F310477

General Info

Members Datasets Scaffolds Average Seq Length
202 112 404 473

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_7258_c1|nmdc:mga06r32_7258_c1_6287_7840
Length 517
Sequence VTDSSTKRERWIHRALRIYTNRPQKEHDVNITTSPTVHRWRAFALLAVAYFMTIVDLTIVNVSLPTIGRDLHFSETSLQWVVTAYALTFGGFLLLGGRAADLLGRRRVLMVGLGLFTAASLACGLATGDGFLIGARAVQGVGAAIMLPAALSIVMNMFEEGAARNKALGIWGAIAASGATVGLITGGLLTRYAGWQYIFYLNVPIGAAALLLVPRIVPESRLAATRRRFDALGALAGTVGLVLLVDAVSQAPRYGWGATRTIAVLAGAVALLTAFLVIESRAKDPLLPLPIFRLRTLAGANAAGLLLGGSFFAFIFIGTLYMQQVLRYSALQTGLAWLATSITSVALAGLSQWLVTRGGAKIVMAIGMSLIGAGVIWATQVPVHGDFVGNLLGPFVVAGAGTAFAFIPISIAALAGVREHQAGLASGLLNTSQQLGGAIGIAIASSVAATHTQALLHSGHAVPDAFTGGFQDAFWVLGAIALLAIPAIFALVRSSELSHAVRKTTMRDPEPALTSAN

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
26 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
27 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
28 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
29 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
30 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
45 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
46 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
47 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
48 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
49 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
50 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
51 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
57 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
60 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
61 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
62 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
63 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
64 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
65 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
66 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
78 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
79 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
80 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
87 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
90 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
91 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
92 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
103 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
104 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
111 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
112 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.45
Rhizosphere 83.66
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_7258_c1 3300050510 Bacteria 9983
2 Ga0070680_100143035 3300005336 Bacteria 2006
3 Ga0070714_100003355 3300005435 Bacteria 11930
4 Ga0070714_100006116 3300005435 Bacteria 9251
5 Ga0070714_100148455 3300005435 Bacteria 2110
6 Ga0070710_10006135 3300005437 Bacteria 5749
7 Ga0070710_10040302 3300005437 Bacteria 2574
8 Ga0070711_100016587 3300005439 Bacteria 4678
9 Ga0070678_100112826 3300005456 Bacteria 2129
10 Ga0070681_10100733 3300005458 Bacteria 2834
11 Ga0070706_100159693 3300005467 Bacteria 2104
12 Ga0070707_100111678 3300005468 Bacteria 2651
13 Ga0070707_100196933 3300005468 Bacteria 1964
14 Ga0070707_100258656 3300005468 Bacteria 1694
15 Ga0070698_100005397 3300005471 Bacteria 13975
16 Ga0070698_100038960 3300005471 Bacteria 4896
17 Ga0070698_100138686 3300005471 Bacteria 2385
18 Ga0070698_100256709 3300005471 Bacteria 1680
19 Ga0070699_100032399 3300005518 Bacteria 4512
20 Ga0070699_100062048 3300005518 Bacteria 3239
21 Ga0068855_100018173 3300005563 Bacteria 8447
22 Ga0068856_100113470 3300005614 Bacteria 2708
23 Ga0068852_100283445 3300005616 Bacteria 1598
24 Ga0081455_10026056 3300005937 Bacteria 5387
25 Ga0081538_10032632 3300005981 Bacteria 3484
26 Ga0070717_10028953 3300006028 Bacteria 4439
27 Ga0070717_10067072 3300006028 Bacteria 2985
28 Ga0070717_10156011 3300006028 Bacteria 1978
29 Ga0070717_10166958 3300006028 Bacteria 1912
30 Ga0070715_10011848 3300006163 Bacteria 3153
31 Ga0070716_100011131 3300006173 Bacteria 4527
32 Ga0070712_100041908 3300006175 Bacteria 3146
33 Ga0097621_100163321 3300006237 Bacteria 1916
34 Ga0075434_100102716 3300006871 Bacteria 2866
35 Ga0105247_10124276 3300009101 Bacteria 1675
36 Ga0114129_10171071 3300009147 Bacteria 2962
37 Ga0114129_10251661 3300009147 Bacteria 2371
38 Ga0105241_10061910 3300009174 Bacteria 2883
39 Ga0213873_10000419 3300021358 Bacteria 6895
40 Ga0213874_10000222 3300021377 Bacteria 10604
41 Ga0213874_10000291 3300021377 Bacteria 9853
42 Ga0213876_10006654 3300021384 Bacteria 6307
43 Ga0213876_10006744 3300021384 Bacteria 6269
44 Ga0213876_10022258 3300021384 Bacteria 3352
45 Ga0213876_10028657 3300021384 Bacteria 2936
46 Ga0213876_10036762 3300021384 Bacteria 2583
47 Ga0213875_10000340 3300021388 Bacteria 44044
48 Ga0207685_10006529 3300025905 Unclassified 3183
49 Ga0207699_10012085 3300025906 Bacteria 4383
50 Ga0207699_10073924 3300025906 Bacteria 2092
51 Ga0207684_10038301 3300025910 Bacteria 4068
52 Ga0207654_10032566 3300025911 Bacteria 2882
53 Ga0207707_10153221 3300025912 Bacteria 2015
54 Ga0207693_10014587 3300025915 Bacteria 6315
55 Ga0207693_10044337 3300025915 Bacteria 3496
56 Ga0207663_10008377 3300025916 Bacteria 5401
57 Ga0207646_10029965 3300025922 Bacteria 4939
58 Ga0207646_10112840 3300025922 Bacteria 2439
59 Ga0207700_10014377 3300025928 Bacteria 5185
60 Ga0207700_10022129 3300025928 Bacteria 4354
61 Ga0207664_10000811 3300025929 Bacteria 21193
62 Ga0207664_10035518 3300025929 Bacteria 3846
63 Ga0207664_10040817 3300025929 Bacteria 3612
64 Ga0207664_10082730 3300025929 Bacteria 2615
65 Ga0207664_10144910 3300025929 Bacteria 2013
66 Ga0207665_10000943 3300025939 Bacteria 19671
67 Ga0207665_10037587 3300025939 Bacteria 3223
68 Ga0207667_10015768 3300025949 Bacteria 8568
69 Ga0207658_10035585 3300025986 Bacteria 3567
70 Ga0207683_10200519 3300026121 Bacteria 1814
71 Ga0207428_10101832 3300027907 Bacteria 2219
72 Ga0307407_10013129 3300031903 Bacteria 4008
73 Ga0373928_0006613 3300035084 Unclassified 2229
74 Ga0373945_0004076 3300035116 Bacteria 4629
75 Ga0373960_0002252 3300035121 Bacteria 4340
76 Ga0373961_0010281 3300035241 Unclassified 2303
77 Ga0373962_0007956 3300035242 Bacteria 2603
78 Ga0373933_0028124 3300035724 Bacteria 3241
79 Ga0373933_0075119 3300035724 Bacteria 2063
80 Ga0373933_0117612 3300035724 Bacteria 1662
81 Ga0373937_0064579 3300036401 Bacteria 3367
82 Ga0395899_0091465 3300037312 Bacteria 2204
83 Ga0395900_0006390 3300037418 Bacteria 12286
84 Ga0395900_0031411 3300037418 Bacteria 5456
85 Ga0395900_0052449 3300037418 Bacteria 4198
86 Ga0395900_0062807 3300037418 Bacteria 3818
87 Ga0395900_0064160 3300037418 Bacteria 3775
88 Ga0395900_0213844 3300037418 Bacteria 1946
89 Ga0395898_0004779 3300037466 Bacteria 14739
90 Ga0395898_0006830 3300037466 Bacteria 12137
91 Ga0395898_0029990 3300037466 Bacteria 5445
92 Ga0395898_0032128 3300037466 Bacteria 5238
93 Ga0395898_0151996 3300037466 Bacteria 2214
94 Ga0395905_0011316 3300037471 Bacteria 8627
95 Ga0436364_0635143 3300037853 Bacteria 45186
96 Ga0436364_1294613 3300037853 Bacteria 100298
97 Ga0395901_0002671 3300038443 Bacteria 17999
98 Ga0395901_0005920 3300038443 Bacteria 12382
99 Ga0395901_0055949 3300038443 Bacteria 4103
100 Ga0395901_0073186 3300038443 Bacteria 3573
101 Ga0395901_0112073 3300038443 Bacteria 2865
102 Ga0395901_0148618 3300038443 Bacteria 2462
103 Ga0436365_0080755 3300039437 Bacteria 8524
104 Ga0436365_0622858 3300039437 Bacteria 15110
105 Ga0436365_0916990 3300039437 Bacteria 1925
106 Ga0436365_0921495 3300039437 Bacteria 3707
107 Ga0436365_0976621 3300039437 Bacteria 10988
108 Ga0436365_0997577 3300039437 Bacteria 19986
109 Ga0436365_1234754 3300039437 Bacteria 12455
110 Ga0436363_0064177 3300039450 Bacteria 10777
111 Ga0436363_0115862 3300039450 Bacteria 2970
112 Ga0436363_0329785 3300039450 Bacteria 16276
113 Ga0436363_1182796 3300039450 Bacteria 9738
114 Ga0436362_0277092 3300039453 Bacteria 3577
115 Ga0466969_0017487 3300044656 Bacteria 3742
116 Ga0466966_0083234 3300044684 Bacteria 1991
117 Ga0466961_0002332 3300044693 Bacteria 11791
118 Ga0466961_0014601 3300044693 Bacteria 5045
119 Ga0466963_0000919 3300044694 Bacteria 15004
120 Ga0466963_0002060 3300044694 Bacteria 11091
121 Ga0466963_0025981 3300044694 Bacteria 3741
122 Ga0466963_0046942 3300044694 Bacteria 2849
123 Ga0466971_0007649 3300044719 Bacteria 4713
124 Ga0466970_0028272 3300044765 Bacteria 2945
125 Ga0466970_0028550 3300044765 Bacteria 2933
126 Ga0466957_0025946 3300044842 Bacteria 3474
127 Ga0466957_0038661 3300044842 Bacteria 2875
128 Ga0466957_0082569 3300044842 Bacteria 2003
129 Ga0466960_0010473 3300044901 Bacteria 3853
130 Ga0466959_0002330 3300045049 Bacteria 12127
131 Ga0466959_0017192 3300045049 Bacteria 5297
132 Ga0466959_0056145 3300045049 Bacteria 2874
133 Ga0466959_0122947 3300045049 Bacteria 1843
134 Ga0466958_0011174 3300045836 Bacteria 5051
135 Ga0466958_0016456 3300045836 Bacteria 4259
136 Ga0466958_0020086 3300045836 Bacteria 3894
137 Ga0466958_0021611 3300045836 Bacteria 3763
138 Ga0466958_0033735 3300045836 Bacteria 3050
139 Ga0466958_0066541 3300045836 Bacteria 2200
140 Ga0466958_0130833 3300045836 Bacteria 1576
141 Ga0466958_0166379 3300045836 Bacteria 1395
142 Ga0466967_0000929 3300045976 Bacteria 15777
143 Ga0466967_0279553 3300045976 Bacteria 1601
144 Ga0495592_0022205 3300046454 Bacteria 4827
145 Ga0495651_0004061 3300046462 Bacteria 11185
146 Ga0495653_0020972 3300046463 Bacteria 5295
147 Ga0495664_0013148 3300046477 Bacteria 4694
148 Ga0495608_0007614 3300046511 Bacteria 7635
149 Ga0495618_0057874 3300046514 Bacteria 2455
150 Ga0495628_0080577 3300046516 Bacteria 2530
151 Ga0495628_0081339 3300046516 Bacteria 2516
152 Ga0495666_0038006 3300046526 Bacteria 2342
153 Ga0495652_0073151 3300046529 Bacteria 2855
154 Ga0495652_0201379 3300046529 Bacteria 1510
155 Ga0495640_0036109 3300046533 Bacteria 3493
156 Ga0495586_0058265 3300046535 Bacteria 2097
157 Ga0495645_0056258 3300046543 Bacteria 2856
158 Ga0495645_0153932 3300046543 Bacteria 1595
159 Ga0495667_0007837 3300046559 Bacteria 7237
160 Ga0495667_0034601 3300046559 Bacteria 3377
161 Ga0495634_0063033 3300046642 Bacteria 2461
162 Ga0495634_0072279 3300046642 Bacteria 2269
163 Ga0495634_0119361 3300046642 Bacteria 1689
164 Ga0495635_0002511 3300046663 Bacteria 12536
165 Ga0495635_0037857 3300046663 Bacteria 3339
166 Ga0495657_0006153 3300046675 Bacteria 9406
167 Ga0495657_0008758 3300046675 Bacteria 7717
168 Ga0495657_0120285 3300046675 Bacteria 1654
169 Ga0495599_0016354 3300046678 Bacteria 4606
170 Ga0495599_0031914 3300046678 Bacteria 3306
171 Ga0495600_0005131 3300046809 Bacteria 7873
172 Ga0495600_0022566 3300046809 Bacteria 4042
173 Ga0495604_0116292 3300047317 Bacteria 1942
174 Ga0495674_0035186 3300047319 Bacteria 4520
175 Ga0495680_0001609 3300047322 Bacteria 24033
176 Ga0495680_0007695 3300047322 Bacteria 9835
177 Ga0495680_0061118 3300047322 Bacteria 2899
178 Ga0495684_0019891 3300047471 Bacteria 5173
179 Ga0495684_0142806 3300047471 Bacteria 1794
180 Ga0495684_0166825 3300047471 Bacteria 1640
181 Ga0495602_0009351 3300048088 Bacteria 10193
182 Ga0496104_0016080 3300048907 Bacteria 6790
183 Ga0496105_0157403 3300048908 Bacteria 1865
184 Ga0496106_0002735 3300048909 Bacteria 13070
185 Ga0496107_0018965 3300048910 Bacteria 4850
186 Ga0496107_0029951 3300048910 Bacteria 3876
187 Ga0496108_0031339 3300048911 Bacteria 4411
188 Ga0496108_0072595 3300048911 Bacteria 2905
189 Ga0496112_0166567 3300048915 Bacteria 2169
190 Ga0496113_0028978 3300048916 Bacteria 3990
191 Ga0496114_0152303 3300048917 Bacteria 2006
192 Ga0496115_0054733 3300048918 Unclassified 3204
193 Ga0496126_0016299 3300048929 Bacteria 7436
194 nmdc:mga05p37_268560_c1 3300050507 Bacteria 2039
195 nmdc:mga05p37_342842_c1 3300050507 Bacteria 1761
196 nmdc:mga08y16_63998_c1 3300050511 Bacteria 3841
197 nmdc:mga0n895_282936_c1 3300050512 Bacteria 1682
198 nmdc:mga0a205_16791_c1 3300050515 Bacteria 6855
199 nmdc:mga0a205_82321_c1 3300050515 Bacteria 3109
200 Ga0495612_0035907 3300053078 Bacteria 2010
201 Ga0495595_0016977 3300053084 Bacteria 3124
202 Ga0495619_0009367 3300053085 Bacteria 6180
203 nmdc:mga06r32_7258_c1
204 Ga0070680_100143035
205 Ga0070714_100003355
206 Ga0070714_100006116
207 Ga0070714_100148455
208 Ga0070710_10006135
209 Ga0070710_10040302
210 Ga0070711_100016587
211 Ga0070678_100112826
212 Ga0070681_10100733
213 Ga0070706_100159693
214 Ga0070707_100111678
215 Ga0070707_100196933
216 Ga0070707_100258656
217 Ga0070698_100005397
218 Ga0070698_100038960
219 Ga0070698_100138686
220 Ga0070698_100256709
221 Ga0070699_100032399
222 Ga0070699_100062048
223 Ga0068855_100018173
224 Ga0068856_100113470
225 Ga0068852_100283445
226 Ga0081455_10026056
227 Ga0081538_10032632
228 Ga0070717_10028953
229 Ga0070717_10067072
230 Ga0070717_10156011
231 Ga0070717_10166958
232 Ga0070715_10011848
233 Ga0070716_100011131
234 Ga0070712_100041908
235 Ga0097621_100163321
236 Ga0075434_100102716
237 Ga0105247_10124276
238 Ga0114129_10171071
239 Ga0114129_10251661
240 Ga0105241_10061910
241 Ga0213873_10000419
242 Ga0213874_10000222
243 Ga0213874_10000291
244 Ga0213876_10006654
245 Ga0213876_10006744
246 Ga0213876_10022258
247 Ga0213876_10028657
248 Ga0213876_10036762
249 Ga0213875_10000340
250 Ga0207685_10006529
251 Ga0207699_10012085
252 Ga0207699_10073924
253 Ga0207684_10038301
254 Ga0207654_10032566
255 Ga0207707_10153221
256 Ga0207693_10014587
257 Ga0207693_10044337
258 Ga0207663_10008377
259 Ga0207646_10029965
260 Ga0207646_10112840
261 Ga0207700_10014377
262 Ga0207700_10022129
263 Ga0207664_10000811
264 Ga0207664_10035518
265 Ga0207664_10040817
266 Ga0207664_10082730
267 Ga0207664_10144910
268 Ga0207665_10000943
269 Ga0207665_10037587
270 Ga0207667_10015768
271 Ga0207658_10035585
272 Ga0207683_10200519
273 Ga0207428_10101832
274 Ga0307407_10013129
275 Ga0373928_0006613
276 Ga0373945_0004076
277 Ga0373960_0002252
278 Ga0373961_0010281
279 Ga0373962_0007956
280 Ga0373933_0028124
281 Ga0373933_0075119
282 Ga0373933_0117612
283 Ga0373937_0064579
284 Ga0395899_0091465
285 Ga0395900_0006390
286 Ga0395900_0031411
287 Ga0395900_0052449
288 Ga0395900_0062807
289 Ga0395900_0064160
290 Ga0395900_0213844
291 Ga0395898_0004779
292 Ga0395898_0006830
293 Ga0395898_0029990
294 Ga0395898_0032128
295 Ga0395898_0151996
296 Ga0395905_0011316
297 Ga0436364_0635143
298 Ga0436364_1294613
299 Ga0395901_0002671
300 Ga0395901_0005920
301 Ga0395901_0055949
302 Ga0395901_0073186
303 Ga0395901_0112073
304 Ga0395901_0148618
305 Ga0436365_0080755
306 Ga0436365_0622858
307 Ga0436365_0916990
308 Ga0436365_0921495
309 Ga0436365_0976621
310 Ga0436365_0997577
311 Ga0436365_1234754
312 Ga0436363_0064177
313 Ga0436363_0115862
314 Ga0436363_0329785
315 Ga0436363_1182796
316 Ga0436362_0277092
317 Ga0466969_0017487
318 Ga0466966_0083234
319 Ga0466961_0002332
320 Ga0466961_0014601
321 Ga0466963_0000919
322 Ga0466963_0002060
323 Ga0466963_0025981
324 Ga0466963_0046942
325 Ga0466971_0007649
326 Ga0466970_0028272
327 Ga0466970_0028550
328 Ga0466957_0025946
329 Ga0466957_0038661
330 Ga0466957_0082569
331 Ga0466960_0010473
332 Ga0466959_0002330
333 Ga0466959_0017192
334 Ga0466959_0056145
335 Ga0466959_0122947
336 Ga0466958_0011174
337 Ga0466958_0016456
338 Ga0466958_0020086
339 Ga0466958_0021611
340 Ga0466958_0033735
341 Ga0466958_0066541
342 Ga0466958_0130833
343 Ga0466958_0166379
344 Ga0466967_0000929
345 Ga0466967_0279553
346 Ga0495592_0022205
347 Ga0495651_0004061
348 Ga0495653_0020972
349 Ga0495664_0013148
350 Ga0495608_0007614
351 Ga0495618_0057874
352 Ga0495628_0080577
353 Ga0495628_0081339
354 Ga0495666_0038006
355 Ga0495652_0073151
356 Ga0495652_0201379
357 Ga0495640_0036109
358 Ga0495586_0058265
359 Ga0495645_0056258
360 Ga0495645_0153932
361 Ga0495667_0007837
362 Ga0495667_0034601
363 Ga0495634_0063033
364 Ga0495634_0072279
365 Ga0495634_0119361
366 Ga0495635_0002511
367 Ga0495635_0037857
368 Ga0495657_0006153
369 Ga0495657_0008758
370 Ga0495657_0120285
371 Ga0495599_0016354
372 Ga0495599_0031914
373 Ga0495600_0005131
374 Ga0495600_0022566
375 Ga0495604_0116292
376 Ga0495674_0035186
377 Ga0495680_0001609
378 Ga0495680_0007695
379 Ga0495680_0061118
380 Ga0495684_0019891
381 Ga0495684_0142806
382 Ga0495684_0166825
383 Ga0495602_0009351
384 Ga0496104_0016080
385 Ga0496105_0157403
386 Ga0496106_0002735
387 Ga0496107_0018965
388 Ga0496107_0029951
389 Ga0496108_0031339
390 Ga0496108_0072595
391 Ga0496112_0166567
392 Ga0496113_0028978
393 Ga0496114_0152303
394 Ga0496115_0054733
395 Ga0496126_0016299
396 nmdc:mga05p37_268560_c1
397 nmdc:mga05p37_342842_c1
398 nmdc:mga08y16_63998_c1
399 nmdc:mga0n895_282936_c1
400 nmdc:mga0a205_16791_c1
401 nmdc:mga0a205_82321_c1
402 Ga0495612_0035907
403 Ga0495595_0016977
404 Ga0495619_0009367

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

46

441

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.9166 6 460
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8713 6 460
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8617 9 460
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8578 9 460
7d5p-assembly2.cif.gz_B structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8574 9 460
ID Description Score Start End Superfamily
af_P76269_18_258_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9684 12 252 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9624 12 199 1.20.1250.20
af_P76269_18_258_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9567 12 252 1.20.1250.20
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9514 10 243 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.945 10 182 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2K2TJ46-F1-model_v4 MFS transporter 0.9781 6 147 GO:0005886
GO:0022857
AF-A0A538CW67-F1-model_v4 MFS transporter 0.9615 1 191 GO:0016020
GO:0022857
AF-A0A0S2C953-F1-model_v4 deleted 0.958 1 147
AF-A0A537NMT5-F1-model_v4 MFS transporter 0.9578 9 159 GO:0005886
GO:0022857
AF-A0A2K2TJ46-F1-model_v4 MFS transporter 0.9515 6 147 GO:0005886
GO:0022857

Map