F310475

General Info

Members Datasets Scaffolds Average Seq Length
202 133 202 121

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_11729_c1|nmdc:mga06r32_11729_c1_5989_6405
Length 138
Sequence LKLLSWHTSWPGICTVVPFMGTKLKVLLVEDNADVRRLYAIGLNQRGFEVKLAANGAEAVDRVASERPDYILLDWMMPLMDGREVVERLGTQDSARDIEIIVISGQPAPTALPSRIRSWLTKPLTVDELVSEMNTAAK

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
101 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
106 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
107 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
110 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
123 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
124 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 6.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10045019 3300001991 Bacteria 891
2 Ga0065715_10130671 3300005293 Bacteria 2022
3 Ga0070658_10013050 3300005327 Bacteria 6667
4 Ga0070683_100000229 3300005329 Bacteria 38178
5 Ga0070683_100193722 3300005329 Bacteria 1930
6 Ga0070670_100000294 3300005331 Bacteria 43861
7 Ga0070670_100345259 3300005331 Bacteria 1307
8 Ga0068869_100114816 3300005334 Unclassified 2053
9 Ga0070680_100054056 3300005336 Bacteria 3278
10 Ga0070680_101781954 3300005336 Unclassified 534
11 Ga0070682_100338783 3300005337 Bacteria 1117
12 Ga0068868_100000460 3300005338 Bacteria 27070
13 Ga0068868_100011046 3300005338 Bacteria 6565
14 Ga0070689_100004219 3300005340 Bacteria 9694
15 Ga0070692_10064516 3300005345 Bacteria 1937
16 Ga0070692_10426809 3300005345 Bacteria 843
17 Ga0070675_100000042 3300005354 Bacteria 78277
18 Ga0070671_100054823 3300005355 Bacteria 3315
19 Ga0070673_101162632 3300005364 Unclassified 722
20 Ga0070709_11484615 3300005434 Unclassified 550
21 Ga0070713_100023315 3300005436 Bacteria 4800
22 Ga0070713_101782942 3300005436 Bacteria 597
23 Ga0070701_10000445 3300005438 Bacteria 14133
24 Ga0070705_100167829 3300005440 Bacteria 1474
25 Ga0070700_100000037 3300005441 Bacteria 109998
26 Ga0070700_101397415 3300005441 Unclassified 592
27 Ga0070708_100002651 3300005445 Bacteria 13860
28 Ga0070708_100117845 3300005445 Unclassified 2446
29 Ga0070708_100246431 3300005445 Unclassified 1678
30 Ga0070708_100387658 3300005445 Unclassified 1317
31 Ga0070678_100517405 3300005456 Unclassified 1055
32 Ga0068867_100662287 3300005459 Unclassified 917
33 Ga0070685_10002951 3300005466 Bacteria 8691
34 Ga0070706_100014605 3300005467 Bacteria 7257
35 Ga0070706_100307371 3300005467 Bacteria 1479
36 Ga0070706_100615747 3300005467 Bacteria 1009
37 Ga0070706_101264349 3300005467 Unclassified 677
38 Ga0070707_100014033 3300005468 Bacteria 7507
39 Ga0070707_100349328 3300005468 Unclassified 1436
40 Ga0070698_100078438 3300005471 Bacteria 3301
41 Ga0070698_100171937 3300005471 Unclassified 2107
42 Ga0070698_100561504 3300005471 Unclassified 1081
43 Ga0070699_100036640 3300005518 Bacteria 4243
44 Ga0070699_100261398 3300005518 Bacteria 1548
45 Ga0070699_100500740 3300005518 Unclassified 1103
46 Ga0070699_100617620 3300005518 Unclassified 989
47 Ga0070684_100003863 3300005535 Bacteria 11339
48 Ga0070697_100045758 3300005536 Unclassified 3547
49 Ga0070697_100568658 3300005536 Unclassified 995
50 Ga0070697_100709535 3300005536 Unclassified 888
51 Ga0068853_101043851 3300005539 Unclassified 787
52 Ga0070672_100006855 3300005543 Bacteria 7696
53 Ga0070672_100693467 3300005543 Bacteria 891
54 Ga0070686_100122515 3300005544 Bacteria 1787
55 Ga0070686_100230945 3300005544 Bacteria 1342
56 Ga0070686_100804354 3300005544 Unclassified 758
57 Ga0070664_100390649 3300005564 Bacteria 1271
58 Ga0068857_100021447 3300005577 Bacteria 5686
59 Ga0068854_100003175 3300005578 Bacteria 10253
60 Ga0068854_100421522 3300005578 Bacteria 1109
61 Ga0070702_100337125 3300005615 Unclassified 1057
62 Ga0070702_100522162 3300005615 Bacteria 876
63 Ga0068864_100000037 3300005618 Bacteria 188796
64 Ga0068864_100396297 3300005618 Bacteria 1311
65 Ga0068861_100034275 3300005719 Bacteria 3754
66 Ga0068870_10272928 3300005840 Bacteria 1057
67 Ga0068858_100000110 3300005842 Bacteria 86502
68 Ga0070717_10000109 3300006028 Bacteria 65427
69 Ga0070717_10654312 3300006028 Unclassified 954
70 Ga0070716_100269164 3300006173 Bacteria 1170
71 Ga0070716_100504309 3300006173 Bacteria 893
72 Ga0097621_100925992 3300006237 Bacteria 813
73 Ga0097621_101214970 3300006237 Bacteria 710
74 Ga0068871_100146786 3300006358 Bacteria 2009
75 Ga0068871_100212171 3300006358 Unclassified 1675
76 Ga0068871_100813312 3300006358 Unclassified 862
77 Ga0075428_100083922 3300006844 Bacteria 3476
78 Ga0075428_101023029 3300006844 Unclassified 874
79 Ga0075431_100003577 3300006847 Bacteria 15054
80 Ga0075434_100079399 3300006871 Bacteria 3278
81 Ga0075434_100090529 3300006871 Bacteria 3061
82 Ga0075436_100024492 3300006914 Bacteria 4149
83 Ga0075435_100001101 3300007076 Bacteria 17191
84 Ga0105244_10023997 3300009036 Bacteria 3334
85 Ga0111539_10000006 3300009094 Bacteria 463720
86 Ga0105245_10000003 3300009098 Bacteria 488207
87 Ga0105245_10911008 3300009098 Bacteria 921
88 Ga0114129_10220437 3300009147 Bacteria 2559
89 Ga0114129_10423097 3300009147 Bacteria 1751
90 Ga0114129_11635255 3300009147 Unclassified 788
91 Ga0114129_12035171 3300009147 Unclassified 694
92 Ga0114129_12863252 3300009147 Unclassified 572
93 Ga0105241_11281490 3300009174 Unclassified 697
94 Ga0105242_10724439 3300009176 Bacteria 976
95 Ga0105238_10000005 3300009551 Bacteria 372840
96 Ga0105239_10056219 3300010375 Bacteria 4316
97 Ga0105246_10183864 3300011119 Bacteria 1612
98 Ga0157369_10000036 3300013105 Bacteria 190875
99 Ga0157374_10000006 3300013296 Bacteria 640284
100 Ga0157374_10284000 3300013296 Bacteria 1634
101 Ga0157378_10001150 3300013297 Bacteria 24054
102 Ga0157378_10001280 3300013297 Bacteria 22615
103 Ga0157378_10021924 3300013297 Bacteria 5617
104 Ga0157375_10000009 3300013308 Bacteria 366440
105 Ga0157375_10000427 3300013308 Bacteria 38132
106 Ga0163163_10077394 3300014325 Bacteria 3322
107 Ga0157380_10175996 3300014326 Bacteria 1875
108 Ga0157377_10000003 3300014745 Bacteria 435133
109 Ga0157377_10000125 3300014745 Bacteria 49824
110 Ga0157377_10058303 3300014745 Bacteria 2198
111 Ga0157376_10000009 3300014969 Bacteria 340244
112 Ga0213873_10000003 3300021358 Bacteria 973849
113 Ga0213873_10000785 3300021358 Bacteria 5126
114 Ga0213876_10000003 3300021384 Bacteria 973849
115 Ga0213876_10000066 3300021384 Bacteria 126862
116 Ga0213876_10004848 3300021384 Bacteria 7457
117 Ga0213876_10011682 3300021384 Bacteria 4689
118 Ga0213876_10562699 3300021384 Bacteria 606
119 Ga0207682_10483294 3300025893 Unclassified 587
120 Ga0207699_10774446 3300025906 Unclassified 705
121 Ga0207643_10190082 3300025908 Bacteria 1246
122 Ga0207705_10010618 3300025909 Bacteria 6692
123 Ga0207684_10037900 3300025910 Unclassified 4090
124 Ga0207684_10428621 3300025910 Unclassified 1136
125 Ga0207660_10040061 3300025917 Bacteria 3278
126 Ga0207646_10056276 3300025922 Unclassified 3516
127 Ga0207646_10235253 3300025922 Bacteria 1655
128 Ga0207694_10000001 3300025924 Bacteria 4078485
129 Ga0207650_10000091 3300025925 Bacteria 117116
130 Ga0207650_10067718 3300025925 Unclassified 2679
131 Ga0207659_10000045 3300025926 Bacteria 88264
132 Ga0207687_10000002 3300025927 Bacteria 975489
133 Ga0207700_10026286 3300025928 Bacteria 4057
134 Ga0207700_11533602 3300025928 Bacteria 591
135 Ga0207644_10064160 3300025931 Bacteria 2669
136 Ga0207686_10002323 3300025934 Bacteria 10409
137 Ga0207670_10000551 3300025936 Bacteria 20729
138 Ga0207665_10160793 3300025939 Bacteria 1615
139 Ga0207665_10532477 3300025939 Unclassified 911
140 Ga0207691_10004173 3300025940 Bacteria 14035
141 Ga0207689_10267454 3300025942 Unclassified 1415
142 Ga0207661_10000006 3300025944 Bacteria 537727
143 Ga0207679_11047520 3300025945 Unclassified 748
144 Ga0207651_10029558 3300025960 Bacteria 3474
145 Ga0207640_10002310 3300025981 Bacteria 10246
146 Ga0207640_10039723 3300025981 Unclassified 2981
147 Ga0207677_10000015 3300026023 Bacteria 173792
148 Ga0207677_10000098 3300026023 Bacteria 71301
149 Ga0207703_10000008 3300026035 Bacteria 373718
150 Ga0207639_10935105 3300026041 Bacteria 811
151 Ga0207708_10000732 3300026075 Bacteria 24645
152 Ga0207648_10054558 3300026089 Bacteria 3490
153 Ga0207676_11390627 3300026095 Bacteria 698
154 Ga0207674_10014979 3300026116 Bacteria 8541
155 Ga0207675_100082991 3300026118 Bacteria 3005
156 Ga0207683_10092818 3300026121 Bacteria 2690
157 Ga0207428_10000007 3300027907 Bacteria 463715
158 Ga0307511_10011569 3300030521 Bacteria 8692
159 Ga0307406_11244159 3300031901 Bacteria 648
160 Ga0307407_10815075 3300031903 Unclassified 711
161 Ga0307416_100572872 3300032002 Bacteria 1205
162 Ga0307416_101414919 3300032002 Bacteria 801
163 Ga0373932_0000030 3300035112 Bacteria 38926
164 Ga0373943_0022856 3300035170 Unclassified 2903
165 Ga0373946_0129099 3300035171 Bacteria 1161
166 Ga0436365_0015033 3300039437 Bacteria 2770
167 Ga0436365_0285258 3300039437 Bacteria 125381
168 Ga0436365_0420414 3300039437 Bacteria 7640
169 Ga0436365_0537254 3300039437 Bacteria 270734
170 Ga0436365_0961583 3300039437 Bacteria 3631
171 Ga0436365_1637018 3300039437 Unclassified 1889
172 Ga0436362_0136400 3300039453 Unclassified 676
173 Ga0436362_0290872 3300039453 Bacteria 21554
174 Ga0436362_1234996 3300039453 Bacteria 292548
175 Ga0451839_0284041 3300041496 Bacteria 1144
176 Ga0451577_0044150 3300042876 Unclassified 3991
177 Ga0451577_0156440 3300042876 Bacteria 2052
178 Ga0453683_0092923 3300044673 Bacteria 1891
179 Ga0466963_0872456 3300044694 Unclassified 634
180 Ga0453684_2112462 3300044712 Unclassified 564
181 Ga0466971_0505706 3300044719 Unclassified 597
182 Ga0451576_2122159 3300045051 Bacteria 578
183 Ga0466958_0309319 3300045836 Unclassified 1015
184 Ga0495620_0001995 3300046515 Bacteria 11928
185 Ga0495598_0185517 3300046537 Bacteria 744
186 Ga0495621_0143866 3300046539 Bacteria 934
187 Ga0495588_0231247 3300046674 Bacteria 976
188 Ga0495679_013784 3300047446 Bacteria 3019
189 Ga0501073_0006180 3300049589 Bacteria 8939
190 Ga0501074_1237857 3300049590 Bacteria 523
191 Ga0501080_0035524 3300049742 Bacteria 4651
192 nmdc:mga05p37_1405613_c1 3300050507 Bacteria 702
193 nmdc:mga05p37_2253425_c1 3300050507 Unclassified 503
194 nmdc:mga05p37_232885_c1 3300050507 Bacteria 2218
195 nmdc:mga05p37_246394_c1 3300050507 Bacteria 2145
196 nmdc:mga06r32_11729_c1 3300050510 Bacteria 7889
197 nmdc:mga08y16_11_c1 3300050511 Bacteria 463712
198 nmdc:mga0n895_253644_c1 3300050512 Bacteria 1785
199 nmdc:mga0rr50_759_c1 3300050513 Bacteria 17337
200 nmdc:mga08x19_400_c2 3300050514 Bacteria 5098
201 nmdc:mga0a205_411477_c1 3300050515 Bacteria 1215
202 Ga0495655_0000186 3300053083 Bacteria 11677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021384 Ga0213876_10562699 Ga0213876_105626991 109
2 3300006914 Ga0075436_100024492 Ga0075436_1000244926 110
3 3300007076 Ga0075435_100001101 Ga0075435_10000110115 110
4 3300039437 Ga0436365_1637018 Ga0436365_1637018_297_629 110
5 3300050513 nmdc:mga0rr50_759_c1 nmdc:mga0rr50_759_c1_13864_14202 110
6 3300050514 nmdc:mga08x19_400_c2 nmdc:mga08x19_400_c2_3009_3347 110
7 3300005615 Ga0070702_100337125 Ga0070702_1003371251 111
8 3300039437 Ga0436365_0961583 Ga0436365_0961583_286_636 111
9 3300010375 Ga0105239_10056219 Ga0105239_100562193 112
10 3300005337 Ga0070682_100338783 Ga0070682_1003387833 114
11 3300005338 Ga0068868_100000460 Ga0068868_10000046023 114
12 3300005466 Ga0070685_10002951 Ga0070685_100029519 114
13 3300005618 Ga0068864_100396297 Ga0068864_1003962971 114
14 3300006173 Ga0070716_100269164 Ga0070716_1002691642 114
15 3300014969 Ga0157376_10000009 Ga0157376_1000000935 114
16 3300025939 Ga0207665_10160793 Ga0207665_101607933 114
17 3300026023 Ga0207677_10000098 Ga0207677_1000009826 114
18 3300026095 Ga0207676_11390627 Ga0207676_113906272 114
19 3300039453 Ga0436362_0136400 Ga0436362_0136400_191_571 114
20 3300005327 Ga0070658_10013050 Ga0070658_100130503 115
21 3300005334 Ga0068869_100114816 Ga0068869_1001148163 115
22 3300005336 Ga0070680_101781954 Ga0070680_1017819541 115
23 3300005338 Ga0068868_100011046 Ga0068868_1000110464 115
24 3300005345 Ga0070692_10426809 Ga0070692_104268091 115
25 3300005539 Ga0068853_101043851 Ga0068853_1010438512 115
26 3300005544 Ga0070686_100122515 Ga0070686_1001225152 115
27 3300006358 Ga0068871_100212171 Ga0068871_1002121713 115
28 3300011119 Ga0105246_10183864 Ga0105246_101838643 115
29 3300013296 Ga0157374_10284000 Ga0157374_102840002 115
30 3300013297 Ga0157378_10001150 Ga0157378_1000115011 115
31 3300013297 Ga0157378_10001280 Ga0157378_1000128013 115
32 3300013297 Ga0157378_10021924 Ga0157378_100219246 115
33 3300013308 Ga0157375_10000009 Ga0157375_10000009300 115
34 3300025909 Ga0207705_10010618 Ga0207705_100106187 115
35 3300025942 Ga0207689_10267454 Ga0207689_102674542 115
36 3300026023 Ga0207677_10000015 Ga0207677_10000015100 115
37 3300026041 Ga0207639_10935105 Ga0207639_109351052 115
38 3300041496 Ga0451839_0284041 Ga0451839_0284041_381_728 115
39 3300047446 Ga0495679_013784 Ga0495679_013784_1222_1569 115
40 3300005434 Ga0070709_11484615 Ga0070709_114846151 116
41 3300005436 Ga0070713_101782942 Ga0070713_1017829421 116
42 3300005543 Ga0070672_100006855 Ga0070672_1000068553 116
43 3300005618 Ga0068864_100000037 Ga0068864_100000037108 116
44 3300006847 Ga0075431_100003577 Ga0075431_1000035773 116
45 3300009174 Ga0105241_11281490 Ga0105241_112814901 116
46 3300009176 Ga0105242_10724439 Ga0105242_107244392 116
47 3300014326 Ga0157380_10175996 Ga0157380_101759962 116
48 3300014745 Ga0157377_10058303 Ga0157377_100583033 116
49 3300021358 Ga0213873_10000785 Ga0213873_100007855 116
50 3300021384 Ga0213876_10000066 Ga0213876_1000006674 116
51 3300025906 Ga0207699_10774446 Ga0207699_107744462 116
52 3300025928 Ga0207700_11533602 Ga0207700_115336021 116
53 3300025940 Ga0207691_10004173 Ga0207691_1000417310 116
54 3300039437 Ga0436365_0285258 Ga0436365_0285258_76668_77018 116
55 3300039453 Ga0436362_0290872 Ga0436362_0290872_19378_19728 116
56 3300050510 nmdc:mga06r32_11729_c1 nmdc:mga06r32_11729_c1_5989_6405 116
57 3300005329 Ga0070683_100193722 Ga0070683_1001937223 117
58 3300005340 Ga0070689_100004219 Ga0070689_10000421910 117
59 3300005467 Ga0070706_100307371 Ga0070706_1003073713 117
60 3300005544 Ga0070686_100804354 Ga0070686_1008043542 117
61 3300005842 Ga0068858_100000110 Ga0068858_10000011012 117
62 3300006173 Ga0070716_100504309 Ga0070716_1005043092 117
63 3300025936 Ga0207670_10000551 Ga0207670_1000055120 117
64 3300025960 Ga0207651_10029558 Ga0207651_100295581 117
65 3300026035 Ga0207703_10000008 Ga0207703_1000000881 117
66 3300039437 Ga0436365_0015033 Ga0436365_0015033_201_590 117
67 3300053083 Ga0495655_0000186 Ga0495655_0000186_5893_6252 117
68 3300005331 Ga0070670_100345259 Ga0070670_1003452593 118
69 3300005436 Ga0070713_100023315 Ga0070713_1000233153 118
70 3300005459 Ga0068867_100662287 Ga0068867_1006622872 118
71 3300005577 Ga0068857_100021447 Ga0068857_1000214476 118
72 3300005578 Ga0068854_100003175 Ga0068854_10000317511 118
73 3300005840 Ga0068870_10272928 Ga0068870_102729282 118
74 3300006237 Ga0097621_100925992 Ga0097621_1009259922 118
75 3300006237 Ga0097621_101214970 Ga0097621_1012149701 118
76 3300009098 Ga0105245_10911008 Ga0105245_109110082 118
77 3300009147 Ga0114129_12863252 Ga0114129_128632521 118
78 3300009551 Ga0105238_10000005 Ga0105238_10000005237 118
79 3300013296 Ga0157374_10000006 Ga0157374_10000006476 118
80 3300013308 Ga0157375_10000427 Ga0157375_100004276 118
81 3300014325 Ga0163163_10077394 Ga0163163_100773944 118
82 3300014745 Ga0157377_10000003 Ga0157377_10000003100 118
83 3300025908 Ga0207643_10190082 Ga0207643_101900822 118
84 3300025924 Ga0207694_10000001 Ga0207694_100000012919 118
85 3300025925 Ga0207650_10067718 Ga0207650_100677183 118
86 3300025939 Ga0207665_10532477 Ga0207665_105324772 118
87 3300025981 Ga0207640_10039723 Ga0207640_100397235 118
88 3300026089 Ga0207648_10054558 Ga0207648_100545581 118
89 3300026116 Ga0207674_10014979 Ga0207674_100149795 118
90 3300046674 Ga0495588_0231247 Ga0495588_0231247_41_397 118
91 3300050507 nmdc:mga05p37_2253425_c1 nmdc:mga05p37_2253425_c1_122_487 118
92 3300050515 nmdc:mga0a205_411477_c1 nmdc:mga0a205_411477_c1_491_856 118
93 3300005336 Ga0070680_100054056 Ga0070680_1000540563 119
94 3300005354 Ga0070675_100000042 Ga0070675_1000000422 119
95 3300005355 Ga0070671_100054823 Ga0070671_1000548233 119
96 3300005364 Ga0070673_101162632 Ga0070673_1011626322 119
97 3300005438 Ga0070701_10000445 Ga0070701_1000044512 119
98 3300005441 Ga0070700_100000037 Ga0070700_10000003788 119
99 3300005456 Ga0070678_100517405 Ga0070678_1005174052 119
100 3300005471 Ga0070698_100561504 Ga0070698_1005615042 119
101 3300005518 Ga0070699_100261398 Ga0070699_1002613982 119
102 3300005615 Ga0070702_100522162 Ga0070702_1005221622 119
103 3300005719 Ga0068861_100034275 Ga0068861_1000342754 119
104 3300006028 Ga0070717_10000109 Ga0070717_1000010956 119
105 3300006358 Ga0068871_100813312 Ga0068871_1008133122 119
106 3300006844 Ga0075428_101023029 Ga0075428_1010230292 119
107 3300006871 Ga0075434_100079399 Ga0075434_1000793994 119
108 3300006871 Ga0075434_100090529 Ga0075434_1000905293 119
109 3300009036 Ga0105244_10023997 Ga0105244_100239973 119
110 3300009147 Ga0114129_10423097 Ga0114129_104230972 119
111 3300009147 Ga0114129_12035171 Ga0114129_120351712 119
112 3300021384 Ga0213876_10004848 Ga0213876_100048484 119
113 3300021384 Ga0213876_10011682 Ga0213876_100116825 119
114 3300025917 Ga0207660_10040061 Ga0207660_100400612 119
115 3300025926 Ga0207659_10000045 Ga0207659_100000452 119
116 3300025928 Ga0207700_10026286 Ga0207700_100262864 119
117 3300025931 Ga0207644_10064160 Ga0207644_100641603 119
118 3300026075 Ga0207708_10000732 Ga0207708_1000073220 119
119 3300026118 Ga0207675_100082991 Ga0207675_1000829913 119
120 3300026121 Ga0207683_10092818 Ga0207683_100928182 119
121 3300031903 Ga0307407_10815075 Ga0307407_108150751 119
122 3300032002 Ga0307416_100572872 Ga0307416_1005728722 119
123 3300032002 Ga0307416_101414919 Ga0307416_1014149192 119
124 3300035170 Ga0373943_0022856 Ga0373943_0022856_1535_1918 119
125 3300039437 Ga0436365_0420414 Ga0436365_0420414_2975_3352 119
126 3300042876 Ga0451577_0044150 Ga0451577_0044150_226_636 119
127 3300044694 Ga0466963_0872456 Ga0466963_0872456_175_534 119
128 3300044712 Ga0453684_2112462 Ga0453684_2112462_29_439 119
129 3300044719 Ga0466971_0505706 Ga0466971_0505706_82_441 119
130 3300045836 Ga0466958_0309319 Ga0466958_0309319_585_944 119
131 3300046515 Ga0495620_0001995 Ga0495620_0001995_73_444 119
132 3300046539 Ga0495621_0143866 Ga0495621_0143866_434_802 119
133 3300050507 nmdc:mga05p37_246394_c1 nmdc:mga05p37_246394_c1_411_773 119
134 3300050512 nmdc:mga0n895_253644_c1 nmdc:mga0n895_253644_c1_579_941 119
135 3300001991 JGI24743J22301_10045019 JGI24743J22301_100450192 120
136 3300005293 Ga0065715_10130671 Ga0065715_101306712 120
137 3300005329 Ga0070683_100000229 Ga0070683_1000002297 120
138 3300005331 Ga0070670_100000294 Ga0070670_10000029442 120
139 3300005345 Ga0070692_10064516 Ga0070692_100645164 120
140 3300005440 Ga0070705_100167829 Ga0070705_1001678291 120
141 3300005441 Ga0070700_101397415 Ga0070700_1013974151 120
142 3300005445 Ga0070708_100002651 Ga0070708_1000026514 120
143 3300005445 Ga0070708_100117845 Ga0070708_1001178452 120
144 3300005445 Ga0070708_100246431 Ga0070708_1002464312 120
145 3300005445 Ga0070708_100387658 Ga0070708_1003876583 120
146 3300005467 Ga0070706_100014605 Ga0070706_1000146056 120
147 3300005467 Ga0070706_100615747 Ga0070706_1006157471 120
148 3300005467 Ga0070706_101264349 Ga0070706_1012643492 120
149 3300005468 Ga0070707_100014033 Ga0070707_1000140337 120
150 3300005468 Ga0070707_100349328 Ga0070707_1003493283 120
151 3300005471 Ga0070698_100078438 Ga0070698_1000784383 120
152 3300005471 Ga0070698_100171937 Ga0070698_1001719373 120
153 3300005518 Ga0070699_100036640 Ga0070699_1000366406 120
154 3300005518 Ga0070699_100500740 Ga0070699_1005007402 120
155 3300005518 Ga0070699_100617620 Ga0070699_1006176202 120
156 3300005535 Ga0070684_100003863 Ga0070684_10000386313 120
157 3300005536 Ga0070697_100045758 Ga0070697_1000457584 120
158 3300005536 Ga0070697_100568658 Ga0070697_1005686582 120
159 3300005536 Ga0070697_100709535 Ga0070697_1007095352 120
160 3300005543 Ga0070672_100693467 Ga0070672_1006934672 120
161 3300005544 Ga0070686_100230945 Ga0070686_1002309452 120
162 3300005564 Ga0070664_100390649 Ga0070664_1003906492 120
163 3300005578 Ga0068854_100421522 Ga0068854_1004215222 120
164 3300006028 Ga0070717_10654312 Ga0070717_106543122 120
165 3300006358 Ga0068871_100146786 Ga0068871_1001467864 120
166 3300006844 Ga0075428_100083922 Ga0075428_1000839223 120
167 3300009094 Ga0111539_10000006 Ga0111539_10000006252 120
168 3300009098 Ga0105245_10000003 Ga0105245_100000032 120
169 3300009147 Ga0114129_10220437 Ga0114129_102204372 120
170 3300009147 Ga0114129_11635255 Ga0114129_116352551 120
171 3300013105 Ga0157369_10000036 Ga0157369_1000003678 120
172 3300014745 Ga0157377_10000125 Ga0157377_1000012513 120
173 3300021358 Ga0213873_10000003 Ga0213873_10000003478 120
174 3300021384 Ga0213876_10000003 Ga0213876_10000003390 120
175 3300025893 Ga0207682_10483294 Ga0207682_104832941 120
176 3300025910 Ga0207684_10037900 Ga0207684_100379002 120
177 3300025910 Ga0207684_10428621 Ga0207684_104286212 120
178 3300025922 Ga0207646_10056276 Ga0207646_100562764 120
179 3300025922 Ga0207646_10235253 Ga0207646_102352534 120
180 3300025925 Ga0207650_10000091 Ga0207650_1000009143 120
181 3300025927 Ga0207687_10000002 Ga0207687_100000022 120
182 3300025934 Ga0207686_10002323 Ga0207686_100023237 120
183 3300025944 Ga0207661_10000006 Ga0207661_10000006108 120
184 3300025945 Ga0207679_11047520 Ga0207679_110475202 120
185 3300025981 Ga0207640_10002310 Ga0207640_100023107 120
186 3300027907 Ga0207428_10000007 Ga0207428_10000007251 120
187 3300030521 Ga0307511_10011569 Ga0307511_1001156910 120
188 3300031901 Ga0307406_11244159 Ga0307406_112441591 120
189 3300035112 Ga0373932_0000030 Ga0373932_0000030_15971_16345 120
190 3300035171 Ga0373946_0129099 Ga0373946_0129099_738_1109 120
191 3300039437 Ga0436365_0537254 Ga0436365_0537254_6431_6805 120
192 3300039453 Ga0436362_1234996 Ga0436362_1234996_126359_126733 120
193 3300042876 Ga0451577_0156440 Ga0451577_0156440_1335_1712 120
194 3300044673 Ga0453683_0092923 Ga0453683_0092923_1300_1692 120
195 3300045051 Ga0451576_2122159 Ga0451576_2122159_178_555 120
196 3300046537 Ga0495598_0185517 Ga0495598_0185517_243_614 120
197 3300049589 Ga0501073_0006180 Ga0501073_0006180_3253_3654 120
198 3300049590 Ga0501074_1237857 Ga0501074_1237857_57_428 120
199 3300049742 Ga0501080_0035524 Ga0501080_0035524_3614_4015 120
200 3300050507 nmdc:mga05p37_1405613_c1 nmdc:mga05p37_1405613_c1_93_461 120
201 3300050507 nmdc:mga05p37_232885_c1 nmdc:mga05p37_232885_c1_1558_1926 120
202 3300050511 nmdc:mga08y16_11_c1 nmdc:mga08y16_11_c1_156103_156474 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

26

134

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2iyn-assembly3.cif.gz_C the co-factor-induced pre-active conformation in phob 0.9173 6 113
7lz9-assembly1.cif.gz_A inactive form of vanr from s. coelicolor 0.907 5 114
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9057 5 113
5ed4-assembly2.cif.gz_F structure of a phop-dna complex 0.9039 5 114
1m5u-assembly1.cif.gz_A crystal structure of the response regulator divk. structure at ph 8.0 in the apo-form 0.9036 5 115
ID Description Score Start End Superfamily
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9676 2 82 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9611 6 84 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9502 5 84 3.40.50.2300
af_P71814_19_100_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9452 6 84 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9409 3 84 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1F9UMS4-F1-model_v4 Response regulatory domain-containing protein 0.9408 5 115 GO:0000160
AF-A0A254Q496-F1-model_v4 Response regulator 0.9401 4 113 GO:0000160
AF-A0A0P8CJ05-F1-model_v4 Response regulator receiver domain-containing protein 0.9396 5 114 GO:0000160
AF-A0A2I8AGU4-F1-model_v4 Response regulator 0.9396 2 113 GO:0000160
AF-A0A1B9F3N2-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9385 1 113 GO:0000155
GO:0005524

Feature Viewer

pLDDT pTM Quality
91.94 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map