F310329

General Info

Members Datasets Scaffolds Average Seq Length
202 157 404 263

Family's Representative Sequence

Representative Sequence 3300046794|Ga0495589_0116075|Ga0495589_0116075_194_1123
Length 309
Sequence MATPVGIPHIPLSSPVPPVDEWATAHYGGHMPTIPPERSRSAGNEPHQHRQTAESFGADAERYERTRPRYPDAMVDRIVAAAPGPDVLDVGCGTGIAARQFQAAGRLVLGVEPDARMADLARRLGVEADVATFEAWDPAGREFDAVVAGTAWHWIDPVAGAAKAARVLRPGGLLAPFWNVFQLPPEAAEAFAAVYRRVMPDAPFDFRAMAKKPALEVYQALFTKAADGIREVGGFTDPVQWRFDWERTYARDEWLDQLPTQGFFTQLPPDRLAEVLEGVGAAVDAMGGGFTARYATVAVTAARTGAASL

Samples

Sample ID Description Type Environment
1 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
22 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
23 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
24 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
25 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
40 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
41 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
42 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
43 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
44 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
45 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
46 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
47 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
48 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
49 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
50 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
51 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
52 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
53 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
54 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
55 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
56 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
57 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
58 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
59 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
62 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
63 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
64 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
65 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
71 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
105 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
108 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
109 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
110 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
111 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
112 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
113 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
119 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
120 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
133 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
134 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
137 2671180195 Frankia sp. CcI49 Isolate Nodule
138 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
139 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
140 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
141 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
142 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
143 2773857922 Frankia sp. CcI49 Isolate Nodule
144 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
145 2808606448 Streptomyces sp. 193411 Isolate Unclassified
146 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
147 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
148 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
149 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
150 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
151 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
152 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
153 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
154 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
155 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
156 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
157 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.12
Metatranscriptomes 0.99
Isolates 10.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.99
Nodule 1.98
Rhizoplane 3.96
Rhizosphere 76.24
Stem 0
Stem Tuber 0
Unclassified 0.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495589_0116075 3300046794 Bacteria 1290
2 rootH1_10024369 3300003316 Bacteria 3704
3 rootL2_10137827 3300003322 Bacteria 3999
4 rootL2_10292714 3300003322 Bacteria 1577
5 Ga0068868_100289586 3300005338 Bacteria 1388
6 Ga0070668_100007854 3300005347 Bacteria 7923
7 Ga0070709_10004757 3300005434 Bacteria 7331
8 Ga0070714_100025584 3300005435 Bacteria 4872
9 Ga0070713_100302030 3300005436 Bacteria 1474
10 Ga0070711_100005781 3300005439 Bacteria 7425
11 Ga0070678_100391329 3300005456 Bacteria 1205
12 Ga0070681_10146131 3300005458 Bacteria 2293
13 Ga0070679_100004285 3300005530 Bacteria 13163
14 Ga0070684_100191626 3300005535 Bacteria 1860
15 Ga0070665_100779730 3300005548 Bacteria 969
16 Ga0081540_1082918 3300005983 Bacteria 1436
17 Ga0081539_10003688 3300005985 Bacteria 18331
18 Ga0081539_10020244 3300005985 Bacteria 4506
19 Ga0070717_10008722 3300006028 Bacteria 7584
20 Ga0070717_10044693 3300006028 Bacteria 3619
21 Ga0070715_10001167 3300006163 Bacteria 7526
22 Ga0070716_100003348 3300006173 Bacteria 7533
23 Ga0070712_100143112 3300006175 Bacteria 1827
24 Ga0206353_10927703 3300020082 Bacteria 5010
25 Ga0213876_10018712 3300021384 Bacteria 3658
26 Ga0224572_1007346 3300024225 Bacteria 2017
27 Ga0207426_1002187 3300025302 Bacteria 13196
28 Ga0207699_10000677 3300025906 Bacteria 16378
29 Ga0207705_10450306 3300025909 Bacteria 998
30 Ga0207707_10259469 3300025912 Bacteria 1508
31 Ga0207693_10011131 3300025915 Bacteria 7287
32 Ga0207663_10003497 3300025916 Bacteria 7693
33 Ga0207649_10074093 3300025920 Bacteria 2184
34 Ga0207652_10106457 3300025921 Bacteria 2482
35 Ga0207700_10001069 3300025928 Bacteria 15781
36 Ga0207664_10004555 3300025929 Bacteria 9395
37 Ga0207664_10038489 3300025929 Bacteria 3709
38 Ga0207664_10048143 3300025929 Bacteria 3352
39 Ga0207665_10006838 3300025939 Bacteria 7550
40 Ga0207668_10037562 3300025972 Bacteria 3242
41 Ga0207702_10008507 3300026078 Bacteria 8652
42 Ga0207674_10318307 3300026116 Bacteria 1505
43 Ga0207683_10401553 3300026121 Bacteria 1261
44 Ga0307511_10002474 3300030521 Bacteria 19309
45 Ga0307512_10006564 3300030522 Bacteria 11755
46 Ga0307509_10020649 3300031507 Bacteria 7470
47 Ga0307509_10056813 3300031507 Bacteria 4152
48 Ga0307509_10161520 3300031507 Bacteria 2137
49 Ga0307508_10029572 3300031616 Bacteria 4952
50 Ga0307508_10190592 3300031616 Bacteria 1652
51 Ga0307516_10005604 3300031730 Bacteria 14949
52 Ga0307405_10104184 3300031731 Bacteria 1909
53 Ga0307413_10220167 3300031824 Bacteria 1386
54 Ga0307518_10268657 3300031838 Bacteria 1067
55 Ga0326468_10002483 3300031889 Bacteria 1540
56 Ga0307407_10216406 3300031903 Bacteria 1293
57 Ga0307409_100208022 3300031995 Bacteria 1756
58 Ga0307415_100220788 3300032126 Bacteria 1519
59 Ga0307510_10022050 3300033180 Bacteria 7403
60 Ga0373951_0000379 3300035091 Bacteria 13390
61 Ga0373923_0144609 3300035111 Bacteria 1076
62 Ga0373953_0014312 3300035117 Bacteria 2850
63 Ga0373957_0030132 3300035120 Bacteria 1986
64 Ga0373960_0005646 3300035121 Bacteria 2907
65 Ga0373955_0202377 3300035172 Bacteria 1182
66 Ga0373962_0021799 3300035242 Bacteria 1693
67 Ga0373924_0040122 3300035410 Bacteria 1915
68 Ga0373935_0237461 3300035692 Bacteria 1271
69 Ga0373927_0397711 3300035695 Bacteria 909
70 Ga0373933_0071965 3300035724 Bacteria 2105
71 Ga0373947_0178502 3300035725 Bacteria 1381
72 Ga0373937_0001630 3300036401 Bacteria 18851
73 Ga0372808_023188 3300036459 Bacteria 892
74 Ga0373925_0154597 3300037068 Bacteria 1803
75 Ga0436364_0235851 3300037853 Bacteria 2277
76 Ga0436364_0435622 3300037853 Bacteria 21231
77 Ga0436364_0545177 3300037853 Bacteria 1634
78 Ga0436364_0611314 3300037853 Bacteria 2645
79 Ga0436364_0974741 3300037853 Bacteria 3828
80 Ga0436364_1407168 3300037853 Bacteria 4415
81 Ga0436365_1868059 3300039437 Bacteria 1904
82 Ga0436363_1692437 3300039450 Bacteria 1175
83 Ga0451791_0848592 3300041451 Unclassified 2754
84 Ga0439449_0129681 3300042007 Bacteria 937
85 Ga0466961_0002927 3300044693 Bacteria 10598
86 Ga0466961_0158150 3300044693 Unclassified 1413
87 Ga0466963_0047150 3300044694 Bacteria 2844
88 Ga0466963_0077526 3300044694 Bacteria 2246
89 Ga0466963_0156494 3300044694 Bacteria 1585
90 Ga0466959_0018312 3300045049 Bacteria 5142
91 Ga0466967_0001426 3300045976 Bacteria 13851
92 Ga0466967_0039874 3300045976 Bacteria 4041
93 Ga0466967_0263817 3300045976 Bacteria 1648
94 Ga0466967_0733701 3300045976 Archaea 979
95 Ga0466967_0748338 3300045976 Bacteria 969
96 Ga0495592_0036691 3300046454 Bacteria 3690
97 Ga0495603_0422943 3300046455 Bacteria 763
98 Ga0495629_0221352 3300046459 Bacteria 1305
99 Ga0495641_0018167 3300046461 Bacteria 3637
100 Ga0495651_0167916 3300046462 Bacteria 1565
101 Ga0495651_0180075 3300046462 Bacteria 1496
102 Ga0495653_0083196 3300046463 Bacteria 2360
103 Ga0495582_0056708 3300046473 Bacteria 2159
104 Ga0495662_0009935 3300046476 Bacteria 4675
105 Ga0495664_0000271 3300046477 Bacteria 24696
106 Ga0495664_0059547 3300046477 Bacteria 2273
107 Ga0495585_0054404 3300046492 Bacteria 2213
108 Ga0495608_0012247 3300046511 Bacteria 5957
109 Ga0495608_0034850 3300046511 Bacteria 3397
110 Ga0495628_0033988 3300046516 Bacteria 4104
111 Ga0495652_0111329 3300046529 Bacteria 2201
112 Ga0495665_0056553 3300046531 Bacteria 2071
113 Ga0495640_0008867 3300046533 Bacteria 7859
114 Ga0495640_0037966 3300046533 Bacteria 3392
115 Ga0495586_0100520 3300046535 Bacteria 1604
116 Ga0495587_0029368 3300046536 Bacteria 3337
117 Ga0495587_0168307 3300046536 Bacteria 1245
118 Ga0495645_0019222 3300046543 Bacteria 4918
119 Ga0495645_0020721 3300046543 Bacteria 4747
120 Ga0495667_0025937 3300046559 Bacteria 3947
121 Ga0495634_0061903 3300046642 Bacteria 2486
122 Ga0495634_0217457 3300046642 Bacteria 1180
123 Ga0495635_0047866 3300046663 Bacteria 2947
124 Ga0495657_0035020 3300046675 Bacteria 3483
125 Ga0495599_0006757 3300046678 Bacteria 6928
126 Ga0495599_0078409 3300046678 Bacteria 2062
127 Ga0495599_0237320 3300046678 Bacteria 1112
128 Ga0495623_0073683 3300046679 Bacteria 2122
129 Ga0495646_0001016 3300046680 Bacteria 16204
130 Ga0495613_0029625 3300046689 Bacteria 4068
131 Ga0495613_0120242 3300046689 Bacteria 1886
132 Ga0495600_0041984 3300046809 Bacteria 2981
133 Ga0495581_0087426 3300047315 Bacteria 1807
134 Ga0495604_0015449 3300047317 Bacteria 6094
135 Ga0495604_0066786 3300047317 Bacteria 2735
136 Ga0495636_0023624 3300047318 Bacteria 2489
137 Ga0495674_0072020 3300047319 Bacteria 2981
138 Ga0495676_0088200 3300047321 Bacteria 2328
139 Ga0495680_0012961 3300047322 Bacteria 7300
140 Ga0495687_001249 3300047443 Bacteria 24187
141 Ga0495687_011469 3300047443 Bacteria 4763
142 Ga0495675_0005902 3300047444 Bacteria 7483
143 Ga0495685_002059 3300047447 Bacteria 6255
144 Ga0495684_0023881 3300047471 Bacteria 4701
145 Ga0495602_0108242 3300048088 Bacteria 2263
146 Ga0495602_0159118 3300048088 Bacteria 1765
147 Ga0496102_0266748 3300048905 Bacteria 1614
148 Ga0496104_0012269 3300048907 Bacteria 7701
149 Ga0496104_0640877 3300048907 Bacteria 972
150 Ga0496105_0111452 3300048908 Bacteria 2258
151 Ga0496108_0534094 3300048911 Bacteria 1024
152 Ga0496110_0170907 3300048913 Bacteria 1972
153 Ga0496115_0008201 3300048918 Bacteria 7717
154 Ga0501031_0045851 3300049568 Bacteria 2852
155 Ga0501032_0032244 3300049569 Bacteria 3590
156 Ga0501032_0105173 3300049569 Bacteria 1870
157 Ga0501033_0134268 3300049570 Bacteria 1791
158 Ga0501034_0071437 3300049571 Bacteria 3480
159 Ga0501036_0006286 3300049572 Bacteria 9637
160 Ga0501036_0017655 3300049572 Bacteria 5970
161 Ga0501036_0318598 3300049572 Bacteria 1299
162 Ga0501038_0234183 3300049574 Bacteria 1460
163 Ga0501043_0004082 3300049579 Bacteria 11928
164 Ga0501043_0424240 3300049579 Bacteria 1002
165 Ga0501047_0127745 3300049581 Bacteria 2422
166 Ga0501047_0453007 3300049581 Bacteria 1112
167 Ga0501048_0001015 3300049582 Bacteria 20966
168 Ga0501048_0355357 3300049582 Bacteria 1045
169 Ga0501070_0049728 3300049586 Bacteria 3481
170 Ga0501070_0354242 3300049586 Bacteria 1191
171 Ga0501074_0127369 3300049590 Bacteria 1822
172 Ga0501044_0422940 3300049823 Bacteria 1242
173 Ga0501044_0484285 3300049823 Bacteria 1140
174 Ga0495601_0058354 3300053077 Bacteria 2445
175 Ga0495601_0092184 3300053077 Bacteria 1951
176 Ga0495612_0120491 3300053078 Bacteria 1128
177 Ga0495595_0034906 3300053084 Bacteria 2277
178 Ga0495619_0104645 3300053085 Bacteria 1929
179 Ga0495619_0134326 3300053085 Bacteria 1701
180 Ga0500577_0201141 3300053142 Bacteria 859
181 2671839271 2671180195 Bacteria 9757215
182 2676205794 2675902999 Bacteria 9438463
183 2738692724 2738541272 Bacteria 6848551
184 2739323805 2738543027 Bacteria 6409078
185 2753266586 2751185782 Bacteria 11227053
186 2774850369 2773857921 Bacteria 9435764
187 2774857427 2773857922 Bacteria 9757215
188 2784591066 2784132148 Bacteria 8627943
189 2784591085 2784132148 Bacteria 8627943
190 2809233359 2808606448 Bacteria 8656184
191 2819747773 2818991472 Bacteria 10089953
192 2862293672 2862290372 Bacteria 7471434
193 2862710571 2862705112 Bacteria 6563286
194 2891399007 2891395885 Bacteria 9251614
195 2915770486 2915768154 Bacteria 8424322
196 2919716697 2919713450 Bacteria 7431245
197 3003009002 3002998708 Bacteria 11715108
198 8008490648 8008485437 Bacteria 7198341
199 8025525736 8025524527 Bacteria 7197316
200 8047713117 8047710418 Bacteria 11023148
201 8053951901 8053945823 Bacteria 8962862
202 8056454292 8056447290 Bacteria 7680491
203 Ga0495589_0116075
204 rootH1_10024369
205 rootL2_10137827
206 rootL2_10292714
207 Ga0068868_100289586
208 Ga0070668_100007854
209 Ga0070709_10004757
210 Ga0070714_100025584
211 Ga0070713_100302030
212 Ga0070711_100005781
213 Ga0070678_100391329
214 Ga0070681_10146131
215 Ga0070679_100004285
216 Ga0070684_100191626
217 Ga0070665_100779730
218 Ga0081540_1082918
219 Ga0081539_10003688
220 Ga0081539_10020244
221 Ga0070717_10008722
222 Ga0070717_10044693
223 Ga0070715_10001167
224 Ga0070716_100003348
225 Ga0070712_100143112
226 Ga0206353_10927703
227 Ga0213876_10018712
228 Ga0224572_1007346
229 Ga0207426_1002187
230 Ga0207699_10000677
231 Ga0207705_10450306
232 Ga0207707_10259469
233 Ga0207693_10011131
234 Ga0207663_10003497
235 Ga0207649_10074093
236 Ga0207652_10106457
237 Ga0207700_10001069
238 Ga0207664_10004555
239 Ga0207664_10038489
240 Ga0207664_10048143
241 Ga0207665_10006838
242 Ga0207668_10037562
243 Ga0207702_10008507
244 Ga0207674_10318307
245 Ga0207683_10401553
246 Ga0307511_10002474
247 Ga0307512_10006564
248 Ga0307509_10020649
249 Ga0307509_10056813
250 Ga0307509_10161520
251 Ga0307508_10029572
252 Ga0307508_10190592
253 Ga0307516_10005604
254 Ga0307405_10104184
255 Ga0307413_10220167
256 Ga0307518_10268657
257 Ga0326468_10002483
258 Ga0307407_10216406
259 Ga0307409_100208022
260 Ga0307415_100220788
261 Ga0307510_10022050
262 Ga0373951_0000379
263 Ga0373923_0144609
264 Ga0373953_0014312
265 Ga0373957_0030132
266 Ga0373960_0005646
267 Ga0373955_0202377
268 Ga0373962_0021799
269 Ga0373924_0040122
270 Ga0373935_0237461
271 Ga0373927_0397711
272 Ga0373933_0071965
273 Ga0373947_0178502
274 Ga0373937_0001630
275 Ga0372808_023188
276 Ga0373925_0154597
277 Ga0436364_0235851
278 Ga0436364_0435622
279 Ga0436364_0545177
280 Ga0436364_0611314
281 Ga0436364_0974741
282 Ga0436364_1407168
283 Ga0436365_1868059
284 Ga0436363_1692437
285 Ga0451791_0848592
286 Ga0439449_0129681
287 Ga0466961_0002927
288 Ga0466961_0158150
289 Ga0466963_0047150
290 Ga0466963_0077526
291 Ga0466963_0156494
292 Ga0466959_0018312
293 Ga0466967_0001426
294 Ga0466967_0039874
295 Ga0466967_0263817
296 Ga0466967_0733701
297 Ga0466967_0748338
298 Ga0495592_0036691
299 Ga0495603_0422943
300 Ga0495629_0221352
301 Ga0495641_0018167
302 Ga0495651_0167916
303 Ga0495651_0180075
304 Ga0495653_0083196
305 Ga0495582_0056708
306 Ga0495662_0009935
307 Ga0495664_0000271
308 Ga0495664_0059547
309 Ga0495585_0054404
310 Ga0495608_0012247
311 Ga0495608_0034850
312 Ga0495628_0033988
313 Ga0495652_0111329
314 Ga0495665_0056553
315 Ga0495640_0008867
316 Ga0495640_0037966
317 Ga0495586_0100520
318 Ga0495587_0029368
319 Ga0495587_0168307
320 Ga0495645_0019222
321 Ga0495645_0020721
322 Ga0495667_0025937
323 Ga0495634_0061903
324 Ga0495634_0217457
325 Ga0495635_0047866
326 Ga0495657_0035020
327 Ga0495599_0006757
328 Ga0495599_0078409
329 Ga0495599_0237320
330 Ga0495623_0073683
331 Ga0495646_0001016
332 Ga0495613_0029625
333 Ga0495613_0120242
334 Ga0495600_0041984
335 Ga0495581_0087426
336 Ga0495604_0015449
337 Ga0495604_0066786
338 Ga0495636_0023624
339 Ga0495674_0072020
340 Ga0495676_0088200
341 Ga0495680_0012961
342 Ga0495687_001249
343 Ga0495687_011469
344 Ga0495675_0005902
345 Ga0495685_002059
346 Ga0495684_0023881
347 Ga0495602_0108242
348 Ga0495602_0159118
349 Ga0496102_0266748
350 Ga0496104_0012269
351 Ga0496104_0640877
352 Ga0496105_0111452
353 Ga0496108_0534094
354 Ga0496110_0170907
355 Ga0496115_0008201
356 Ga0501031_0045851
357 Ga0501032_0032244
358 Ga0501032_0105173
359 Ga0501033_0134268
360 Ga0501034_0071437
361 Ga0501036_0006286
362 Ga0501036_0017655
363 Ga0501036_0318598
364 Ga0501038_0234183
365 Ga0501043_0004082
366 Ga0501043_0424240
367 Ga0501047_0127745
368 Ga0501047_0453007
369 Ga0501048_0001015
370 Ga0501048_0355357
371 Ga0501070_0049728
372 Ga0501070_0354242
373 Ga0501074_0127369
374 Ga0501044_0422940
375 Ga0501044_0484285
376 Ga0495601_0058354
377 Ga0495601_0092184
378 Ga0495612_0120491
379 Ga0495595_0034906
380 Ga0495619_0104645
381 Ga0495619_0134326
382 Ga0500577_0201141
383 2671839271
384 2676205794
385 2738692724
386 2739323805
387 2753266586
388 2774850369
389 2774857427
390 2784591066
391 2784591085
392 2809233359
393 2819747773
394 2862293672
395 2862710571
396 2891399007
397 2915770486
398 2919716697
399 3003009002
400 8008490648
401 8025525736
402 8047713117
403 8053951901
404 8056454292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

88

175

0.94

PF13489

Methyltransf_23

Methyltransferase domain

63

177

0.94

PF13649

Methyltransf_25

Methyltransferase domain

87

172

0.93

PF08242

Methyltransf_12

Methyltransferase domain

88

174

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6g-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution 0.8158 22 126
3thr-assembly1.cif.gz_A crystal structure of rat native liver glycine n-methyltransferase complexed with 5-methyltetrahydrofolate monoglutamate 0.8105 16 128
2idk-assembly1.cif.gz_A crystal structure of rat glycine n-methyltransferase complexed with folate 0.8056 17 128
7wm6-assembly1.cif.gz_B crystal structure of sah-bound trmm from mycoplasma capricolum 0.8044 21 126
1ws6-assembly1.cif.gz_A the structure of thermus thermphillus hb8 hypothetical protein ttha0928 0.8027 22 127
ID Description Score Start End Superfamily
af_Q54U59_216_375_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9104 35 125 3.40.50.150
af_Q59TS3_66_252_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8724 21 125 3.40.50.150
af_Q9P3E7_8_144_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8697 33 129 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8538 30 83 3.40.50.150
4hg2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8515 16 129 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6B2T004-F1-model_v4 Class I SAM-dependent methyltransferase 0.9928 1 114 GO:0008168
GO:0032259
AF-D9WMN7-F1-model_v4 Putative methyltransferase 0.9788 2 250 GO:0008757
GO:0032259
AF-A0A535TPR2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9695 2 106 GO:0008168
GO:0032259
AF-D9WMN7-F1-model_v4 Putative methyltransferase 0.9673 2 250 GO:0008757
GO:0032259
AF-Q2I758-F1-model_v4 PlaM2 0.9622 2 250

Map