F310967
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 203 | 146 | 203 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_101182496|Ga0068853_1011824961 |
| Length | 131 |
| Sequence | MIAAMGVWQKFALVALGGGLGSVARFAVGEWAGQRWGAAFPWGTFIANISGALLIGLLMGIVLSRPSISPAYRLLLGSGFLGGYTTFSSWMYESWALADGGALWRAGGNVLLSVVAGLAAAWVGLQIGRAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 22 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 23 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 24 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 26 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 27 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 28 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 29 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 32 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 33 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 34 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 42 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 50 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 79 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 80 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 81 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 82 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 83 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 84 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 85 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 86 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 87 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 88 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 89 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 90 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 91 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 92 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 93 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 94 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 95 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 99 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 100 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 101 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 102 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 103 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 104 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 105 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 106 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 107 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 108 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 109 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 110 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 111 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 112 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 113 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 114 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 119 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 128 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 129 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 130 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 139 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 140 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 141 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 142 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 144 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 146 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.37 |
| Nodule | 0 |
| Rhizoplane | 13.79 |
| Rhizosphere | 75.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1018981 | 3300000549 | Bacteria | 800 |
| 2 | JGI24743J22301_10153663 | 3300001991 | Bacteria | 517 |
| 3 | JGI24735J21928_10143490 | 3300002067 | Bacteria | 689 |
| 4 | Ga0070683_100036920 | 3300005329 | Bacteria | 4471 |
| 5 | Ga0068868_100022770 | 3300005338 | Bacteria | 4734 |
| 6 | Ga0068868_100799259 | 3300005338 | Bacteria | 851 |
| 7 | Ga0070660_100087193 | 3300005339 | Bacteria | 2457 |
| 8 | Ga0070661_100221956 | 3300005344 | Bacteria | 1450 |
| 9 | Ga0070692_10199819 | 3300005345 | Bacteria | 1170 |
| 10 | Ga0070668_100158241 | 3300005347 | Bacteria | 1836 |
| 11 | Ga0070669_100001472 | 3300005353 | Bacteria | 17027 |
| 12 | Ga0070669_100242361 | 3300005353 | Bacteria | 1433 |
| 13 | Ga0070674_100291323 | 3300005356 | Bacteria | 1298 |
| 14 | Ga0070674_101630399 | 3300005356 | Bacteria | 582 |
| 15 | Ga0070688_100399388 | 3300005365 | Bacteria | 1017 |
| 16 | Ga0070659_100000823 | 3300005366 | Bacteria | 22612 |
| 17 | Ga0070701_10152757 | 3300005438 | Bacteria | 1331 |
| 18 | Ga0070711_100002198 | 3300005439 | Bacteria | 11075 |
| 19 | Ga0070705_100002363 | 3300005440 | Bacteria | 9517 |
| 20 | Ga0070705_101088335 | 3300005440 | Bacteria | 653 |
| 21 | Ga0070685_10109577 | 3300005466 | Bacteria | 1699 |
| 22 | Ga0070684_100240006 | 3300005535 | Bacteria | 1656 |
| 23 | Ga0070684_100543484 | 3300005535 | Bacteria | 1078 |
| 24 | Ga0068853_101182496 | 3300005539 | Unclassified | 738 |
| 25 | Ga0068853_101493867 | 3300005539 | Bacteria | 654 |
| 26 | Ga0070693_100250349 | 3300005547 | Bacteria | 1174 |
| 27 | Ga0068857_100043540 | 3300005577 | Bacteria | 3982 |
| 28 | Ga0068854_100037726 | 3300005578 | Bacteria | 3393 |
| 29 | Ga0068856_100252625 | 3300005614 | Unclassified | 1778 |
| 30 | Ga0070702_100038460 | 3300005615 | Bacteria | 2664 |
| 31 | Ga0068852_100284722 | 3300005616 | Bacteria | 1594 |
| 32 | Ga0068864_100062813 | 3300005618 | Bacteria | 3218 |
| 33 | Ga0068864_100147534 | 3300005618 | Bacteria | 2128 |
| 34 | Ga0068866_10056382 | 3300005718 | Bacteria | 2021 |
| 35 | Ga0068861_100013016 | 3300005719 | Bacteria | 5815 |
| 36 | Ga0068870_10063304 | 3300005840 | Bacteria | 1995 |
| 37 | Ga0068860_100033021 | 3300005843 | Bacteria | 4969 |
| 38 | Ga0068860_100147622 | 3300005843 | Bacteria | 2263 |
| 39 | Ga0075365_10149707 | 3300006038 | Bacteria | 1623 |
| 40 | Ga0075365_10197129 | 3300006038 | Bacteria | 1410 |
| 41 | Ga0075365_10574486 | 3300006038 | Bacteria | 797 |
| 42 | Ga0075364_10020194 | 3300006051 | Bacteria | 4189 |
| 43 | Ga0075364_10087627 | 3300006051 | Bacteria | 2063 |
| 44 | Ga0075364_10391795 | 3300006051 | Bacteria | 948 |
| 45 | Ga0075369_10108528 | 3300006186 | Bacteria | 1250 |
| 46 | Ga0068865_100073945 | 3300006881 | Bacteria | 2425 |
| 47 | Ga0068865_101767265 | 3300006881 | Bacteria | 558 |
| 48 | Ga0105240_10190832 | 3300009093 | Bacteria | 2410 |
| 49 | Ga0111539_10474194 | 3300009094 | Bacteria | 1457 |
| 50 | Ga0105245_10100135 | 3300009098 | Bacteria | 2680 |
| 51 | Ga0105245_10302294 | 3300009098 | Bacteria | 1570 |
| 52 | Ga0105245_10440406 | 3300009098 | Bacteria | 1310 |
| 53 | Ga0105245_12682590 | 3300009098 | Unclassified | 551 |
| 54 | Ga0105243_10040608 | 3300009148 | Bacteria | 3634 |
| 55 | Ga0105237_10167055 | 3300009545 | Bacteria | 2199 |
| 56 | Ga0105237_11483576 | 3300009545 | Bacteria | 685 |
| 57 | Ga0105238_10733494 | 3300009551 | Bacteria | 1001 |
| 58 | Ga0105028_110412 | 3300009993 | Bacteria | 977 |
| 59 | Ga0105239_10048109 | 3300010375 | Bacteria | 4676 |
| 60 | Ga0105239_10066897 | 3300010375 | Bacteria | 3947 |
| 61 | Ga0105239_10345651 | 3300010375 | Bacteria | 1679 |
| 62 | Ga0157369_10330206 | 3300013105 | Bacteria | 1585 |
| 63 | Ga0163163_10375598 | 3300014325 | Bacteria | 1479 |
| 64 | Ga0163163_11815089 | 3300014325 | Bacteria | 670 |
| 65 | Ga0157380_10194304 | 3300014326 | Bacteria | 1794 |
| 66 | Ga0157377_10572647 | 3300014745 | Bacteria | 801 |
| 67 | Ga0157379_10293210 | 3300014968 | Bacteria | 1482 |
| 68 | Ga0157379_12621292 | 3300014968 | Bacteria | 505 |
| 69 | Ga0163161_10578671 | 3300017792 | Bacteria | 923 |
| 70 | Ga0213874_10003311 | 3300021377 | Bacteria | 3563 |
| 71 | Ga0207688_10015233 | 3300025901 | Bacteria | 4173 |
| 72 | Ga0207643_10143310 | 3300025908 | Bacteria | 1428 |
| 73 | Ga0207671_10104207 | 3300025914 | Bacteria | 2152 |
| 74 | Ga0207671_10352954 | 3300025914 | Unclassified | 1166 |
| 75 | Ga0207663_10001040 | 3300025916 | Bacteria | 12723 |
| 76 | Ga0207657_11297131 | 3300025919 | Bacteria | 550 |
| 77 | Ga0207681_10220559 | 3300025923 | Bacteria | 1467 |
| 78 | Ga0207650_10574017 | 3300025925 | Bacteria | 947 |
| 79 | Ga0207687_10044815 | 3300025927 | Bacteria | 3055 |
| 80 | Ga0207706_10087858 | 3300025933 | Bacteria | 2734 |
| 81 | Ga0207709_10168787 | 3300025935 | Bacteria | 1534 |
| 82 | Ga0207670_10295214 | 3300025936 | Bacteria | 1267 |
| 83 | Ga0207704_10221818 | 3300025938 | Bacteria | 1399 |
| 84 | Ga0207711_11227426 | 3300025941 | Bacteria | 691 |
| 85 | Ga0207651_10894197 | 3300025960 | Bacteria | 791 |
| 86 | Ga0207668_10057291 | 3300025972 | Bacteria | 2718 |
| 87 | Ga0207640_10109984 | 3300025981 | Bacteria | 1951 |
| 88 | Ga0207677_10041729 | 3300026023 | Bacteria | 3036 |
| 89 | Ga0207703_10377600 | 3300026035 | Bacteria | 1310 |
| 90 | Ga0207639_11079378 | 3300026041 | Unclassified | 753 |
| 91 | Ga0207708_10025023 | 3300026075 | Bacteria | 4515 |
| 92 | Ga0207708_10929899 | 3300026075 | Bacteria | 753 |
| 93 | Ga0207702_10054282 | 3300026078 | Bacteria | 3395 |
| 94 | Ga0207676_10931900 | 3300026095 | Bacteria | 853 |
| 95 | Ga0207674_10030525 | 3300026116 | Bacteria | 5666 |
| 96 | Ga0207675_100009373 | 3300026118 | Bacteria | 9177 |
| 97 | Ga0207683_10235799 | 3300026121 | Bacteria | 1669 |
| 98 | Ga0207698_10049460 | 3300026142 | Bacteria | 3200 |
| 99 | Ga0268265_10267286 | 3300028380 | Bacteria | 1524 |
| 100 | Ga0268264_10029576 | 3300028381 | Bacteria | 4488 |
| 101 | Ga0268264_10224917 | 3300028381 | Bacteria | 1729 |
| 102 | Ga0265337_1119171 | 3300028556 | Bacteria | 716 |
| 103 | Ga0265330_10534080 | 3300031235 | Unclassified | 500 |
| 104 | Ga0307408_101966728 | 3300031548 | Bacteria | 562 |
| 105 | Ga0265313_10370301 | 3300031595 | Unclassified | 565 |
| 106 | Ga0316578_10183359 | 3300031728 | Bacteria | 1262 |
| 107 | Ga0307409_100360037 | 3300031995 | Bacteria | 1376 |
| 108 | Ga0307415_101613984 | 3300032126 | Bacteria | 623 |
| 109 | Ga0373923_0371483 | 3300035111 | Bacteria | 685 |
| 110 | Ga0316582_0068800 | 3300036647 | Bacteria | 2287 |
| 111 | Ga0316584_0274519 | 3300036712 | Bacteria | 1226 |
| 112 | Ga0395901_0927126 | 3300038443 | Bacteria | 851 |
| 113 | Ga0395901_1471227 | 3300038443 | Bacteria | 638 |
| 114 | Ga0436363_0048697 | 3300039450 | Bacteria | 7463 |
| 115 | Ga0436362_1175837 | 3300039453 | Bacteria | 1532 |
| 116 | Ga0466963_0231328 | 3300044694 | Bacteria | 1295 |
| 117 | Ga0466963_0658273 | 3300044694 | Bacteria | 739 |
| 118 | Ga0466957_0205061 | 3300044842 | Bacteria | 1296 |
| 119 | Ga0466957_0226151 | 3300044842 | Bacteria | 1237 |
| 120 | Ga0466958_0138287 | 3300045836 | Bacteria | 1533 |
| 121 | Ga0466967_0011018 | 3300045976 | Bacteria | 6821 |
| 122 | Ga0466967_0444983 | 3300045976 | Bacteria | 1266 |
| 123 | Ga0466967_2060615 | 3300045976 | Bacteria | 567 |
| 124 | Ga0495650_0000063 | 3300046471 | Bacteria | 277841 |
| 125 | Ga0495656_0362217 | 3300046615 | Bacteria | 753 |
| 126 | Ga0495686_0023496 | 3300047472 | Bacteria | 4066 |
| 127 | Ga0496100_0000895 | 3300048903 | Bacteria | 14217 |
| 128 | Ga0496100_0585757 | 3300048903 | Bacteria | 865 |
| 129 | Ga0496101_0001538 | 3300048904 | Bacteria | 13819 |
| 130 | Ga0496101_0014778 | 3300048904 | Bacteria | 5252 |
| 131 | Ga0496101_0771695 | 3300048904 | Bacteria | 758 |
| 132 | Ga0496101_1074210 | 3300048904 | Bacteria | 632 |
| 133 | Ga0496102_0427725 | 3300048905 | Bacteria | 1243 |
| 134 | Ga0496104_0113198 | 3300048907 | Bacteria | 2602 |
| 135 | Ga0496104_1556208 | 3300048907 | Bacteria | 564 |
| 136 | Ga0496105_0203182 | 3300048908 | Bacteria | 1617 |
| 137 | Ga0496106_0026949 | 3300048909 | Bacteria | 4279 |
| 138 | Ga0496108_0098572 | 3300048911 | Bacteria | 2491 |
| 139 | Ga0496108_0219294 | 3300048911 | Bacteria | 1653 |
| 140 | Ga0496109_1413359 | 3300048912 | Bacteria | 631 |
| 141 | Ga0496109_2006780 | 3300048912 | Bacteria | 510 |
| 142 | Ga0496109_2067670 | 3300048912 | Bacteria | 501 |
| 143 | Ga0496110_0109118 | 3300048913 | Bacteria | 2485 |
| 144 | Ga0496110_0144777 | 3300048913 | Bacteria | 2149 |
| 145 | Ga0496110_0502616 | 3300048913 | Bacteria | 1104 |
| 146 | Ga0496111_0029749 | 3300048914 | Bacteria | 3880 |
| 147 | Ga0496111_0550149 | 3300048914 | Bacteria | 847 |
| 148 | Ga0496112_0000983 | 3300048915 | Bacteria | 20803 |
| 149 | Ga0496112_0019725 | 3300048915 | Bacteria | 6372 |
| 150 | Ga0496113_0031028 | 3300048916 | Bacteria | 3874 |
| 151 | Ga0496113_0118180 | 3300048916 | Bacteria | 2070 |
| 152 | Ga0496113_0355057 | 3300048916 | Bacteria | 1176 |
| 153 | Ga0496114_0503928 | 3300048917 | Bacteria | 1071 |
| 154 | Ga0496115_0199420 | 3300048918 | Bacteria | 1653 |
| 155 | Ga0496124_0235631 | 3300048927 | Bacteria | 1365 |
| 156 | Ga0496126_0006921 | 3300048929 | Bacteria | 12561 |
| 157 | Ga0501031_1094635 | 3300049568 | Bacteria | 508 |
| 158 | Ga0501032_0017705 | 3300049569 | Bacteria | 5001 |
| 159 | Ga0501033_0094964 | 3300049570 | Bacteria | 2179 |
| 160 | Ga0501034_1020566 | 3300049571 | Bacteria | 711 |
| 161 | Ga0501036_0064414 | 3300049572 | Bacteria | 3102 |
| 162 | Ga0501037_0605282 | 3300049573 | Bacteria | 735 |
| 163 | Ga0501038_0008589 | 3300049574 | Bacteria | 9375 |
| 164 | Ga0501042_0002966 | 3300049578 | Bacteria | 10552 |
| 165 | Ga0501046_0021523 | 3300049580 | Bacteria | 5321 |
| 166 | Ga0501046_0043031 | 3300049580 | Bacteria | 3597 |
| 167 | Ga0501047_0000155 | 3300049581 | Bacteria | 83152 |
| 168 | Ga0501047_0490638 | 3300049581 | Bacteria | 1055 |
| 169 | Ga0501048_0067714 | 3300049582 | Bacteria | 2523 |
| 170 | Ga0501048_0859785 | 3300049582 | Unclassified | 652 |
| 171 | Ga0501067_0070105 | 3300049583 | Bacteria | 1941 |
| 172 | Ga0501067_0324079 | 3300049583 | Bacteria | 858 |
| 173 | Ga0501068_0080906 | 3300049584 | Bacteria | 1993 |
| 174 | Ga0501068_0786142 | 3300049584 | Bacteria | 624 |
| 175 | Ga0501070_0144569 | 3300049586 | Bacteria | 1963 |
| 176 | Ga0501072_0065588 | 3300049588 | Bacteria | 2863 |
| 177 | Ga0501073_0124263 | 3300049589 | Bacteria | 1788 |
| 178 | Ga0501074_0361788 | 3300049590 | Bacteria | 1029 |
| 179 | Ga0501079_0418494 | 3300049741 | Bacteria | 1052 |
| 180 | Ga0501079_1046491 | 3300049741 | Bacteria | 643 |
| 181 | Ga0501080_0020938 | 3300049742 | Bacteria | 6052 |
| 182 | Ga0501080_0024987 | 3300049742 | Bacteria | 5542 |
| 183 | Ga0501080_0264165 | 3300049742 | Bacteria | 1567 |
| 184 | Ga0501081_0216217 | 3300049743 | Bacteria | 1393 |
| 185 | Ga0501083_0217319 | 3300049744 | Bacteria | 1245 |
| 186 | Ga0501035_0020979 | 3300049822 | Bacteria | 6004 |
| 187 | Ga0501044_0768533 | 3300049823 | Bacteria | 844 |
| 188 | Ga0501045_0331998 | 3300049824 | Bacteria | 1132 |
| 189 | nmdc:mga00v17_242882_c1 | 3300050491 | Bacteria | 1168 |
| 190 | nmdc:mga00v17_55309_c1 | 3300050491 | Bacteria | 2424 |
| 191 | nmdc:mga00v17_641710_c1 | 3300050491 | Unclassified | 683 |
| 192 | nmdc:mga00v17_898802_c1 | 3300050491 | Bacteria | 561 |
| 193 | nmdc:mga0yw44_15646_c1 | 3300050492 | Bacteria | 4071 |
| 194 | nmdc:mga0yw44_219872_c1 | 3300050492 | Bacteria | 1259 |
| 195 | nmdc:mga0yw44_252522_c1 | 3300050492 | Bacteria | 1174 |
| 196 | nmdc:mga06z11_493012_c1 | 3300050494 | Unclassified | 742 |
| 197 | nmdc:mga07m45_694442_c1 | 3300050496 | Unclassified | 585 |
| 198 | Ga0495655_0002482 | 3300053083 | Bacteria | 2938 |
| 199 | Ga0495655_0350966 | 3300053083 | Unclassified | 516 |
| 200 | Ga0500616_0001582 | 3300053153 | Bacteria | 21267 |
| 201 | Ga0501084_0022356 | 3300054114 | Bacteria | 5278 |
| 202 | Ga0501082_0537227 | 3300060353 | Bacteria | 1022 |
| 203 | Ga0530510_0001175 | 3300061734 | Bacteria | 17412 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050496 | nmdc:mga07m45_694442_c1 | nmdc:mga07m45_694442_c1_61_363 | 100 |
| 2 | 3300048927 | Ga0496124_0235631 | Ga0496124_0235631_546_893 | 106 |
| 3 | 3300044842 | Ga0466957_0205061 | Ga0466957_0205061_39_371 | 110 |
| 4 | 3300045836 | Ga0466958_0138287 | Ga0466958_0138287_1005_1337 | 110 |
| 5 | 3300049571 | Ga0501034_1020566 | Ga0501034_1020566_360_695 | 110 |
| 6 | 3300009993 | Ga0105028_110412 | Ga0105028_1104122 | 112 |
| 7 | 3300031728 | Ga0316578_10183359 | Ga0316578_101833591 | 112 |
| 8 | 3300036712 | Ga0316584_0274519 | Ga0316584_0274519_528_893 | 112 |
| 9 | 3300031235 | Ga0265330_10534080 | Ga0265330_105340801 | 115 |
| 10 | 3300031595 | Ga0265313_10370301 | Ga0265313_103703011 | 115 |
| 11 | 3300049580 | Ga0501046_0021523 | Ga0501046_0021523_2340_2732 | 115 |
| 12 | 3300049581 | Ga0501047_0000155 | Ga0501047_0000155_19159_19551 | 115 |
| 13 | 3300049582 | Ga0501048_0859785 | Ga0501048_0859785_285_632 | 115 |
| 14 | 3300049741 | Ga0501079_0418494 | Ga0501079_0418494_471_818 | 115 |
| 15 | 3300049742 | Ga0501080_0024987 | Ga0501080_0024987_3084_3476 | 115 |
| 16 | 3300049743 | Ga0501081_0216217 | Ga0501081_0216217_230_577 | 115 |
| 17 | 3300005356 | Ga0070674_101630399 | Ga0070674_1016303991 | 116 |
| 18 | 3300005535 | Ga0070684_100543484 | Ga0070684_1005434842 | 116 |
| 19 | 3300009098 | Ga0105245_10440406 | Ga0105245_104404062 | 116 |
| 20 | 3300014325 | Ga0163163_11815089 | Ga0163163_118150891 | 116 |
| 21 | 3300048911 | Ga0496108_0098572 | Ga0496108_0098572_1852_2202 | 116 |
| 22 | 3300048912 | Ga0496109_1413359 | Ga0496109_1413359_224_574 | 116 |
| 23 | 3300048914 | Ga0496111_0550149 | Ga0496111_0550149_464_814 | 116 |
| 24 | 3300049586 | Ga0501070_0144569 | Ga0501070_0144569_927_1292 | 116 |
| 25 | 3300049742 | Ga0501080_0264165 | Ga0501080_0264165_981_1346 | 116 |
| 26 | 3300006038 | Ga0075365_10574486 | Ga0075365_105744862 | 117 |
| 27 | 3300006051 | Ga0075364_10020194 | Ga0075364_100201942 | 117 |
| 28 | 3300006186 | Ga0075369_10108528 | Ga0075369_101085282 | 117 |
| 29 | 3300046471 | Ga0495650_0000063 | Ga0495650_0000063_77603_77956 | 117 |
| 30 | 3300050491 | nmdc:mga00v17_55309_c1 | nmdc:mga00v17_55309_c1_183_536 | 117 |
| 31 | 3300050491 | nmdc:mga00v17_641710_c1 | nmdc:mga00v17_641710_c1_200_553 | 117 |
| 32 | 3300050492 | nmdc:mga0yw44_219872_c1 | nmdc:mga0yw44_219872_c1_851_1204 | 117 |
| 33 | 3300050494 | nmdc:mga06z11_493012_c1 | nmdc:mga06z11_493012_c1_27_380 | 117 |
| 34 | 3300061734 | Ga0530510_0001175 | Ga0530510_0001175_1439_1807 | 117 |
| 35 | 3300036647 | Ga0316582_0068800 | Ga0316582_0068800_843_1208 | 118 |
| 36 | 3300049568 | Ga0501031_1094635 | Ga0501031_1094635_45_404 | 118 |
| 37 | 3300049569 | Ga0501032_0017705 | Ga0501032_0017705_4545_4904 | 118 |
| 38 | 3300049570 | Ga0501033_0094964 | Ga0501033_0094964_1787_2146 | 118 |
| 39 | 3300049572 | Ga0501036_0064414 | Ga0501036_0064414_164_523 | 118 |
| 40 | 3300049573 | Ga0501037_0605282 | Ga0501037_0605282_211_570 | 118 |
| 41 | 3300049574 | Ga0501038_0008589 | Ga0501038_0008589_1742_2101 | 118 |
| 42 | 3300049578 | Ga0501042_0002966 | Ga0501042_0002966_6399_6758 | 118 |
| 43 | 3300049580 | Ga0501046_0043031 | Ga0501046_0043031_128_487 | 118 |
| 44 | 3300049581 | Ga0501047_0490638 | Ga0501047_0490638_193_552 | 118 |
| 45 | 3300049582 | Ga0501048_0067714 | Ga0501048_0067714_1877_2236 | 118 |
| 46 | 3300049583 | Ga0501067_0070105 | Ga0501067_0070105_191_550 | 118 |
| 47 | 3300049584 | Ga0501068_0080906 | Ga0501068_0080906_1588_1947 | 118 |
| 48 | 3300049588 | Ga0501072_0065588 | Ga0501072_0065588_302_661 | 118 |
| 49 | 3300049589 | Ga0501073_0124263 | Ga0501073_0124263_1137_1496 | 118 |
| 50 | 3300049590 | Ga0501074_0361788 | Ga0501074_0361788_58_417 | 118 |
| 51 | 3300049741 | Ga0501079_1046491 | Ga0501079_1046491_197_556 | 118 |
| 52 | 3300049742 | Ga0501080_0020938 | Ga0501080_0020938_2745_3104 | 118 |
| 53 | 3300049744 | Ga0501083_0217319 | Ga0501083_0217319_209_568 | 118 |
| 54 | 3300049822 | Ga0501035_0020979 | Ga0501035_0020979_3087_3446 | 118 |
| 55 | 3300049823 | Ga0501044_0768533 | Ga0501044_0768533_380_739 | 118 |
| 56 | 3300049824 | Ga0501045_0331998 | Ga0501045_0331998_711_1070 | 118 |
| 57 | 3300054114 | Ga0501084_0022356 | Ga0501084_0022356_379_738 | 118 |
| 58 | 3300060353 | Ga0501082_0537227 | Ga0501082_0537227_406_765 | 118 |
| 59 | 3300025919 | Ga0207657_11297131 | Ga0207657_112971312 | 119 |
| 60 | 3300047472 | Ga0495686_0023496 | Ga0495686_0023496_2132_2491 | 119 |
| 61 | 3300001991 | JGI24743J22301_10153663 | JGI24743J22301_101536631 | 120 |
| 62 | 3300005329 | Ga0070683_100036920 | Ga0070683_1000369204 | 120 |
| 63 | 3300009098 | Ga0105245_12682590 | Ga0105245_126825901 | 120 |
| 64 | 3300013105 | Ga0157369_10330206 | Ga0157369_103302064 | 120 |
| 65 | 3300025960 | Ga0207651_10894197 | Ga0207651_108941972 | 120 |
| 66 | 3300053083 | Ga0495655_0002482 | Ga0495655_0002482_2389_2751 | 120 |
| 67 | 3300006038 | Ga0075365_10149707 | Ga0075365_101497073 | 121 |
| 68 | 3300006038 | Ga0075365_10197129 | Ga0075365_101971293 | 121 |
| 69 | 3300006051 | Ga0075364_10087627 | Ga0075364_100876272 | 121 |
| 70 | 3300006051 | Ga0075364_10391795 | Ga0075364_103917952 | 121 |
| 71 | 3300050491 | nmdc:mga00v17_242882_c1 | nmdc:mga00v17_242882_c1_758_1123 | 121 |
| 72 | 3300050491 | nmdc:mga00v17_898802_c1 | nmdc:mga00v17_898802_c1_183_548 | 121 |
| 73 | 3300050492 | nmdc:mga0yw44_15646_c1 | nmdc:mga0yw44_15646_c1_618_983 | 121 |
| 74 | 3300050492 | nmdc:mga0yw44_252522_c1 | nmdc:mga0yw44_252522_c1_59_424 | 121 |
| 75 | 3300002067 | JGI24735J21928_10143490 | JGI24735J21928_101434902 | 122 |
| 76 | 3300005338 | Ga0068868_100022770 | Ga0068868_1000227703 | 122 |
| 77 | 3300005339 | Ga0070660_100087193 | Ga0070660_1000871933 | 122 |
| 78 | 3300005345 | Ga0070692_10199819 | Ga0070692_101998192 | 122 |
| 79 | 3300005347 | Ga0070668_100158241 | Ga0070668_1001582412 | 122 |
| 80 | 3300005353 | Ga0070669_100242361 | Ga0070669_1002423612 | 122 |
| 81 | 3300005356 | Ga0070674_100291323 | Ga0070674_1002913232 | 122 |
| 82 | 3300005438 | Ga0070701_10152757 | Ga0070701_101527572 | 122 |
| 83 | 3300005440 | Ga0070705_101088335 | Ga0070705_1010883351 | 122 |
| 84 | 3300005466 | Ga0070685_10109577 | Ga0070685_101095772 | 122 |
| 85 | 3300005539 | Ga0068853_101182496 | Ga0068853_1011824961 | 122 |
| 86 | 3300005539 | Ga0068853_101493867 | Ga0068853_1014938671 | 122 |
| 87 | 3300005578 | Ga0068854_100037726 | Ga0068854_1000377264 | 122 |
| 88 | 3300005615 | Ga0070702_100038460 | Ga0070702_1000384603 | 122 |
| 89 | 3300005616 | Ga0068852_100284722 | Ga0068852_1002847222 | 122 |
| 90 | 3300005618 | Ga0068864_100062813 | Ga0068864_1000628133 | 122 |
| 91 | 3300005718 | Ga0068866_10056382 | Ga0068866_100563823 | 122 |
| 92 | 3300005719 | Ga0068861_100013016 | Ga0068861_1000130167 | 122 |
| 93 | 3300005840 | Ga0068870_10063304 | Ga0068870_100633043 | 122 |
| 94 | 3300005843 | Ga0068860_100033021 | Ga0068860_1000330216 | 122 |
| 95 | 3300005843 | Ga0068860_100147622 | Ga0068860_1001476223 | 122 |
| 96 | 3300006881 | Ga0068865_100073945 | Ga0068865_1000739453 | 122 |
| 97 | 3300009093 | Ga0105240_10190832 | Ga0105240_101908322 | 122 |
| 98 | 3300009094 | Ga0111539_10474194 | Ga0111539_104741942 | 122 |
| 99 | 3300009098 | Ga0105245_10100135 | Ga0105245_101001352 | 122 |
| 100 | 3300009148 | Ga0105243_10040608 | Ga0105243_100406082 | 122 |
| 101 | 3300009545 | Ga0105237_10167055 | Ga0105237_101670553 | 122 |
| 102 | 3300010375 | Ga0105239_10048109 | Ga0105239_100481096 | 122 |
| 103 | 3300014326 | Ga0157380_10194304 | Ga0157380_101943042 | 122 |
| 104 | 3300014745 | Ga0157377_10572647 | Ga0157377_105726472 | 122 |
| 105 | 3300014968 | Ga0157379_10293210 | Ga0157379_102932102 | 122 |
| 106 | 3300017792 | Ga0163161_10578671 | Ga0163161_105786712 | 122 |
| 107 | 3300025901 | Ga0207688_10015233 | Ga0207688_100152332 | 122 |
| 108 | 3300025908 | Ga0207643_10143310 | Ga0207643_101433102 | 122 |
| 109 | 3300025914 | Ga0207671_10104207 | Ga0207671_101042073 | 122 |
| 110 | 3300025923 | Ga0207681_10220559 | Ga0207681_102205592 | 122 |
| 111 | 3300025927 | Ga0207687_10044815 | Ga0207687_100448152 | 122 |
| 112 | 3300025933 | Ga0207706_10087858 | Ga0207706_100878583 | 122 |
| 113 | 3300025935 | Ga0207709_10168787 | Ga0207709_101687872 | 122 |
| 114 | 3300025936 | Ga0207670_10295214 | Ga0207670_102952142 | 122 |
| 115 | 3300025938 | Ga0207704_10221818 | Ga0207704_102218182 | 122 |
| 116 | 3300025941 | Ga0207711_11227426 | Ga0207711_112274261 | 122 |
| 117 | 3300025972 | Ga0207668_10057291 | Ga0207668_100572913 | 122 |
| 118 | 3300025981 | Ga0207640_10109984 | Ga0207640_101099842 | 122 |
| 119 | 3300026023 | Ga0207677_10041729 | Ga0207677_100417293 | 122 |
| 120 | 3300026035 | Ga0207703_10377600 | Ga0207703_103776002 | 122 |
| 121 | 3300026041 | Ga0207639_11079378 | Ga0207639_110793782 | 122 |
| 122 | 3300026075 | Ga0207708_10025023 | Ga0207708_100250236 | 122 |
| 123 | 3300026075 | Ga0207708_10929899 | Ga0207708_109298992 | 122 |
| 124 | 3300026095 | Ga0207676_10931900 | Ga0207676_109319001 | 122 |
| 125 | 3300026118 | Ga0207675_100009373 | Ga0207675_1000093734 | 122 |
| 126 | 3300026121 | Ga0207683_10235799 | Ga0207683_102357992 | 122 |
| 127 | 3300026142 | Ga0207698_10049460 | Ga0207698_100494603 | 122 |
| 128 | 3300028380 | Ga0268265_10267286 | Ga0268265_102672862 | 122 |
| 129 | 3300028381 | Ga0268264_10029576 | Ga0268264_100295762 | 122 |
| 130 | 3300028381 | Ga0268264_10224917 | Ga0268264_102249173 | 122 |
| 131 | 3300028556 | Ga0265337_1119171 | Ga0265337_11191712 | 122 |
| 132 | 3300035111 | Ga0373923_0371483 | Ga0373923_0371483_201_569 | 122 |
| 133 | 3300038443 | Ga0395901_0927126 | Ga0395901_0927126_169_537 | 122 |
| 134 | 3300038443 | Ga0395901_1471227 | Ga0395901_1471227_146_514 | 122 |
| 135 | 3300048903 | Ga0496100_0000895 | Ga0496100_0000895_11409_11777 | 122 |
| 136 | 3300048903 | Ga0496100_0585757 | Ga0496100_0585757_292_660 | 122 |
| 137 | 3300048904 | Ga0496101_0001538 | Ga0496101_0001538_2499_2867 | 122 |
| 138 | 3300048904 | Ga0496101_0014778 | Ga0496101_0014778_311_679 | 122 |
| 139 | 3300048904 | Ga0496101_0771695 | Ga0496101_0771695_20_388 | 122 |
| 140 | 3300048904 | Ga0496101_1074210 | Ga0496101_1074210_116_484 | 122 |
| 141 | 3300048905 | Ga0496102_0427725 | Ga0496102_0427725_524_892 | 122 |
| 142 | 3300048907 | Ga0496104_0113198 | Ga0496104_0113198_1128_1496 | 122 |
| 143 | 3300048908 | Ga0496105_0203182 | Ga0496105_0203182_443_811 | 122 |
| 144 | 3300048909 | Ga0496106_0026949 | Ga0496106_0026949_1766_2134 | 122 |
| 145 | 3300048912 | Ga0496109_2006780 | Ga0496109_2006780_124_492 | 122 |
| 146 | 3300048913 | Ga0496110_0109118 | Ga0496110_0109118_1912_2280 | 122 |
| 147 | 3300048914 | Ga0496111_0029749 | Ga0496111_0029749_1820_2188 | 122 |
| 148 | 3300048915 | Ga0496112_0000983 | Ga0496112_0000983_1495_1863 | 122 |
| 149 | 3300048915 | Ga0496112_0019725 | Ga0496112_0019725_1608_1976 | 122 |
| 150 | 3300048916 | Ga0496113_0031028 | Ga0496113_0031028_991_1359 | 122 |
| 151 | 3300048916 | Ga0496113_0355057 | Ga0496113_0355057_739_1107 | 122 |
| 152 | 3300048917 | Ga0496114_0503928 | Ga0496114_0503928_42_410 | 122 |
| 153 | 3300048918 | Ga0496115_0199420 | Ga0496115_0199420_352_720 | 122 |
| 154 | 3300048929 | Ga0496126_0006921 | Ga0496126_0006921_3677_4045 | 122 |
| 155 | 3300053153 | Ga0500616_0001582 | Ga0500616_0001582_211_579 | 122 |
| 156 | 3300000549 | LJQas_1018981 | LJQas_10189812 | 123 |
| 157 | 3300005338 | Ga0068868_100799259 | Ga0068868_1007992592 | 123 |
| 158 | 3300005344 | Ga0070661_100221956 | Ga0070661_1002219562 | 123 |
| 159 | 3300005353 | Ga0070669_100001472 | Ga0070669_1000014726 | 123 |
| 160 | 3300005365 | Ga0070688_100399388 | Ga0070688_1003993882 | 123 |
| 161 | 3300005366 | Ga0070659_100000823 | Ga0070659_1000008235 | 123 |
| 162 | 3300005439 | Ga0070711_100002198 | Ga0070711_10000219815 | 123 |
| 163 | 3300005440 | Ga0070705_100002363 | Ga0070705_1000023632 | 123 |
| 164 | 3300005535 | Ga0070684_100240006 | Ga0070684_1002400063 | 123 |
| 165 | 3300005547 | Ga0070693_100250349 | Ga0070693_1002503492 | 123 |
| 166 | 3300005577 | Ga0068857_100043540 | Ga0068857_1000435404 | 123 |
| 167 | 3300005614 | Ga0068856_100252625 | Ga0068856_1002526252 | 123 |
| 168 | 3300005618 | Ga0068864_100147534 | Ga0068864_1001475343 | 123 |
| 169 | 3300006881 | Ga0068865_101767265 | Ga0068865_1017672651 | 123 |
| 170 | 3300009098 | Ga0105245_10302294 | Ga0105245_103022942 | 123 |
| 171 | 3300009545 | Ga0105237_11483576 | Ga0105237_114835762 | 123 |
| 172 | 3300009551 | Ga0105238_10733494 | Ga0105238_107334942 | 123 |
| 173 | 3300010375 | Ga0105239_10066897 | Ga0105239_100668975 | 123 |
| 174 | 3300010375 | Ga0105239_10345651 | Ga0105239_103456513 | 123 |
| 175 | 3300014325 | Ga0163163_10375598 | Ga0163163_103755982 | 123 |
| 176 | 3300014968 | Ga0157379_12621292 | Ga0157379_126212922 | 123 |
| 177 | 3300021377 | Ga0213874_10003311 | Ga0213874_100033113 | 123 |
| 178 | 3300025914 | Ga0207671_10352954 | Ga0207671_103529542 | 123 |
| 179 | 3300025916 | Ga0207663_10001040 | Ga0207663_100010406 | 123 |
| 180 | 3300025925 | Ga0207650_10574017 | Ga0207650_105740172 | 123 |
| 181 | 3300026078 | Ga0207702_10054282 | Ga0207702_100542823 | 123 |
| 182 | 3300026116 | Ga0207674_10030525 | Ga0207674_100305253 | 123 |
| 183 | 3300031548 | Ga0307408_101966728 | Ga0307408_1019667282 | 123 |
| 184 | 3300031995 | Ga0307409_100360037 | Ga0307409_1003600372 | 123 |
| 185 | 3300032126 | Ga0307415_101613984 | Ga0307415_1016139842 | 123 |
| 186 | 3300039450 | Ga0436363_0048697 | Ga0436363_0048697_4550_4921 | 123 |
| 187 | 3300039453 | Ga0436362_1175837 | Ga0436362_1175837_358_729 | 123 |
| 188 | 3300044694 | Ga0466963_0231328 | Ga0466963_0231328_258_629 | 123 |
| 189 | 3300044694 | Ga0466963_0658273 | Ga0466963_0658273_91_462 | 123 |
| 190 | 3300044842 | Ga0466957_0226151 | Ga0466957_0226151_777_1148 | 123 |
| 191 | 3300045976 | Ga0466967_0011018 | Ga0466967_0011018_4452_4823 | 123 |
| 192 | 3300045976 | Ga0466967_0444983 | Ga0466967_0444983_436_807 | 123 |
| 193 | 3300045976 | Ga0466967_2060615 | Ga0466967_2060615_163_534 | 123 |
| 194 | 3300046615 | Ga0495656_0362217 | Ga0495656_0362217_133_504 | 123 |
| 195 | 3300048907 | Ga0496104_1556208 | Ga0496104_1556208_60_431 | 123 |
| 196 | 3300048911 | Ga0496108_0219294 | Ga0496108_0219294_1091_1462 | 123 |
| 197 | 3300048912 | Ga0496109_2067670 | Ga0496109_2067670_50_421 | 123 |
| 198 | 3300048913 | Ga0496110_0144777 | Ga0496110_0144777_1454_1825 | 123 |
| 199 | 3300048913 | Ga0496110_0502616 | Ga0496110_0502616_341_712 | 123 |
| 200 | 3300048916 | Ga0496113_0118180 | Ga0496113_0118180_1168_1539 | 123 |
| 201 | 3300049583 | Ga0501067_0324079 | Ga0501067_0324079_137_508 | 123 |
| 202 | 3300049584 | Ga0501068_0786142 | Ga0501068_0786142_118_489 | 123 |
| 203 | 3300053083 | Ga0495655_0350966 | Ga0495655_0350966_58_429 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bx5-assembly1.cif.gz_A | the crystal structure of fluoride channel fluc ec2 with monobody s12 | 0.9118 | 6 | 118 |
| 6bqo-assembly1.cif.gz_A | structure of a dual topology fluoride channel with monobody s8 | 0.9011 | 1 | 119 |
| 5a43-assembly1.cif.gz_B | crystal structure of a dual topology fluoride ion channel. | 0.9011 | 6 | 122 |
| 7kkb-assembly1.cif.gz_B | fluoride channel fluc-ec2 mutant s81c with bromide | 0.8991 | 6 | 123 |
| 5kbn-assembly1.cif.gz_A | the crystal structure of fluoride channel fluc ec2 f80i mutant | 0.8987 | 6 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WP61_13_121_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9855 | 9 | 115 | 1.10.287.70 |
| af_P9WP61_13_121_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9589 | 9 | 115 | 1.10.287.70 |
| af_P37002_6_119_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9168 | 9 | 116 | 1.10.287.70 |
| af_Q58918_7_116_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8984 | 10 | 115 | 1.10.287.70 |
| af_Q4D2Y9_236_346_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8893 | 10 | 115 | 1.10.287.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5B8UC75-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9965 | 5 | 123 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-A0A552ZDL6-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9911 | 4 | 121 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-A0A1E3RS30-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9906 | 5 | 120 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-A0A1Y5PPU9-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9892 | 5 | 120 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
| AF-A0A5B8TZE5-F1-model_v4 | Fluoride-specific ion channel FluC | 0.9883 | 4 | 119 |
GO:0005886
GO:0046872 GO:0062054 GO:0140114 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar