F310967

General Info

Members Datasets Scaffolds Average Seq Length
203 146 203 121

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_101182496|Ga0068853_1011824961
Length 131
Sequence MIAAMGVWQKFALVALGGGLGSVARFAVGEWAGQRWGAAFPWGTFIANISGALLIGLLMGIVLSRPSISPAYRLLLGSGFLGGYTTFSSWMYESWALADGGALWRAGGNVLLSVVAGLAAAWVGLQIGRAL

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
79 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
82 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
86 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
87 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
96 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
97 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
105 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
110 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
111 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
132 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
142 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
143 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.37
Nodule 0
Rhizoplane 13.79
Rhizosphere 75.86
Stem 0
Stem Tuber 0
Unclassified 1.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1018981 3300000549 Bacteria 800
2 JGI24743J22301_10153663 3300001991 Bacteria 517
3 JGI24735J21928_10143490 3300002067 Bacteria 689
4 Ga0070683_100036920 3300005329 Bacteria 4471
5 Ga0068868_100022770 3300005338 Bacteria 4734
6 Ga0068868_100799259 3300005338 Bacteria 851
7 Ga0070660_100087193 3300005339 Bacteria 2457
8 Ga0070661_100221956 3300005344 Bacteria 1450
9 Ga0070692_10199819 3300005345 Bacteria 1170
10 Ga0070668_100158241 3300005347 Bacteria 1836
11 Ga0070669_100001472 3300005353 Bacteria 17027
12 Ga0070669_100242361 3300005353 Bacteria 1433
13 Ga0070674_100291323 3300005356 Bacteria 1298
14 Ga0070674_101630399 3300005356 Bacteria 582
15 Ga0070688_100399388 3300005365 Bacteria 1017
16 Ga0070659_100000823 3300005366 Bacteria 22612
17 Ga0070701_10152757 3300005438 Bacteria 1331
18 Ga0070711_100002198 3300005439 Bacteria 11075
19 Ga0070705_100002363 3300005440 Bacteria 9517
20 Ga0070705_101088335 3300005440 Bacteria 653
21 Ga0070685_10109577 3300005466 Bacteria 1699
22 Ga0070684_100240006 3300005535 Bacteria 1656
23 Ga0070684_100543484 3300005535 Bacteria 1078
24 Ga0068853_101182496 3300005539 Unclassified 738
25 Ga0068853_101493867 3300005539 Bacteria 654
26 Ga0070693_100250349 3300005547 Bacteria 1174
27 Ga0068857_100043540 3300005577 Bacteria 3982
28 Ga0068854_100037726 3300005578 Bacteria 3393
29 Ga0068856_100252625 3300005614 Unclassified 1778
30 Ga0070702_100038460 3300005615 Bacteria 2664
31 Ga0068852_100284722 3300005616 Bacteria 1594
32 Ga0068864_100062813 3300005618 Bacteria 3218
33 Ga0068864_100147534 3300005618 Bacteria 2128
34 Ga0068866_10056382 3300005718 Bacteria 2021
35 Ga0068861_100013016 3300005719 Bacteria 5815
36 Ga0068870_10063304 3300005840 Bacteria 1995
37 Ga0068860_100033021 3300005843 Bacteria 4969
38 Ga0068860_100147622 3300005843 Bacteria 2263
39 Ga0075365_10149707 3300006038 Bacteria 1623
40 Ga0075365_10197129 3300006038 Bacteria 1410
41 Ga0075365_10574486 3300006038 Bacteria 797
42 Ga0075364_10020194 3300006051 Bacteria 4189
43 Ga0075364_10087627 3300006051 Bacteria 2063
44 Ga0075364_10391795 3300006051 Bacteria 948
45 Ga0075369_10108528 3300006186 Bacteria 1250
46 Ga0068865_100073945 3300006881 Bacteria 2425
47 Ga0068865_101767265 3300006881 Bacteria 558
48 Ga0105240_10190832 3300009093 Bacteria 2410
49 Ga0111539_10474194 3300009094 Bacteria 1457
50 Ga0105245_10100135 3300009098 Bacteria 2680
51 Ga0105245_10302294 3300009098 Bacteria 1570
52 Ga0105245_10440406 3300009098 Bacteria 1310
53 Ga0105245_12682590 3300009098 Unclassified 551
54 Ga0105243_10040608 3300009148 Bacteria 3634
55 Ga0105237_10167055 3300009545 Bacteria 2199
56 Ga0105237_11483576 3300009545 Bacteria 685
57 Ga0105238_10733494 3300009551 Bacteria 1001
58 Ga0105028_110412 3300009993 Bacteria 977
59 Ga0105239_10048109 3300010375 Bacteria 4676
60 Ga0105239_10066897 3300010375 Bacteria 3947
61 Ga0105239_10345651 3300010375 Bacteria 1679
62 Ga0157369_10330206 3300013105 Bacteria 1585
63 Ga0163163_10375598 3300014325 Bacteria 1479
64 Ga0163163_11815089 3300014325 Bacteria 670
65 Ga0157380_10194304 3300014326 Bacteria 1794
66 Ga0157377_10572647 3300014745 Bacteria 801
67 Ga0157379_10293210 3300014968 Bacteria 1482
68 Ga0157379_12621292 3300014968 Bacteria 505
69 Ga0163161_10578671 3300017792 Bacteria 923
70 Ga0213874_10003311 3300021377 Bacteria 3563
71 Ga0207688_10015233 3300025901 Bacteria 4173
72 Ga0207643_10143310 3300025908 Bacteria 1428
73 Ga0207671_10104207 3300025914 Bacteria 2152
74 Ga0207671_10352954 3300025914 Unclassified 1166
75 Ga0207663_10001040 3300025916 Bacteria 12723
76 Ga0207657_11297131 3300025919 Bacteria 550
77 Ga0207681_10220559 3300025923 Bacteria 1467
78 Ga0207650_10574017 3300025925 Bacteria 947
79 Ga0207687_10044815 3300025927 Bacteria 3055
80 Ga0207706_10087858 3300025933 Bacteria 2734
81 Ga0207709_10168787 3300025935 Bacteria 1534
82 Ga0207670_10295214 3300025936 Bacteria 1267
83 Ga0207704_10221818 3300025938 Bacteria 1399
84 Ga0207711_11227426 3300025941 Bacteria 691
85 Ga0207651_10894197 3300025960 Bacteria 791
86 Ga0207668_10057291 3300025972 Bacteria 2718
87 Ga0207640_10109984 3300025981 Bacteria 1951
88 Ga0207677_10041729 3300026023 Bacteria 3036
89 Ga0207703_10377600 3300026035 Bacteria 1310
90 Ga0207639_11079378 3300026041 Unclassified 753
91 Ga0207708_10025023 3300026075 Bacteria 4515
92 Ga0207708_10929899 3300026075 Bacteria 753
93 Ga0207702_10054282 3300026078 Bacteria 3395
94 Ga0207676_10931900 3300026095 Bacteria 853
95 Ga0207674_10030525 3300026116 Bacteria 5666
96 Ga0207675_100009373 3300026118 Bacteria 9177
97 Ga0207683_10235799 3300026121 Bacteria 1669
98 Ga0207698_10049460 3300026142 Bacteria 3200
99 Ga0268265_10267286 3300028380 Bacteria 1524
100 Ga0268264_10029576 3300028381 Bacteria 4488
101 Ga0268264_10224917 3300028381 Bacteria 1729
102 Ga0265337_1119171 3300028556 Bacteria 716
103 Ga0265330_10534080 3300031235 Unclassified 500
104 Ga0307408_101966728 3300031548 Bacteria 562
105 Ga0265313_10370301 3300031595 Unclassified 565
106 Ga0316578_10183359 3300031728 Bacteria 1262
107 Ga0307409_100360037 3300031995 Bacteria 1376
108 Ga0307415_101613984 3300032126 Bacteria 623
109 Ga0373923_0371483 3300035111 Bacteria 685
110 Ga0316582_0068800 3300036647 Bacteria 2287
111 Ga0316584_0274519 3300036712 Bacteria 1226
112 Ga0395901_0927126 3300038443 Bacteria 851
113 Ga0395901_1471227 3300038443 Bacteria 638
114 Ga0436363_0048697 3300039450 Bacteria 7463
115 Ga0436362_1175837 3300039453 Bacteria 1532
116 Ga0466963_0231328 3300044694 Bacteria 1295
117 Ga0466963_0658273 3300044694 Bacteria 739
118 Ga0466957_0205061 3300044842 Bacteria 1296
119 Ga0466957_0226151 3300044842 Bacteria 1237
120 Ga0466958_0138287 3300045836 Bacteria 1533
121 Ga0466967_0011018 3300045976 Bacteria 6821
122 Ga0466967_0444983 3300045976 Bacteria 1266
123 Ga0466967_2060615 3300045976 Bacteria 567
124 Ga0495650_0000063 3300046471 Bacteria 277841
125 Ga0495656_0362217 3300046615 Bacteria 753
126 Ga0495686_0023496 3300047472 Bacteria 4066
127 Ga0496100_0000895 3300048903 Bacteria 14217
128 Ga0496100_0585757 3300048903 Bacteria 865
129 Ga0496101_0001538 3300048904 Bacteria 13819
130 Ga0496101_0014778 3300048904 Bacteria 5252
131 Ga0496101_0771695 3300048904 Bacteria 758
132 Ga0496101_1074210 3300048904 Bacteria 632
133 Ga0496102_0427725 3300048905 Bacteria 1243
134 Ga0496104_0113198 3300048907 Bacteria 2602
135 Ga0496104_1556208 3300048907 Bacteria 564
136 Ga0496105_0203182 3300048908 Bacteria 1617
137 Ga0496106_0026949 3300048909 Bacteria 4279
138 Ga0496108_0098572 3300048911 Bacteria 2491
139 Ga0496108_0219294 3300048911 Bacteria 1653
140 Ga0496109_1413359 3300048912 Bacteria 631
141 Ga0496109_2006780 3300048912 Bacteria 510
142 Ga0496109_2067670 3300048912 Bacteria 501
143 Ga0496110_0109118 3300048913 Bacteria 2485
144 Ga0496110_0144777 3300048913 Bacteria 2149
145 Ga0496110_0502616 3300048913 Bacteria 1104
146 Ga0496111_0029749 3300048914 Bacteria 3880
147 Ga0496111_0550149 3300048914 Bacteria 847
148 Ga0496112_0000983 3300048915 Bacteria 20803
149 Ga0496112_0019725 3300048915 Bacteria 6372
150 Ga0496113_0031028 3300048916 Bacteria 3874
151 Ga0496113_0118180 3300048916 Bacteria 2070
152 Ga0496113_0355057 3300048916 Bacteria 1176
153 Ga0496114_0503928 3300048917 Bacteria 1071
154 Ga0496115_0199420 3300048918 Bacteria 1653
155 Ga0496124_0235631 3300048927 Bacteria 1365
156 Ga0496126_0006921 3300048929 Bacteria 12561
157 Ga0501031_1094635 3300049568 Bacteria 508
158 Ga0501032_0017705 3300049569 Bacteria 5001
159 Ga0501033_0094964 3300049570 Bacteria 2179
160 Ga0501034_1020566 3300049571 Bacteria 711
161 Ga0501036_0064414 3300049572 Bacteria 3102
162 Ga0501037_0605282 3300049573 Bacteria 735
163 Ga0501038_0008589 3300049574 Bacteria 9375
164 Ga0501042_0002966 3300049578 Bacteria 10552
165 Ga0501046_0021523 3300049580 Bacteria 5321
166 Ga0501046_0043031 3300049580 Bacteria 3597
167 Ga0501047_0000155 3300049581 Bacteria 83152
168 Ga0501047_0490638 3300049581 Bacteria 1055
169 Ga0501048_0067714 3300049582 Bacteria 2523
170 Ga0501048_0859785 3300049582 Unclassified 652
171 Ga0501067_0070105 3300049583 Bacteria 1941
172 Ga0501067_0324079 3300049583 Bacteria 858
173 Ga0501068_0080906 3300049584 Bacteria 1993
174 Ga0501068_0786142 3300049584 Bacteria 624
175 Ga0501070_0144569 3300049586 Bacteria 1963
176 Ga0501072_0065588 3300049588 Bacteria 2863
177 Ga0501073_0124263 3300049589 Bacteria 1788
178 Ga0501074_0361788 3300049590 Bacteria 1029
179 Ga0501079_0418494 3300049741 Bacteria 1052
180 Ga0501079_1046491 3300049741 Bacteria 643
181 Ga0501080_0020938 3300049742 Bacteria 6052
182 Ga0501080_0024987 3300049742 Bacteria 5542
183 Ga0501080_0264165 3300049742 Bacteria 1567
184 Ga0501081_0216217 3300049743 Bacteria 1393
185 Ga0501083_0217319 3300049744 Bacteria 1245
186 Ga0501035_0020979 3300049822 Bacteria 6004
187 Ga0501044_0768533 3300049823 Bacteria 844
188 Ga0501045_0331998 3300049824 Bacteria 1132
189 nmdc:mga00v17_242882_c1 3300050491 Bacteria 1168
190 nmdc:mga00v17_55309_c1 3300050491 Bacteria 2424
191 nmdc:mga00v17_641710_c1 3300050491 Unclassified 683
192 nmdc:mga00v17_898802_c1 3300050491 Bacteria 561
193 nmdc:mga0yw44_15646_c1 3300050492 Bacteria 4071
194 nmdc:mga0yw44_219872_c1 3300050492 Bacteria 1259
195 nmdc:mga0yw44_252522_c1 3300050492 Bacteria 1174
196 nmdc:mga06z11_493012_c1 3300050494 Unclassified 742
197 nmdc:mga07m45_694442_c1 3300050496 Unclassified 585
198 Ga0495655_0002482 3300053083 Bacteria 2938
199 Ga0495655_0350966 3300053083 Unclassified 516
200 Ga0500616_0001582 3300053153 Bacteria 21267
201 Ga0501084_0022356 3300054114 Bacteria 5278
202 Ga0501082_0537227 3300060353 Bacteria 1022
203 Ga0530510_0001175 3300061734 Bacteria 17412

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050496 nmdc:mga07m45_694442_c1 nmdc:mga07m45_694442_c1_61_363 100
2 3300048927 Ga0496124_0235631 Ga0496124_0235631_546_893 106
3 3300044842 Ga0466957_0205061 Ga0466957_0205061_39_371 110
4 3300045836 Ga0466958_0138287 Ga0466958_0138287_1005_1337 110
5 3300049571 Ga0501034_1020566 Ga0501034_1020566_360_695 110
6 3300009993 Ga0105028_110412 Ga0105028_1104122 112
7 3300031728 Ga0316578_10183359 Ga0316578_101833591 112
8 3300036712 Ga0316584_0274519 Ga0316584_0274519_528_893 112
9 3300031235 Ga0265330_10534080 Ga0265330_105340801 115
10 3300031595 Ga0265313_10370301 Ga0265313_103703011 115
11 3300049580 Ga0501046_0021523 Ga0501046_0021523_2340_2732 115
12 3300049581 Ga0501047_0000155 Ga0501047_0000155_19159_19551 115
13 3300049582 Ga0501048_0859785 Ga0501048_0859785_285_632 115
14 3300049741 Ga0501079_0418494 Ga0501079_0418494_471_818 115
15 3300049742 Ga0501080_0024987 Ga0501080_0024987_3084_3476 115
16 3300049743 Ga0501081_0216217 Ga0501081_0216217_230_577 115
17 3300005356 Ga0070674_101630399 Ga0070674_1016303991 116
18 3300005535 Ga0070684_100543484 Ga0070684_1005434842 116
19 3300009098 Ga0105245_10440406 Ga0105245_104404062 116
20 3300014325 Ga0163163_11815089 Ga0163163_118150891 116
21 3300048911 Ga0496108_0098572 Ga0496108_0098572_1852_2202 116
22 3300048912 Ga0496109_1413359 Ga0496109_1413359_224_574 116
23 3300048914 Ga0496111_0550149 Ga0496111_0550149_464_814 116
24 3300049586 Ga0501070_0144569 Ga0501070_0144569_927_1292 116
25 3300049742 Ga0501080_0264165 Ga0501080_0264165_981_1346 116
26 3300006038 Ga0075365_10574486 Ga0075365_105744862 117
27 3300006051 Ga0075364_10020194 Ga0075364_100201942 117
28 3300006186 Ga0075369_10108528 Ga0075369_101085282 117
29 3300046471 Ga0495650_0000063 Ga0495650_0000063_77603_77956 117
30 3300050491 nmdc:mga00v17_55309_c1 nmdc:mga00v17_55309_c1_183_536 117
31 3300050491 nmdc:mga00v17_641710_c1 nmdc:mga00v17_641710_c1_200_553 117
32 3300050492 nmdc:mga0yw44_219872_c1 nmdc:mga0yw44_219872_c1_851_1204 117
33 3300050494 nmdc:mga06z11_493012_c1 nmdc:mga06z11_493012_c1_27_380 117
34 3300061734 Ga0530510_0001175 Ga0530510_0001175_1439_1807 117
35 3300036647 Ga0316582_0068800 Ga0316582_0068800_843_1208 118
36 3300049568 Ga0501031_1094635 Ga0501031_1094635_45_404 118
37 3300049569 Ga0501032_0017705 Ga0501032_0017705_4545_4904 118
38 3300049570 Ga0501033_0094964 Ga0501033_0094964_1787_2146 118
39 3300049572 Ga0501036_0064414 Ga0501036_0064414_164_523 118
40 3300049573 Ga0501037_0605282 Ga0501037_0605282_211_570 118
41 3300049574 Ga0501038_0008589 Ga0501038_0008589_1742_2101 118
42 3300049578 Ga0501042_0002966 Ga0501042_0002966_6399_6758 118
43 3300049580 Ga0501046_0043031 Ga0501046_0043031_128_487 118
44 3300049581 Ga0501047_0490638 Ga0501047_0490638_193_552 118
45 3300049582 Ga0501048_0067714 Ga0501048_0067714_1877_2236 118
46 3300049583 Ga0501067_0070105 Ga0501067_0070105_191_550 118
47 3300049584 Ga0501068_0080906 Ga0501068_0080906_1588_1947 118
48 3300049588 Ga0501072_0065588 Ga0501072_0065588_302_661 118
49 3300049589 Ga0501073_0124263 Ga0501073_0124263_1137_1496 118
50 3300049590 Ga0501074_0361788 Ga0501074_0361788_58_417 118
51 3300049741 Ga0501079_1046491 Ga0501079_1046491_197_556 118
52 3300049742 Ga0501080_0020938 Ga0501080_0020938_2745_3104 118
53 3300049744 Ga0501083_0217319 Ga0501083_0217319_209_568 118
54 3300049822 Ga0501035_0020979 Ga0501035_0020979_3087_3446 118
55 3300049823 Ga0501044_0768533 Ga0501044_0768533_380_739 118
56 3300049824 Ga0501045_0331998 Ga0501045_0331998_711_1070 118
57 3300054114 Ga0501084_0022356 Ga0501084_0022356_379_738 118
58 3300060353 Ga0501082_0537227 Ga0501082_0537227_406_765 118
59 3300025919 Ga0207657_11297131 Ga0207657_112971312 119
60 3300047472 Ga0495686_0023496 Ga0495686_0023496_2132_2491 119
61 3300001991 JGI24743J22301_10153663 JGI24743J22301_101536631 120
62 3300005329 Ga0070683_100036920 Ga0070683_1000369204 120
63 3300009098 Ga0105245_12682590 Ga0105245_126825901 120
64 3300013105 Ga0157369_10330206 Ga0157369_103302064 120
65 3300025960 Ga0207651_10894197 Ga0207651_108941972 120
66 3300053083 Ga0495655_0002482 Ga0495655_0002482_2389_2751 120
67 3300006038 Ga0075365_10149707 Ga0075365_101497073 121
68 3300006038 Ga0075365_10197129 Ga0075365_101971293 121
69 3300006051 Ga0075364_10087627 Ga0075364_100876272 121
70 3300006051 Ga0075364_10391795 Ga0075364_103917952 121
71 3300050491 nmdc:mga00v17_242882_c1 nmdc:mga00v17_242882_c1_758_1123 121
72 3300050491 nmdc:mga00v17_898802_c1 nmdc:mga00v17_898802_c1_183_548 121
73 3300050492 nmdc:mga0yw44_15646_c1 nmdc:mga0yw44_15646_c1_618_983 121
74 3300050492 nmdc:mga0yw44_252522_c1 nmdc:mga0yw44_252522_c1_59_424 121
75 3300002067 JGI24735J21928_10143490 JGI24735J21928_101434902 122
76 3300005338 Ga0068868_100022770 Ga0068868_1000227703 122
77 3300005339 Ga0070660_100087193 Ga0070660_1000871933 122
78 3300005345 Ga0070692_10199819 Ga0070692_101998192 122
79 3300005347 Ga0070668_100158241 Ga0070668_1001582412 122
80 3300005353 Ga0070669_100242361 Ga0070669_1002423612 122
81 3300005356 Ga0070674_100291323 Ga0070674_1002913232 122
82 3300005438 Ga0070701_10152757 Ga0070701_101527572 122
83 3300005440 Ga0070705_101088335 Ga0070705_1010883351 122
84 3300005466 Ga0070685_10109577 Ga0070685_101095772 122
85 3300005539 Ga0068853_101182496 Ga0068853_1011824961 122
86 3300005539 Ga0068853_101493867 Ga0068853_1014938671 122
87 3300005578 Ga0068854_100037726 Ga0068854_1000377264 122
88 3300005615 Ga0070702_100038460 Ga0070702_1000384603 122
89 3300005616 Ga0068852_100284722 Ga0068852_1002847222 122
90 3300005618 Ga0068864_100062813 Ga0068864_1000628133 122
91 3300005718 Ga0068866_10056382 Ga0068866_100563823 122
92 3300005719 Ga0068861_100013016 Ga0068861_1000130167 122
93 3300005840 Ga0068870_10063304 Ga0068870_100633043 122
94 3300005843 Ga0068860_100033021 Ga0068860_1000330216 122
95 3300005843 Ga0068860_100147622 Ga0068860_1001476223 122
96 3300006881 Ga0068865_100073945 Ga0068865_1000739453 122
97 3300009093 Ga0105240_10190832 Ga0105240_101908322 122
98 3300009094 Ga0111539_10474194 Ga0111539_104741942 122
99 3300009098 Ga0105245_10100135 Ga0105245_101001352 122
100 3300009148 Ga0105243_10040608 Ga0105243_100406082 122
101 3300009545 Ga0105237_10167055 Ga0105237_101670553 122
102 3300010375 Ga0105239_10048109 Ga0105239_100481096 122
103 3300014326 Ga0157380_10194304 Ga0157380_101943042 122
104 3300014745 Ga0157377_10572647 Ga0157377_105726472 122
105 3300014968 Ga0157379_10293210 Ga0157379_102932102 122
106 3300017792 Ga0163161_10578671 Ga0163161_105786712 122
107 3300025901 Ga0207688_10015233 Ga0207688_100152332 122
108 3300025908 Ga0207643_10143310 Ga0207643_101433102 122
109 3300025914 Ga0207671_10104207 Ga0207671_101042073 122
110 3300025923 Ga0207681_10220559 Ga0207681_102205592 122
111 3300025927 Ga0207687_10044815 Ga0207687_100448152 122
112 3300025933 Ga0207706_10087858 Ga0207706_100878583 122
113 3300025935 Ga0207709_10168787 Ga0207709_101687872 122
114 3300025936 Ga0207670_10295214 Ga0207670_102952142 122
115 3300025938 Ga0207704_10221818 Ga0207704_102218182 122
116 3300025941 Ga0207711_11227426 Ga0207711_112274261 122
117 3300025972 Ga0207668_10057291 Ga0207668_100572913 122
118 3300025981 Ga0207640_10109984 Ga0207640_101099842 122
119 3300026023 Ga0207677_10041729 Ga0207677_100417293 122
120 3300026035 Ga0207703_10377600 Ga0207703_103776002 122
121 3300026041 Ga0207639_11079378 Ga0207639_110793782 122
122 3300026075 Ga0207708_10025023 Ga0207708_100250236 122
123 3300026075 Ga0207708_10929899 Ga0207708_109298992 122
124 3300026095 Ga0207676_10931900 Ga0207676_109319001 122
125 3300026118 Ga0207675_100009373 Ga0207675_1000093734 122
126 3300026121 Ga0207683_10235799 Ga0207683_102357992 122
127 3300026142 Ga0207698_10049460 Ga0207698_100494603 122
128 3300028380 Ga0268265_10267286 Ga0268265_102672862 122
129 3300028381 Ga0268264_10029576 Ga0268264_100295762 122
130 3300028381 Ga0268264_10224917 Ga0268264_102249173 122
131 3300028556 Ga0265337_1119171 Ga0265337_11191712 122
132 3300035111 Ga0373923_0371483 Ga0373923_0371483_201_569 122
133 3300038443 Ga0395901_0927126 Ga0395901_0927126_169_537 122
134 3300038443 Ga0395901_1471227 Ga0395901_1471227_146_514 122
135 3300048903 Ga0496100_0000895 Ga0496100_0000895_11409_11777 122
136 3300048903 Ga0496100_0585757 Ga0496100_0585757_292_660 122
137 3300048904 Ga0496101_0001538 Ga0496101_0001538_2499_2867 122
138 3300048904 Ga0496101_0014778 Ga0496101_0014778_311_679 122
139 3300048904 Ga0496101_0771695 Ga0496101_0771695_20_388 122
140 3300048904 Ga0496101_1074210 Ga0496101_1074210_116_484 122
141 3300048905 Ga0496102_0427725 Ga0496102_0427725_524_892 122
142 3300048907 Ga0496104_0113198 Ga0496104_0113198_1128_1496 122
143 3300048908 Ga0496105_0203182 Ga0496105_0203182_443_811 122
144 3300048909 Ga0496106_0026949 Ga0496106_0026949_1766_2134 122
145 3300048912 Ga0496109_2006780 Ga0496109_2006780_124_492 122
146 3300048913 Ga0496110_0109118 Ga0496110_0109118_1912_2280 122
147 3300048914 Ga0496111_0029749 Ga0496111_0029749_1820_2188 122
148 3300048915 Ga0496112_0000983 Ga0496112_0000983_1495_1863 122
149 3300048915 Ga0496112_0019725 Ga0496112_0019725_1608_1976 122
150 3300048916 Ga0496113_0031028 Ga0496113_0031028_991_1359 122
151 3300048916 Ga0496113_0355057 Ga0496113_0355057_739_1107 122
152 3300048917 Ga0496114_0503928 Ga0496114_0503928_42_410 122
153 3300048918 Ga0496115_0199420 Ga0496115_0199420_352_720 122
154 3300048929 Ga0496126_0006921 Ga0496126_0006921_3677_4045 122
155 3300053153 Ga0500616_0001582 Ga0500616_0001582_211_579 122
156 3300000549 LJQas_1018981 LJQas_10189812 123
157 3300005338 Ga0068868_100799259 Ga0068868_1007992592 123
158 3300005344 Ga0070661_100221956 Ga0070661_1002219562 123
159 3300005353 Ga0070669_100001472 Ga0070669_1000014726 123
160 3300005365 Ga0070688_100399388 Ga0070688_1003993882 123
161 3300005366 Ga0070659_100000823 Ga0070659_1000008235 123
162 3300005439 Ga0070711_100002198 Ga0070711_10000219815 123
163 3300005440 Ga0070705_100002363 Ga0070705_1000023632 123
164 3300005535 Ga0070684_100240006 Ga0070684_1002400063 123
165 3300005547 Ga0070693_100250349 Ga0070693_1002503492 123
166 3300005577 Ga0068857_100043540 Ga0068857_1000435404 123
167 3300005614 Ga0068856_100252625 Ga0068856_1002526252 123
168 3300005618 Ga0068864_100147534 Ga0068864_1001475343 123
169 3300006881 Ga0068865_101767265 Ga0068865_1017672651 123
170 3300009098 Ga0105245_10302294 Ga0105245_103022942 123
171 3300009545 Ga0105237_11483576 Ga0105237_114835762 123
172 3300009551 Ga0105238_10733494 Ga0105238_107334942 123
173 3300010375 Ga0105239_10066897 Ga0105239_100668975 123
174 3300010375 Ga0105239_10345651 Ga0105239_103456513 123
175 3300014325 Ga0163163_10375598 Ga0163163_103755982 123
176 3300014968 Ga0157379_12621292 Ga0157379_126212922 123
177 3300021377 Ga0213874_10003311 Ga0213874_100033113 123
178 3300025914 Ga0207671_10352954 Ga0207671_103529542 123
179 3300025916 Ga0207663_10001040 Ga0207663_100010406 123
180 3300025925 Ga0207650_10574017 Ga0207650_105740172 123
181 3300026078 Ga0207702_10054282 Ga0207702_100542823 123
182 3300026116 Ga0207674_10030525 Ga0207674_100305253 123
183 3300031548 Ga0307408_101966728 Ga0307408_1019667282 123
184 3300031995 Ga0307409_100360037 Ga0307409_1003600372 123
185 3300032126 Ga0307415_101613984 Ga0307415_1016139842 123
186 3300039450 Ga0436363_0048697 Ga0436363_0048697_4550_4921 123
187 3300039453 Ga0436362_1175837 Ga0436362_1175837_358_729 123
188 3300044694 Ga0466963_0231328 Ga0466963_0231328_258_629 123
189 3300044694 Ga0466963_0658273 Ga0466963_0658273_91_462 123
190 3300044842 Ga0466957_0226151 Ga0466957_0226151_777_1148 123
191 3300045976 Ga0466967_0011018 Ga0466967_0011018_4452_4823 123
192 3300045976 Ga0466967_0444983 Ga0466967_0444983_436_807 123
193 3300045976 Ga0466967_2060615 Ga0466967_2060615_163_534 123
194 3300046615 Ga0495656_0362217 Ga0495656_0362217_133_504 123
195 3300048907 Ga0496104_1556208 Ga0496104_1556208_60_431 123
196 3300048911 Ga0496108_0219294 Ga0496108_0219294_1091_1462 123
197 3300048912 Ga0496109_2067670 Ga0496109_2067670_50_421 123
198 3300048913 Ga0496110_0144777 Ga0496110_0144777_1454_1825 123
199 3300048913 Ga0496110_0502616 Ga0496110_0502616_341_712 123
200 3300048916 Ga0496113_0118180 Ga0496113_0118180_1168_1539 123
201 3300049583 Ga0501067_0324079 Ga0501067_0324079_137_508 123
202 3300049584 Ga0501068_0786142 Ga0501068_0786142_118_489 123
203 3300053083 Ga0495655_0350966 Ga0495655_0350966_58_429 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02537

CRCB

CrcB-like protein, Camphor Resistance (CrcB)

12

125

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bx5-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 with monobody s12 0.9118 6 118
6bqo-assembly1.cif.gz_A structure of a dual topology fluoride channel with monobody s8 0.9011 1 119
5a43-assembly1.cif.gz_B crystal structure of a dual topology fluoride ion channel. 0.9011 6 122
7kkb-assembly1.cif.gz_B fluoride channel fluc-ec2 mutant s81c with bromide 0.8991 6 123
5kbn-assembly1.cif.gz_A the crystal structure of fluoride channel fluc ec2 f80i mutant 0.8987 6 118
ID Description Score Start End Superfamily
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9855 9 115 1.10.287.70
af_P9WP61_13_121_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9589 9 115 1.10.287.70
af_P37002_6_119_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9168 9 116 1.10.287.70
af_Q58918_7_116_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8984 10 115 1.10.287.70
af_Q4D2Y9_236_346_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8893 10 115 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A5B8UC75-F1-model_v4 Fluoride-specific ion channel FluC 0.9965 5 123 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A552ZDL6-F1-model_v4 Fluoride-specific ion channel FluC 0.9911 4 121 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A1E3RS30-F1-model_v4 Fluoride-specific ion channel FluC 0.9906 5 120 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A1Y5PPU9-F1-model_v4 Fluoride-specific ion channel FluC 0.9892 5 120 GO:0005886
GO:0046872
GO:0062054
GO:0140114
AF-A0A5B8TZE5-F1-model_v4 Fluoride-specific ion channel FluC 0.9883 4 119 GO:0005886
GO:0046872
GO:0062054
GO:0140114

Feature Viewer

pLDDT pTM Quality
96.98 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map