443 Bacteria 6887
80 Ga0436362_0564045 3300039453 Bacteria 12936
81 Ga0466966_0673296 3300044684 Bacteria 623
82 Ga0466968_0071246 3300044735 Bacteria 1514
83 Ga0466958_0131506 3300045836 Bacteria 1572
84 Ga0495592_0168071 3300046454 Bacteria 1504
85 Ga0495592_0321824 3300046454 Bacteria 999
86 Ga0495603_0285196 3300046455 Bacteria 949
87 Ga0495629_0161164 3300046459 Bacteria 1558
88 Ga0495629_0424263 3300046459 Unclassified 902
89 Ga0495641_0525657 3300046461 Unclassified 540
90 Ga0495651_0264383 3300046462 Bacteria 1169
91 Ga0495653_0027663 3300046463 Bacteria 4539
92 Ga0495639_0201439 3300046475 Bacteria 974
93 Ga0495662_0173343 3300046476 Bacteria 1063
94 Ga0495662_0664666 3300046476 Unclassified 508
95 Ga0495664_0176434 3300046477 Bacteria 1296
96 Ga0495594_0308598 3300046499 Unclassified 901
97 Ga0495594_0648221 3300046499 Unclassified 598
98 Ga0495608_0147200 3300046511 Unclassified 1502
99 Ga0495608_0181407 3300046511 Bacteria 1332
100 Ga0495608_0451010 3300046511 Unclassified 783
101 Ga0495618_0014172 3300046514 Bacteria 4854
102 Ga0495618_0072356 3300046514 Bacteria 2194
103 Ga0495618_0149931 3300046514 Bacteria 1490
104 Ga0495618_0158125 3300046514 Bacteria 1446
105 Ga0495628_0005642 3300046516 Bacteria 10954
106 Ga0495628_0043651 3300046516 Bacteria 3569
107 Ga0495630_0107633 3300046517 Bacteria 2111
108 Ga0495630_0339990 3300046517 Bacteria 1148
109 Ga0495630_0681190 3300046517 Unclassified 787
110 Ga0495640_0023851 3300046533 Bacteria 4451
111 Ga0495586_0024828 3300046535 Bacteria 3205
112 Ga0495586_0167394 3300046535 Bacteria 1241
113 Ga0495586_0298911 3300046535 Unclassified 922
114 Ga0495645_0762232 3300046543 Unclassified 583
115 Ga0495622_0076155 3300046557 Bacteria 1546
116 Ga0495667_0113961 3300046559 Bacteria 1747
117 Ga0495667_0196940 3300046559 Unclassified 1290
118 Ga0495634_0108378 3300046642 Bacteria 1788
119 Ga0495634_0569955 3300046642 Bacteria 659
120 Ga0495599_0359872 3300046678 Bacteria 871
121 Ga0495646_0408267 3300046680 Bacteria 705
122 Ga0495647_0155344 3300046681 Bacteria 983
123 Ga0495658_0292486 3300046683 Bacteria 1029
124 Ga0495658_1073504 3300046683 Unclassified 513
125 Ga0495613_0000311 3300046689 Bacteria 44152
126 Ga0495613_0110332 3300046689 Bacteria 1983
127 Ga0495624_0466440 3300046690 Bacteria 756
128 Ga0495670_0735210 3300046691 Bacteria 538
129 Ga0495604_0111059 3300047317 Bacteria 1999
130 Ga0495674_0037976 3300047319 Bacteria 4326
131 Ga0495674_1273240 3300047319 Unclassified 553
132 Ga0495676_0858605 3300047321 Bacteria 583
133 Ga0495680_0035256 3300047322 Bacteria 4031
134 Ga0495680_0396184 3300047322 Bacteria 954
135 Ga0495680_1022362 3300047322 Bacteria 527
136 Ga0495675_0060824 3300047444 Bacteria 2393
137 Ga0495684_0463233 3300047471 Bacteria 878
138 Ga0495602_0397286 3300048088 Unclassified 984
139 Ga0496100_0291428 3300048903 Bacteria 1219
140 Ga0496101_0043663 3300048904 Bacteria 3204
141 Ga0496102_0018703 3300048905 Bacteria 6093
142 Ga0496102_0893260 3300048905 Bacteria 810
143 Ga0496103_0034656 3300048906 Bacteria 3088
144 Ga0496104_0027290 3300048907 Bacteria 5284
145 Ga0496104_0137298 3300048907 Bacteria 2349
146 Ga0496105_0103259 3300048908 Bacteria 2354
147 Ga0496105_0509857 3300048908 Bacteria 943
148 Ga0496106_0281096 3300048909 Bacteria 1333
149 Ga0496106_0606189 3300048909 Bacteria 877
150 Ga0496107_0069310 3300048910 Bacteria 2560
151 Ga0496108_0031764 3300048911 Bacteria 4383
152 Ga0496108_0104193 3300048911 Bacteria 2421
153 Ga0496108_0768825 3300048911 Unclassified 832
154 Ga0496109_0010349 3300048912 Bacteria 7967
155 Ga0496109_0255187 3300048912 Bacteria 1651
156 Ga0496109_0305868 3300048912 Bacteria 1500
157 Ga0496110_0033342 3300048913 Bacteria 4454
158 Ga0496110_0087738 3300048913 Bacteria 2778
159 Ga0496111_0060742 3300048914 Bacteria 2740
160 Ga0496111_0260749 3300048914 Bacteria 1286
161 Ga0496112_0009237 3300048915 Bacteria 8864
162 Ga0496112_0178039 3300048915 Bacteria 2091
163 Ga0496113_0588054 3300048916 Bacteria 892
164 Ga0496114_0873479 3300048917 Bacteria 780
165 Ga0496114_1059439 3300048917 Bacteria 695
166 Ga0496115_0052644 3300048918 Bacteria 3266
167 Ga0496115_1003544 3300048918 Bacteria 638
168 Ga0501032_0270237 3300049569 Bacteria 1102
169 Ga0501036_0162114 3300049572 Bacteria 1885
170 Ga0501039_0252579 3300049575 Bacteria 1386
171 Ga0501041_0189598 3300049577 Bacteria 1288
172 Ga0501042_0589702 3300049578 Bacteria 808
173 Ga0501043_1320022 3300049579 Bacteria 503
174 Ga0501067_0351862 3300049583 Bacteria 821
175 Ga0501067_0670870 3300049583 Bacteria 582
176 Ga0501070_0745616 3300049586 Bacteria 772
177 Ga0501072_0235587 3300049588 Bacteria 1458
178 Ga0501075_0158532 3300049591 Bacteria 1726
179 Ga0501075_0378750 3300049591 Bacteria 1079
180 Ga0501075_1259513 3300049591 Unclassified 561
181 Ga0501076_0229421 3300049592 Bacteria 1518
182 Ga0501079_0514784 3300049741 Unclassified 941
183 Ga0501079_0809243 3300049741 Bacteria 738
184 Ga0501080_0425214 3300049742 Unclassified 1193
185 Ga0501081_0295846 3300049743 Bacteria 1187
186 Ga0501081_1062795 3300049743 Bacteria 612
187 Ga0501035_0762666 3300049822 Unclassified 775
188 Ga0501045_0163949 3300049824 Bacteria 1655
189 nmdc:mga00v17_198062_c1 3300050491 Bacteria 1298
190 nmdc:mga05p37_113014_c1 3300050507 Bacteria 3339
191 nmdc:mga05p37_946290_c1 3300050507 Unclassified 922
192 nmdc:mga0qj67_43021_c1 3300050509 Bacteria 3557
193 nmdc:mga0n895_1452947_c1 3300050512 Unclassified 653
194 Ga0495601_0052203 3300053077 Bacteria 2581
195 Ga0495612_0139774 3300053078 Bacteria 1050
196 Ga0495595_0007238 3300053084 Bacteria 4537
197 Ga0495595_0239753 3300053084 Unclassified 907
198 Ga0495619_0134073 3300053085 Bacteria 1703
199 Ga0500616_0001262 3300053153 Bacteria 25292
200 Ga0501084_0420464 3300054114 Bacteria 1130
201 Ga0501084_1018420 3300054114 Bacteria 696
202 Ga0501082_0279314 3300060353 Bacteria 1454
203 Ga0501082_0772915 3300060353 Bacteria 840
204 Ga0530510_1402429 3300061734 Unclassified 536
205 Ga0070689_100496030
206 Ga0070676_10392103
207 Ga0070676_11193992
208 Ga0070683_101030514
209 Ga0068868_101109235
210 Ga0068868_101541001
211 Ga0070669_100183612
212 Ga0070669_101095054
213 Ga0070709_10183205
214 Ga0070714_101175732
215 Ga0070713_100980355
216 Ga0070710_10035175
217 Ga0070694_101570426
218 Ga0070708_100022379
219 Ga0070708_101005837
220 Ga0070678_100748079
221 Ga0070706_100065685
222 Ga0070707_100223497
223 Ga0070707_100889951
224 Ga0070707_101264316
225 Ga0070699_100337961
226 Ga0070696_100355084
227 Ga0070665_100279818
228 Ga0070704_101119750
229 Ga0068858_101212254
230 Ga0068860_102592897
231 Ga0068862_100545025
232 Ga0070716_100227032
233 Ga0070712_100049561
234 Ga0075428_101305619
235 Ga0075430_100209443
236 Ga0075430_100674719
237 Ga0075434_101050756
238 Ga0099794_10312881
239 Ga0105240_10712309
240 Ga0111539_10886270
241 Ga0111539_12588438
242 Ga0105245_12125925
243 Ga0105247_10700614
244 Ga0114129_10675871
245 Ga0105242_10651222
246 Ga0105242_11408853
247 Ga0105246_11692621
248 Ga0163163_10460204
249 Ga0157379_10494912
250 Ga0157376_11797918
251 Ga0213873_10126490
252 Ga0207699_10459421
253 Ga0207645_10647553
254 Ga0207684_10051791
255 Ga0207684_10684487
256 Ga0207695_10491062
257 Ga0207693_10240822
258 Ga0207663_10986758
259 Ga0207646_10242915
260 Ga0207681_10140504
261 Ga0207687_10710976
262 Ga0207670_10484627
263 Ga0207670_11026589
264 Ga0207704_10852642
265 Ga0207665_10223908
266 Ga0207661_11086067
267 Ga0207677_11186521
268 Ga0207683_10326691
269 Ga0268264_10091814
270 Ga0268264_10720175
271 Ga0373930_0137044
272 Ga0373928_0000495
273 Ga0373932_0000164
274 Ga0373954_0165371
275 Ga0373942_0238185
276 Ga0373961_0123668
277 Ga0373931_0000010
278 Ga0373931_0120008
279 Ga0373937_0108462
280 Ga0395900_0015572
281 Ga0395898_0030396
282 Ga0395905_0043492
283 Ga0395901_0019764
284 Ga0436362_0564045
285 Ga0466966_0673296
286 Ga0466968_0071246
287 Ga0466958_0131506
288 Ga0495592_0168071
289 Ga0495592_0321824
290 Ga0495603_0285196
291 Ga0495629_0161164
292 Ga0495629_0424263
293 Ga0495641_0525657
294 Ga0495651_0264383
295 Ga0495653_0027663
296 Ga0495639_0201439
297 Ga0495662_0173343
298 Ga0495662_0664666
299 Ga0495664_0176434
300 Ga0495594_0308598
301 Ga0495594_0648221
302 Ga0495608_0147200
303 Ga0495608_0181407
304 Ga0495608_0451010
305 Ga0495618_0014172
306 Ga0495618_0072356
307 Ga0495618_0149931
308 Ga0495618_0158125
309 Ga0495628_0005642
310 Ga0495628_0043651
311 Ga0495630_0107633
312 Ga0495630_0339990
313 Ga0495630_0681190
314 Ga0495640_0023851
315 Ga0495586_0024828
316 Ga0495586_0167394
317 Ga0495586_0298911
318 Ga0495645_0762232
319 Ga0495622_0076155
320 Ga0495667_0113961
321 Ga0495667_0196940
322 Ga0495634_0108378
323 Ga0495634_0569955
324 Ga0495599_0359872
325 Ga0495646_0408267
326 Ga0495647_0155344
327 Ga0495658_0292486
328 Ga0495658_1073504
329 Ga0495613_0000311
330 Ga0495613_0110332
331 Ga0495624_0466440
332 Ga0495670_0735210
333 Ga0495604_0111059
334 Ga0495674_0037976
335 Ga0495674_1273240
336 Ga0495676_0858605
337 Ga0495680_0035256
338 Ga0495680_0396184
339 Ga0495680_1022362
340 Ga0495675_0060824
341 Ga0495684_0463233
342 Ga0495602_0397286
343 Ga0496100_0291428
344 Ga0496101_0043663
345 Ga0496102_0018703
346 Ga0496102_0893260
347 Ga0496103_0034656
348 Ga0496104_0027290
349 Ga0496104_0137298
350 Ga0496105_0103259
351 Ga0496105_0509857
352 Ga0496106_0281096
353 Ga0496106_0606189
354 Ga0496107_0069310
355 Ga0496108_0031764
356 Ga0496108_0104193
357 Ga0496108_0768825
358 Ga0496109_0010349
359 Ga0496109_0255187
360 Ga0496109_0305868
361 Ga0496110_0033342
362 Ga0496110_0087738
363 Ga0496111_0060742
364 Ga0496111_0260749
365 Ga0496112_0009237
366 Ga0496112_0178039
367 Ga0496113_0588054
368 Ga0496114_0873479
369 Ga0496114_1059439
370 Ga0496115_0052644
371 Ga0496115_1003544
372 Ga0501032_0270237
373 Ga0501036_0162114
374 Ga0501039_0252579
375 Ga0501041_0189598
376 Ga0501042_0589702
377 Ga0501043_1320022
378 Ga0501067_0351862
379 Ga0501067_0670870
380 Ga0501070_0745616
381 Ga0501072_0235587
382 Ga0501075_0158532
383 Ga0501075_0378750
384 Ga0501075_1259513
385 Ga0501076_0229421
386 Ga0501079_0514784
387 Ga0501079_0809243
388 Ga0501080_0425214
389 Ga0501081_0295846
390 Ga0501081_1062795
391 Ga0501035_0762666
392 Ga0501045_0163949
393 nmdc:mga00v17_198062_c1
394 nmdc:mga05p37_113014_c1
395 nmdc:mga05p37_946290_c1
396 nmdc:mga0qj67_43021_c1
397 nmdc:mga0n895_1452947_c1
398 Ga0495601_0052203
399 Ga0495612_0139774
400 Ga0495595_0007238
401 Ga0495595_0239753
402 Ga0495619_0134073
403 Ga0500616_0001262
404 Ga0501084_0420464
405 Ga0501084_1018420
406 Ga0501082_0279314
407 Ga0501082_0772915
408 Ga0530510_1402429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

11

132

0.96

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

1

122

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8978 3 133
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8851 2 128
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8688 3 142
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8665 3 141
7dme-assembly1.cif.gz_A solution structure of human aha1 0.8523 2 136
ID Description Score Start End Superfamily
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9409 4 137 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.902 4 137 3.30.530.20
af_Q8N9S3_197_326_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8998 2 128 3.30.530.20
af_Q93168_208_339_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8944 2 127 3.30.530.20
af_Q9P782_203_333_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8834 2 133 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7Y1ZYI0-F1-model_v4 SRPBCC domain-containing protein 0.9686 3 133
AF-A0A243RNG7-F1-model_v4 ATPase 0.9666 1 131
AF-A0A3C0XID3-F1-model_v4 Transcriptional regulator 0.9652 3 135
AF-E3IWA2-F1-model_v4 Activator of Hsp90 ATPase 1 family protein 0.9633 3 139
AF-A0A2X0J2E6-F1-model_v4 SRPBCC domain-containing protein 0.9627 3 139

Map