F310763

General Info

Members Datasets Scaffolds Average Seq Length
203 125 406 187

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100003938|Ga0070683_1000039382
Length 196
Sequence VIELKRGDEMALIRPDGAPLGKLTMGLGWDKKPGAGALSGSNTPDVDLDASAIQYAGDQLFDLAFFNHLETRDGSVVHLGDNISGRGEGDDEQITIDLVRVYPKVDTMLFLVSSYQGHSLEFVHSAYCRLVEEDDEGDAAEIARFTLTEGVPRTGFMLAKMFRDPDNTDGWRLKAIGQGIAVSVPTESLDVLQRFV

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
30 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
34 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
35 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
37 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
53 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
57 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
58 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
59 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
60 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
61 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
64 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
65 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
66 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
67 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
68 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
69 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
70 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
71 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
75 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
76 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
79 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
80 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
81 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
82 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
83 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
86 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
87 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
88 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
89 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
90 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
91 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
92 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
100 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
101 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
102 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
105 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
108 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
109 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
110 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
113 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
116 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
117 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
118 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
119 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
120 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
124 2643221641 Nocardioides sp. Root122 Isolate Unclassified
125 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0.49
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.73
Nodule 0.49
Rhizoplane 19.7
Rhizosphere 59.61
Stem 0
Stem Tuber 0
Unclassified 1.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100003938 3300005329 Bacteria 12145
2 JGI24740J21852_10028338 3300001979 Bacteria 1851
3 JGI24739J22299_10112464 3300001989 Bacteria 816
4 rootL2_10088649 3300003322 Bacteria 1431
5 Ga0070658_10561634 3300005327 Bacteria 988
6 Ga0070658_11011347 3300005327 Bacteria 723
7 Ga0070683_100005822 3300005329 Bacteria 10314
8 Ga0070683_100163614 3300005329 Bacteria 2111
9 Ga0070680_100880632 3300005336 Bacteria 772
10 Ga0070682_100075835 3300005337 Bacteria 2163
11 Ga0070682_100514731 3300005337 Bacteria 930
12 Ga0070660_100137941 3300005339 Bacteria 1955
13 Ga0070681_10164326 3300005458 Bacteria 2143
14 Ga0070679_100006112 3300005530 Bacteria 11200
15 Ga0070665_100000273 3300005548 Bacteria 84592
16 Ga0068855_101140526 3300005563 Bacteria 813
17 Ga0068852_101175787 3300005616 Bacteria 788
18 Ga0068866_10303282 3300005718 Bacteria 998
19 Ga0068861_100119479 3300005719 Bacteria 2124
20 Ga0068870_10101481 3300005840 Bacteria 1627
21 Ga0075365_10011491 3300006038 Bacteria 5209
22 Ga0075365_10046867 3300006038 Bacteria 2840
23 Ga0075368_10000633 3300006042 Bacteria 10650
24 Ga0075368_10001958 3300006042 Bacteria 6629
25 Ga0075363_100001382 3300006048 Bacteria 9146
26 Ga0075363_100003131 3300006048 Bacteria 6951
27 Ga0075363_100030104 3300006048 Bacteria 2808
28 Ga0075364_10009228 3300006051 Bacteria 5911
29 Ga0075364_10010664 3300006051 Bacteria 5557
30 Ga0075364_10421879 3300006051 Bacteria 911
31 Ga0075362_10002312 3300006177 Bacteria 6372
32 Ga0075367_10073246 3300006178 Bacteria 2063
33 Ga0075367_10147205 3300006178 Bacteria 1461
34 Ga0075367_10278644 3300006178 Bacteria 1051
35 Ga0075370_10016040 3300006353 Bacteria 4025
36 Ga0075370_10039968 3300006353 Bacteria 2644
37 Ga0075370_10154184 3300006353 Bacteria 1347
38 Ga0105245_10026481 3300009098 Bacteria 5104
39 Ga0105245_10145274 3300009098 Bacteria 2238
40 Ga0105245_10318680 3300009098 Bacteria 1531
41 Ga0105243_10082550 3300009148 Bacteria 2627
42 Ga0105248_11433980 3300009177 Bacteria 781
43 Ga0105238_10674959 3300009551 Bacteria 1044
44 Ga0105238_10906942 3300009551 Bacteria 900
45 Ga0105238_11271094 3300009551 Bacteria 761
46 Ga0105249_10139340 3300009553 Bacteria 2324
47 Ga0157374_11368287 3300013296 Bacteria 730
48 Ga0157375_10410985 3300013308 Bacteria 1519
49 Ga0163163_10951248 3300014325 Bacteria 922
50 Ga0163163_11078999 3300014325 Bacteria 866
51 Ga0182008_10168594 3300014497 Bacteria 1105
52 Ga0157379_10682013 3300014968 Bacteria 963
53 Ga0163161_10599669 3300017792 Bacteria 908
54 Ga0206353_10306987 3300020082 Bacteria 2675
55 Ga0213876_10047960 3300021384 Bacteria 2258
56 Ga0207642_10219477 3300025899 Bacteria 1062
57 Ga0207647_10018975 3300025904 Bacteria 4633
58 Ga0207707_10672490 3300025912 Bacteria 871
59 Ga0207660_10717292 3300025917 Bacteria 816
60 Ga0207657_10569565 3300025919 Bacteria 885
61 Ga0207652_10004665 3300025921 Bacteria 11112
62 Ga0207709_10258827 3300025935 Bacteria 1275
63 Ga0207704_10102310 3300025938 Bacteria 1913
64 Ga0207661_10048295 3300025944 Bacteria 3381
65 Ga0207661_10563685 3300025944 Bacteria 1044
66 Ga0207712_10478067 3300025961 Bacteria 1061
67 Ga0207639_10141342 3300026041 Bacteria 2006
68 Ga0207702_11468555 3300026078 Bacteria 675
69 Ga0207674_10022719 3300026116 Bacteria 6730
70 Ga0207675_100196945 3300026118 Bacteria 1934
71 Ga0207675_100411250 3300026118 Bacteria 1335
72 Ga0207698_10671028 3300026142 Bacteria 1029
73 Ga0207698_11200112 3300026142 Bacteria 773
74 Ga0209813_10001174 3300027866 Bacteria 5840
75 Ga0209813_10010926 3300027866 Bacteria 2361
76 Ga0268266_10002137 3300028379 Bacteria 21775
77 Ga0307413_10057230 3300031824 Bacteria 2383
78 Ga0307413_10411774 3300031824 Bacteria 1062
79 Ga0307413_10414024 3300031824 Bacteria 1060
80 Ga0307410_10361275 3300031852 Bacteria 1163
81 Ga0307407_10060236 3300031903 Bacteria 2215
82 Ga0307407_10101773 3300031903 Bacteria 1785
83 Ga0307409_100175476 3300031995 Bacteria 1891
84 Ga0307416_100466642 3300032002 Bacteria 1319
85 Ga0307414_10289282 3300032004 Bacteria 1381
86 Ga0307411_10423375 3300032005 Bacteria 1107
87 Ga0307411_10515763 3300032005 Bacteria 1014
88 Ga0307415_100246869 3300032126 Bacteria 1448
89 Ga0373925_1185180 3300037068 Bacteria 628
90 Ga0395905_0267781 3300037471 Bacteria 1594
91 Ga0436365_1776603 3300039437 Bacteria 3244
92 Ga0439436_0050016 3300041404 Bacteria 1184
93 Ga0439438_088100 3300041405 Bacteria 758
94 Ga0451791_0379347 3300041451 Bacteria 1129
95 Ga0451797_0005416 3300041453 Bacteria 1930
96 Ga0451797_0933370 3300041453 Unclassified 724
97 Ga0451853_3154955 3300041512 Bacteria 2863
98 Ga0466963_0123916 3300044694 Bacteria 1781
99 Ga0466963_0166026 3300044694 Bacteria 1538
100 Ga0466963_0211223 3300044694 Bacteria 1358
101 Ga0466964_0025007 3300044706 Bacteria 2330
102 Ga0466967_0022913 3300045976 Bacteria 5106
103 Ga0466967_0160509 3300045976 Bacteria 2109
104 Ga0466967_0555332 3300045976 Bacteria 1130
105 Ga0495603_0460299 3300046455 Bacteria 728
106 Ga0495641_0152691 3300046461 Bacteria 1032
107 Ga0495582_0199336 3300046473 Bacteria 1143
108 Ga0495639_0162930 3300046475 Bacteria 1080
109 Ga0495608_0635973 3300046511 Bacteria 638
110 Ga0495581_0225116 3300047315 Bacteria 1097
111 Ga0495674_0258369 3300047319 Bacteria 1432
112 Ga0496100_0424894 3300048903 Bacteria 1015
113 Ga0496100_0538306 3300048903 Bacteria 902
114 Ga0496100_0737838 3300048903 Bacteria 770
115 Ga0496101_0029424 3300048904 Bacteria 3842
116 Ga0496101_0061855 3300048904 Bacteria 2720
117 Ga0496101_0217237 3300048904 Bacteria 1483
118 Ga0496101_0323745 3300048904 Bacteria 1210
119 Ga0496102_0023085 3300048905 Bacteria 5520
120 Ga0496102_0545406 3300048905 Bacteria 1082
121 Ga0496102_0695592 3300048905 Bacteria 940
122 Ga0496103_0068172 3300048906 Bacteria 2223
123 Ga0496103_0306495 3300048906 Bacteria 1022
124 Ga0496104_0001223 3300048907 Bacteria 22094
125 Ga0496104_1079717 3300048907 Bacteria 706
126 Ga0496105_0000120 3300048908 Bacteria 53984
127 Ga0496105_0363948 3300048908 Bacteria 1153
128 Ga0496105_1290900 3300048908 Bacteria 533
129 Ga0496106_0183995 3300048909 Bacteria 1659
130 Ga0496106_0330376 3300048909 Bacteria 1224
131 Ga0496107_0279342 3300048910 Bacteria 1243
132 Ga0496107_0566310 3300048910 Bacteria 841
133 Ga0496108_0041803 3300048911 Bacteria 3828
134 Ga0496108_0048140 3300048911 Bacteria 3564
135 Ga0496108_0097453 3300048911 Bacteria 2506
136 Ga0496108_0805169 3300048911 Bacteria 810
137 Ga0496109_0236100 3300048912 Bacteria 1720
138 Ga0496109_0379986 3300048912 Unclassified 1334
139 Ga0496110_0054206 3300048913 Bacteria 3527
140 Ga0496111_0011767 3300048914 Bacteria 5907
141 Ga0496114_0002783 3300048917 Bacteria 13389
142 Ga0496114_0026679 3300048917 Bacteria 4731
143 Ga0496114_0029762 3300048917 Bacteria 4489
144 Ga0496114_0072603 3300048917 Bacteria 2894
145 Ga0496114_0379551 3300048917 Bacteria 1251
146 Ga0496114_0493124 3300048917 Bacteria 1084
147 Ga0496115_0035674 3300048918 Bacteria 3936
148 Ga0496115_0067587 3300048918 Bacteria 2891
149 Ga0501031_0156107 3300049568 Bacteria 1491
150 Ga0501031_0163769 3300049568 Bacteria 1454
151 Ga0501031_0605725 3300049568 Bacteria 705
152 Ga0501034_0118442 3300049571 Bacteria 2635
153 Ga0501036_0322197 3300049572 Bacteria 1291
154 Ga0501036_0385330 3300049572 Unclassified 1170
155 Ga0501036_1105796 3300049572 Bacteria 647
156 Ga0501039_0476210 3300049575 Bacteria 980
157 Ga0501040_0473540 3300049576 Bacteria 902
158 Ga0501067_0003673 3300049583 Bacteria 8456
159 Ga0501067_0006281 3300049583 Bacteria 6592
160 Ga0501067_0061231 3300049583 Bacteria 2084
161 Ga0501068_0211469 3300049584 Bacteria 1232
162 Ga0501070_0001044 3300049586 Bacteria 24944
163 Ga0501070_0011585 3300049586 Bacteria 7445
164 Ga0501070_0096433 3300049586 Bacteria 2446
165 Ga0501071_0014640 3300049587 Bacteria 5368
166 Ga0501072_0191632 3300049588 Bacteria 1630
167 Ga0501072_0339729 3300049588 Bacteria 1193
168 Ga0501073_0015363 3300049589 Bacteria 5552
169 Ga0501073_0038762 3300049589 Bacteria 3378
170 Ga0501074_0003036 3300049590 Bacteria 11827
171 Ga0501074_0015998 3300049590 Bacteria 5453
172 Ga0501074_0240510 3300049590 Bacteria 1287
173 Ga0501075_0767556 3300049591 Bacteria 734
174 Ga0501076_0299264 3300049592 Bacteria 1319
175 Ga0501077_0012249 3300049593 Bacteria 5371
176 Ga0501202_057469 3300049652 Bacteria 873
177 Ga0501079_0184784 3300049741 Bacteria 1627
178 Ga0501080_0006681 3300049742 Bacteria 10381
179 Ga0501080_0021999 3300049742 Bacteria 5906
180 nmdc:mga03683_21117_c2 3300050489 Bacteria 1562
181 nmdc:mga03n38_100726_c1 3300050490 Bacteria 1393
182 nmdc:mga03n38_359649_c1 3300050490 Bacteria 794
183 nmdc:mga03n38_8092_c1 3300050490 Bacteria 3754
184 nmdc:mga00v17_178354_c1 3300050491 Bacteria 1370
185 nmdc:mga00v17_54981_c1 3300050491 Bacteria 2430
186 nmdc:mga00v17_8800_c1 3300050491 Bacteria 5439
187 nmdc:mga0yw44_15062_c1 3300050492 Bacteria 4129
188 nmdc:mga0yw44_5953_c1 3300050492 Bacteria 5835
189 nmdc:mga06z11_113787_c1 3300050494 Bacteria 1501
190 nmdc:mga06z11_193738_c1 3300050494 Bacteria 1178
191 nmdc:mga06z11_280741_c1 3300050494 Bacteria 987
192 nmdc:mga06z11_564572_c1 3300050494 Bacteria 691
193 nmdc:mga04h51_2139_c1 3300050495 Bacteria 4629
194 nmdc:mga04h51_3611_c1 3300050495 Bacteria 3776
195 nmdc:mga07m45_46578_c1 3300050496 Bacteria 2437
196 nmdc:mga07m45_7686_c2 3300050496 Bacteria 4410
197 Ga0495595_0190658 3300053084 Bacteria 1019
198 Ga0495619_0235997 3300053085 Bacteria 1267
199 Ga0501084_0006158 3300054114 Bacteria 9865
200 Ga0590075_090005 3300059424 Bacteria 796
201 Ga0501082_0050296 3300060353 Bacteria 3594
202 2644230797 2643221641 Bacteria 4490190
203 8054610515 8054609563 Bacteria 5170090
204 Ga0070683_100003938
205 JGI24740J21852_10028338
206 JGI24739J22299_10112464
207 rootL2_10088649
208 Ga0070658_10561634
209 Ga0070658_11011347
210 Ga0070683_100005822
211 Ga0070683_100163614
212 Ga0070680_100880632
213 Ga0070682_100075835
214 Ga0070682_100514731
215 Ga0070660_100137941
216 Ga0070681_10164326
217 Ga0070679_100006112
218 Ga0070665_100000273
219 Ga0068855_101140526
220 Ga0068852_101175787
221 Ga0068866_10303282
222 Ga0068861_100119479
223 Ga0068870_10101481
224 Ga0075365_10011491
225 Ga0075365_10046867
226 Ga0075368_10000633
227 Ga0075368_10001958
228 Ga0075363_100001382
229 Ga0075363_100003131
230 Ga0075363_100030104
231 Ga0075364_10009228
232 Ga0075364_10010664
233 Ga0075364_10421879
234 Ga0075362_10002312
235 Ga0075367_10073246
236 Ga0075367_10147205
237 Ga0075367_10278644
238 Ga0075370_10016040
239 Ga0075370_10039968
240 Ga0075370_10154184
241 Ga0105245_10026481
242 Ga0105245_10145274
243 Ga0105245_10318680
244 Ga0105243_10082550
245 Ga0105248_11433980
246 Ga0105238_10674959
247 Ga0105238_10906942
248 Ga0105238_11271094
249 Ga0105249_10139340
250 Ga0157374_11368287
251 Ga0157375_10410985
252 Ga0163163_10951248
253 Ga0163163_11078999
254 Ga0182008_10168594
255 Ga0157379_10682013
256 Ga0163161_10599669
257 Ga0206353_10306987
258 Ga0213876_10047960
259 Ga0207642_10219477
260 Ga0207647_10018975
261 Ga0207707_10672490
262 Ga0207660_10717292
263 Ga0207657_10569565
264 Ga0207652_10004665
265 Ga0207709_10258827
266 Ga0207704_10102310
267 Ga0207661_10048295
268 Ga0207661_10563685
269 Ga0207712_10478067
270 Ga0207639_10141342
271 Ga0207702_11468555
272 Ga0207674_10022719
273 Ga0207675_100196945
274 Ga0207675_100411250
275 Ga0207698_10671028
276 Ga0207698_11200112
277 Ga0209813_10001174
278 Ga0209813_10010926
279 Ga0268266_10002137
280 Ga0307413_10057230
281 Ga0307413_10411774
282 Ga0307413_10414024
283 Ga0307410_10361275
284 Ga0307407_10060236
285 Ga0307407_10101773
286 Ga0307409_100175476
287 Ga0307416_100466642
288 Ga0307414_10289282
289 Ga0307411_10423375
290 Ga0307411_10515763
291 Ga0307415_100246869
292 Ga0373925_1185180
293 Ga0395905_0267781
294 Ga0436365_1776603
295 Ga0439436_0050016
296 Ga0439438_088100
297 Ga0451791_0379347
298 Ga0451797_0005416
299 Ga0451797_0933370
300 Ga0451853_3154955
301 Ga0466963_0123916
302 Ga0466963_0166026
303 Ga0466963_0211223
304 Ga0466964_0025007
305 Ga0466967_0022913
306 Ga0466967_0160509
307 Ga0466967_0555332
308 Ga0495603_0460299
309 Ga0495641_0152691
310 Ga0495582_0199336
311 Ga0495639_0162930
312 Ga0495608_0635973
313 Ga0495581_0225116
314 Ga0495674_0258369
315 Ga0496100_0424894
316 Ga0496100_0538306
317 Ga0496100_0737838
318 Ga0496101_0029424
319 Ga0496101_0061855
320 Ga0496101_0217237
321 Ga0496101_0323745
322 Ga0496102_0023085
323 Ga0496102_0545406
324 Ga0496102_0695592
325 Ga0496103_0068172
326 Ga0496103_0306495
327 Ga0496104_0001223
328 Ga0496104_1079717
329 Ga0496105_0000120
330 Ga0496105_0363948
331 Ga0496105_1290900
332 Ga0496106_0183995
333 Ga0496106_0330376
334 Ga0496107_0279342
335 Ga0496107_0566310
336 Ga0496108_0041803
337 Ga0496108_0048140
338 Ga0496108_0097453
339 Ga0496108_0805169
340 Ga0496109_0236100
341 Ga0496109_0379986
342 Ga0496110_0054206
343 Ga0496111_0011767
344 Ga0496114_0002783
345 Ga0496114_0026679
346 Ga0496114_0029762
347 Ga0496114_0072603
348 Ga0496114_0379551
349 Ga0496114_0493124
350 Ga0496115_0035674
351 Ga0496115_0067587
352 Ga0501031_0156107
353 Ga0501031_0163769
354 Ga0501031_0605725
355 Ga0501034_0118442
356 Ga0501036_0322197
357 Ga0501036_0385330
358 Ga0501036_1105796
359 Ga0501039_0476210
360 Ga0501040_0473540
361 Ga0501067_0003673
362 Ga0501067_0006281
363 Ga0501067_0061231
364 Ga0501068_0211469
365 Ga0501070_0001044
366 Ga0501070_0011585
367 Ga0501070_0096433
368 Ga0501071_0014640
369 Ga0501072_0191632
370 Ga0501072_0339729
371 Ga0501073_0015363
372 Ga0501073_0038762
373 Ga0501074_0003036
374 Ga0501074_0015998
375 Ga0501074_0240510
376 Ga0501075_0767556
377 Ga0501076_0299264
378 Ga0501077_0012249
379 Ga0501202_057469
380 Ga0501079_0184784
381 Ga0501080_0006681
382 Ga0501080_0021999
383 nmdc:mga03683_21117_c2
384 nmdc:mga03n38_100726_c1
385 nmdc:mga03n38_359649_c1
386 nmdc:mga03n38_8092_c1
387 nmdc:mga00v17_178354_c1
388 nmdc:mga00v17_54981_c1
389 nmdc:mga00v17_8800_c1
390 nmdc:mga0yw44_15062_c1
391 nmdc:mga0yw44_5953_c1
392 nmdc:mga06z11_113787_c1
393 nmdc:mga06z11_193738_c1
394 nmdc:mga06z11_280741_c1
395 nmdc:mga06z11_564572_c1
396 nmdc:mga04h51_2139_c1
397 nmdc:mga04h51_3611_c1
398 nmdc:mga07m45_46578_c1
399 nmdc:mga07m45_7686_c2
400 Ga0495595_0190658
401 Ga0495619_0235997
402 Ga0501084_0006158
403 Ga0590075_090005
404 Ga0501082_0050296
405 2644230797
406 8054610515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02342

TerD

TerD domain

1

186

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qng-assembly1.cif.gz_A crystal structure of unknown function protein sav2460 0.8313 20 182
2qz7-assembly2.cif.gz_B the crystal structure of a homologue of telluride resistance protein (terd), sco6318 from streptomyces coelicolor a3(2) 0.8199 19 179
2kxv-assembly1.cif.gz_A nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae 0.8108 19 189
3ibz-assembly1.cif.gz_A crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) 0.7936 4 191
2kxv-assembly1.cif.gz_A nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae 0.7853 19 189
ID Description Score Start End Superfamily
3ibzA01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.8302 19 177 2.60.60.30
2qz7B01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.8151 19 179 2.60.60.30
af_P19198_159_328_2.60.60.30 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.7914 19 181 2.60.60.30
3ibzA01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.7839 19 177 2.60.60.30
2qz7B01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.7787 19 179 2.60.60.30
ID Description Score Start End GO Terms
AF-A0A2T8FB56-F1-model_v4 TerD domain-containing protein 0.9364 1 192
AF-A0A4Q2RJH2-F1-model_v4 TerD domain-containing protein 0.9323 40 192
AF-A0A4Q4ZD21-F1-model_v4 TerD family protein 0.9272 1 192
AF-A0A4Z1CCT0-F1-model_v4 TerD family protein 0.9265 1 191
AF-A0A7S2I451-F1-model_v4 TerD domain-containing protein 0.9204 46 190

Map