F309516

General Info

Members Datasets Scaffolds Average Seq Length
202 132 202 332

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100075815|Ga0070708_1000758152
Length 379
Sequence MSTWPRHSLGEQVTKVPWAQQGVNAAGRRILDGDADAKVGRTLASDSNSAYHIPALPLPERGLIARIRRRARPSPAVIAGIGDDCAILRIRAGHEFLVTTDFSLEGVHFRRQWHPPESVGHRCLARGLSDIAAMGGDPVAAFLSLALPAKLPQRWVDRFFDGLLALAAEFKVTLAGGDTAQSPGGILADIVVLGSVPRGNAVLRSNAQLGDRIYVSGTLGGAAATLDLLNSKRRKKLRPDLYPEHFFPTPLIKLGQILRQQGIASAMIDISDGFSTDLAHICVESGVGAEIREDLLPLAKVGQAARSVDVRFALHGGEDYQLLFTAPKEQAVPAVIGGVAITEVGVITKSKDILLAHTNQRRSKLKPLGWEHFRKHTLR

Samples

Sample ID Description Type Environment
1 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
95 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
111 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
112 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
113 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
119 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
120 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
121 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.88
Rhizosphere 85.64
Stem 0
Stem Tuber 0
Unclassified 2.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10185140 3300003320 Unclassified 1580
2 Ga0070658_10284909 3300005327 Unclassified 1407
3 Ga0070683_100090564 3300005329 Bacteria 2872
4 Ga0068869_100055049 3300005334 Bacteria 2898
5 Ga0070680_100184548 3300005336 Bacteria 1757
6 Ga0070660_100072033 3300005339 Bacteria 2699
7 Ga0070659_100153068 3300005366 Bacteria 1882
8 Ga0070714_100037007 3300005435 Bacteria 4098
9 Ga0070714_100067855 3300005435 Bacteria 3077
10 Ga0070714_100147873 3300005435 Bacteria 2115
11 Ga0070710_10058372 3300005437 Bacteria 2189
12 Ga0070711_100016684 3300005439 Bacteria 4666
13 Ga0070708_100000613 3300005445 Bacteria 26909
14 Ga0070708_100002717 3300005445 Bacteria 13726
15 Ga0070708_100075815 3300005445 Bacteria 3036
16 Ga0070708_100082998 3300005445 Bacteria 2904
17 Ga0070663_100082718 3300005455 Bacteria 2362
18 Ga0070681_10274738 3300005458 Bacteria 1596
19 Ga0070685_10030039 3300005466 Bacteria 3024
20 Ga0070706_100000935 3300005467 Bacteria 31937
21 Ga0070706_100011331 3300005467 Bacteria 8285
22 Ga0070706_100014239 3300005467 Bacteria 7349
23 Ga0070706_100347087 3300005467 Bacteria 1383
24 Ga0070707_100002157 3300005468 Bacteria 18841
25 Ga0070707_100188756 3300005468 Bacteria 2009
26 Ga0070698_100000689 3300005471 Bacteria 36131
27 Ga0070698_100002044 3300005471 Bacteria 22425
28 Ga0070699_100000679 3300005518 Bacteria 31766
29 Ga0070699_100053765 3300005518 Unclassified 3485
30 Ga0070697_100000053 3300005536 Bacteria 88025
31 Ga0070697_100001303 3300005536 Bacteria 18808
32 Ga0068853_100087044 3300005539 Bacteria 2740
33 Ga0068853_100089587 3300005539 Bacteria 2702
34 Ga0070665_100075094 3300005548 Bacteria 3387
35 Ga0070665_100455114 3300005548 Bacteria 1290
36 Ga0068855_100034867 3300005563 Bacteria 5997
37 Ga0068855_100046303 3300005563 Bacteria 5142
38 Ga0068855_100517778 3300005563 Bacteria 1294
39 Ga0068855_100531642 3300005563 Bacteria 1275
40 Ga0068857_100038691 3300005577 Bacteria 4223
41 Ga0068854_100315973 3300005578 Unclassified 1268
42 Ga0068856_100086487 3300005614 Archaea 3115
43 Ga0068864_100048249 3300005618 Bacteria 3660
44 Ga0068861_100124461 3300005719 Bacteria 2084
45 Ga0068851_10017475 3300005834 Unclassified 3446
46 Ga0068863_100088157 3300005841 Bacteria 2940
47 Ga0068863_100093064 3300005841 Bacteria 2861
48 Ga0068863_100196666 3300005841 Unclassified 1938
49 Ga0068863_100270057 3300005841 Bacteria 1646
50 Ga0068860_100033292 3300005843 Bacteria 4946
51 Ga0068862_100107344 3300005844 Bacteria 2448
52 Ga0070717_10016413 3300006028 Bacteria 5739
53 Ga0070717_10086285 3300006028 Bacteria 2642
54 Ga0097621_100033870 3300006237 Bacteria 4072
55 Ga0068871_100155226 3300006358 Unclassified 1954
56 Ga0075434_100000475 3300006871 Bacteria 30016
57 Ga0075436_100001451 3300006914 Bacteria 16110
58 Ga0075435_100000307 3300007076 Bacteria 30206
59 Ga0099794_10067093 3300007265 Unclassified 1751
60 Ga0105240_10020446 3300009093 Bacteria 8830
61 Ga0105240_10064437 3300009093 Bacteria 4554
62 Ga0105240_10214674 3300009093 Bacteria 2245
63 Ga0114129_10510109 3300009147 Unclassified 1569
64 Ga0105243_10036902 3300009148 Bacteria 3796
65 Ga0105241_10019275 3300009174 Bacteria 5031
66 Ga0105241_10020634 3300009174 Bacteria 4868
67 Ga0105248_10098813 3300009177 Bacteria 3288
68 Ga0105248_10149069 3300009177 Bacteria 2639
69 Ga0105237_10195112 3300009545 Unclassified 2024
70 Ga0105239_10050965 3300010375 Unclassified 4539
71 Ga0105239_10161257 3300010375 Bacteria 2505
72 Ga0157373_10113322 3300013100 Unclassified 1906
73 Ga0157370_10018358 3300013104 Bacteria 7036
74 Ga0157370_10119679 3300013104 Bacteria 2458
75 Ga0157369_10013671 3300013105 Bacteria 9179
76 Ga0157369_10020879 3300013105 Bacteria 7321
77 Ga0157369_10089029 3300013105 Unclassified 3295
78 Ga0157374_10092212 3300013296 Bacteria 2890
79 Ga0163162_10159320 3300013306 Bacteria 2378
80 Ga0157372_10004384 3300013307 Bacteria 15059
81 Ga0157372_10031132 3300013307 Bacteria 5841
82 Ga0157372_10039140 3300013307 Bacteria 5234
83 Ga0157372_10076864 3300013307 Bacteria 3770
84 Ga0157375_10054585 3300013308 Unclassified 3935
85 Ga0157375_10458468 3300013308 Unclassified 1440
86 Ga0163163_10035106 3300014325 Bacteria 4862
87 Ga0163163_10054995 3300014325 Unclassified 3933
88 Ga0182008_10025148 3300014497 Unclassified 3026
89 Ga0157379_10291856 3300014968 Bacteria 1485
90 Ga0157379_10428470 3300014968 Bacteria 1219
91 Ga0157376_10034034 3300014969 Bacteria 4110
92 Ga0157376_10360099 3300014969 Unclassified 1395
93 Ga0213872_10002403 3300021361 Bacteria 11053
94 Ga0207692_10019893 3300025898 Bacteria 3043
95 Ga0207647_10050395 3300025904 Bacteria 2578
96 Ga0207684_10000223 3300025910 Bacteria 87514
97 Ga0207684_10001852 3300025910 Bacteria 22015
98 Ga0207654_10069491 3300025911 Bacteria 2087
99 Ga0207707_10096670 3300025912 Bacteria 2581
100 Ga0207707_10235850 3300025912 Bacteria 1591
101 Ga0207695_10021009 3300025913 Bacteria 7457
102 Ga0207671_10068961 3300025914 Bacteria 2636
103 Ga0207693_10009489 3300025915 Bacteria 7925
104 Ga0207663_10079819 3300025916 Bacteria 2138
105 Ga0207660_10149010 3300025917 Bacteria 1796
106 Ga0207657_10028695 3300025919 Bacteria 5072
107 Ga0207652_10266714 3300025921 Bacteria 1544
108 Ga0207646_10000341 3300025922 Bacteria 63056
109 Ga0207646_10000348 3300025922 Bacteria 62738
110 Ga0207700_10050051 3300025928 Bacteria 3111
111 Ga0207700_10079287 3300025928 Bacteria 2557
112 Ga0207664_10027184 3300025929 Bacteria 4334
113 Ga0207706_10220777 3300025933 Bacteria 1659
114 Ga0207711_10070982 3300025941 Bacteria 3021
115 Ga0207711_10187983 3300025941 Bacteria 1881
116 Ga0207689_10001592 3300025942 Bacteria 21492
117 Ga0207661_10067311 3300025944 Bacteria 2913
118 Ga0207661_10079876 3300025944 Bacteria 2697
119 Ga0207679_10061055 3300025945 Bacteria 2804
120 Ga0207667_10096283 3300025949 Bacteria 3055
121 Ga0207667_10260485 3300025949 Bacteria 1773
122 Ga0207667_10372054 3300025949 Bacteria 1456
123 Ga0207677_10091711 3300026023 Bacteria 2210
124 Ga0207703_10020571 3300026035 Bacteria 5161
125 Ga0207639_10229184 3300026041 Bacteria 1609
126 Ga0207702_10019031 3300026078 Bacteria 5682
127 Ga0207702_10034072 3300026078 Bacteria 4255
128 Ga0207641_10252304 3300026088 Bacteria 1648
129 Ga0207676_10062099 3300026095 Bacteria 2962
130 Ga0207674_10027369 3300026116 Bacteria 6033
131 Ga0207675_100167810 3300026118 Bacteria 2097
132 Ga0207698_10004759 3300026142 Bacteria 8305
133 Ga0268266_10362405 3300028379 Bacteria 1364
134 Ga0268265_10155521 3300028380 Bacteria 1934
135 Ga0268264_10122525 3300028381 Bacteria 2293
136 Ga0265338_10006677 3300028800 Bacteria 14586
137 Ga0265338_10008116 3300028800 Bacteria 12822
138 Ga0265762_1008532 3300030760 Bacteria 1824
139 Ga0265328_10048056 3300031239 Bacteria 1568
140 Ga0265329_10001299 3300031242 Bacteria 12146
141 Ga0265316_10148699 3300031344 Unclassified 1755
142 Ga0265314_10000034 3300031711 Bacteria 241556
143 Ga0307510_10091317 3300033180 Bacteria 2888
144 Ga0373933_0058322 3300035724 Bacteria 2322
145 Ga0373937_0025887 3300036401 Bacteria 5298
146 Ga0373937_0504203 3300036401 Bacteria 1150
147 Ga0373925_0032451 3300037068 Unclassified 3844
148 Ga0395900_0020477 3300037418 Bacteria 6752
149 Ga0395905_0034318 3300037471 Bacteria 4764
150 Ga0395905_0159928 3300037471 Bacteria 2117
151 Ga0436360_0111474 3300039438 Bacteria 6156
152 Ga0436361_0034168 3300039447 Bacteria 12217
153 Ga0436361_0159168 3300039447 Bacteria 35585
154 Ga0436361_0337014 3300039447 Bacteria 5408
155 Ga0436361_0488590 3300039447 Bacteria 2085
156 Ga0466963_0006072 3300044694 Bacteria 7121
157 Ga0451576_0062060 3300045051 Bacteria 3897
158 Ga0466958_0092739 3300045836 Unclassified 1870
159 Ga0466967_0026328 3300045976 Bacteria 4816
160 Ga0466967_0253538 3300045976 Unclassified 1682
161 Ga0495629_0143800 3300046459 Bacteria 1659
162 Ga0495580_0038266 3300046472 Bacteria 3436
163 Ga0495645_0176527 3300046543 Unclassified 1467
164 Ga0495669_0029419 3300046684 Bacteria 2409
165 Ga0495669_0066910 3300046684 Unclassified 1632
166 Ga0496100_0003409 3300048903 Bacteria 8282
167 Ga0496100_0082636 3300048903 Bacteria 2173
168 Ga0496100_0107245 3300048903 Bacteria 1935
169 Ga0496102_0117173 3300048905 Bacteria 2486
170 Ga0496102_0218299 3300048905 Bacteria 1797
171 Ga0496103_0129075 3300048906 Bacteria 1614
172 Ga0496104_0038527 3300048907 Unclassified 4473
173 Ga0496104_0319979 3300048907 Unclassified 1464
174 Ga0496105_0021464 3300048908 Bacteria 5225
175 Ga0496106_0021891 3300048909 Unclassified 4749
176 Ga0496107_0107735 3300048910 Unclassified 2046
177 Ga0496107_0317248 3300048910 Bacteria 1160
178 Ga0496108_0036679 3300048911 Bacteria 4080
179 Ga0496109_0160772 3300048912 Bacteria 2104
180 Ga0496109_0314543 3300048912 Bacteria 1477
181 Ga0496109_0325623 3300048912 Bacteria 1450
182 Ga0496112_0020038 3300048915 Bacteria 6332
183 Ga0496112_0172137 3300048915 Bacteria 2130
184 Ga0496112_0263563 3300048915 Bacteria 1672
185 Ga0496113_0013144 3300048916 Bacteria 5592
186 Ga0496113_0035316 3300048916 Bacteria 3655
187 Ga0496114_0053895 3300048917 Unclassified 3352
188 Ga0496115_0132255 3300048918 Unclassified 2056
189 Ga0496115_0192926 3300048918 Bacteria 1683
190 Ga0496126_0000215 3300048929 Bacteria 127753
191 Ga0496126_0003413 3300048929 Bacteria 20084
192 Ga0496126_0021790 3300048929 Bacteria 6251
193 Ga0501083_0076212 3300049744 Bacteria 2226
194 nmdc:mga05p37_504631_c1 3300050507 Unclassified 1387
195 nmdc:mga0n895_19993_c1 3300050512 Bacteria 6234
196 nmdc:mga0n895_838_c1 3300050512 Bacteria 22032
197 nmdc:mga0rr50_1337_c1 3300050513 Bacteria 13452
198 nmdc:mga0rr50_3443_c1 3300050513 Bacteria 9105
199 nmdc:mga08x19_62715_c1 3300050514 Bacteria 2411
200 nmdc:mga08x19_7079_c1 3300050514 Bacteria 6656
201 nmdc:mga08x19_71349_c1 3300050514 Bacteria 2265
202 nmdc:mga0a205_181_c2 3300050515 Bacteria 34765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050514 nmdc:mga08x19_62715_c1 nmdc:mga08x19_62715_c1_1126_1947 271
2 3300005445 Ga0070708_100002717 Ga0070708_1000027171 286
3 3300005536 Ga0070697_100001303 Ga0070697_10000130311 286
4 3300025910 Ga0207684_10001852 Ga0207684_1000185218 286
5 3300005435 Ga0070714_100067855 Ga0070714_1000678553 298
6 3300036401 Ga0373937_0504203 Ga0373937_0504203_26_928 298
7 3300005563 Ga0068855_100046303 Ga0068855_1000463033 299
8 3300013104 Ga0157370_10018358 Ga0157370_100183585 299
9 3300013307 Ga0157372_10031132 Ga0157372_100311322 299
10 3300025949 Ga0207667_10096283 Ga0207667_100962832 299
11 3300013105 Ga0157369_10020879 Ga0157369_100208797 301
12 3300025913 Ga0207695_10021009 Ga0207695_100210096 301
13 3300031239 Ga0265328_10048056 Ga0265328_100480562 301
14 3300031242 Ga0265329_10001299 Ga0265329_1000129912 301
15 3300031711 Ga0265314_10000034 Ga0265314_10000034132 301
16 3300005445 Ga0070708_100082998 Ga0070708_1000829982 302
17 3300005467 Ga0070706_100347087 Ga0070706_1003470871 302
18 3300006914 Ga0075436_100001451 Ga0075436_10000145110 302
19 3300050514 nmdc:mga08x19_71349_c1 nmdc:mga08x19_71349_c1_1069_2079 302
20 3300005577 Ga0068857_100038691 Ga0068857_1000386913 303
21 3300005841 Ga0068863_100093064 Ga0068863_1000930642 303
22 3300009177 Ga0105248_10098813 Ga0105248_100988133 303
23 3300010375 Ga0105239_10161257 Ga0105239_101612572 303
24 3300014325 Ga0163163_10035106 Ga0163163_100351062 303
25 3300025941 Ga0207711_10187983 Ga0207711_101879832 303
26 3300025944 Ga0207661_10067311 Ga0207661_100673112 303
27 3300048911 Ga0496108_0036679 Ga0496108_0036679_1195_2139 303
28 3300048912 Ga0496109_0325623 Ga0496109_0325623_421_1365 303
29 3300048915 Ga0496112_0263563 Ga0496112_0263563_620_1564 303
30 3300048916 Ga0496113_0035316 Ga0496113_0035316_2385_3329 303
31 3300048918 Ga0496115_0192926 Ga0496115_0192926_167_1111 303
32 3300030760 Ga0265762_1008532 Ga0265762_10085321 307
33 3300028800 Ga0265338_10008116 Ga0265338_100081169 310
34 3300045051 Ga0451576_0062060 Ga0451576_0062060_1829_2773 310
35 3300037471 Ga0395905_0159928 Ga0395905_0159928_679_1620 311
36 3300005336 Ga0070680_100184548 Ga0070680_1001845482 314
37 3300013306 Ga0163162_10159320 Ga0163162_101593203 314
38 3300025917 Ga0207660_10149010 Ga0207660_101490102 314
39 3300025941 Ga0207711_10070982 Ga0207711_100709822 314
40 3300046684 Ga0495669_0066910 Ga0495669_0066910_280_1278 314
41 3300005548 Ga0070665_100455114 Ga0070665_1004551142 315
42 3300028379 Ga0268266_10362405 Ga0268266_103624052 315
43 3300005445 Ga0070708_100000613 Ga0070708_1000006133 316
44 3300005467 Ga0070706_100000935 Ga0070706_10000093518 316
45 3300005468 Ga0070707_100002157 Ga0070707_10000215717 316
46 3300005471 Ga0070698_100002044 Ga0070698_1000020447 316
47 3300006028 Ga0070717_10086285 Ga0070717_100862852 316
48 3300025912 Ga0207707_10096670 Ga0207707_100966703 316
49 3300025922 Ga0207646_10000341 Ga0207646_100003415 316
50 3300025928 Ga0207700_10079287 Ga0207700_100792872 316
51 3300037471 Ga0395905_0034318 Ga0395905_0034318_1705_2667 316
52 3300006871 Ga0075434_100000475 Ga0075434_1000004756 317
53 3300007076 Ga0075435_100000307 Ga0075435_10000030719 317
54 3300009093 Ga0105240_10020446 Ga0105240_100204467 317
55 3300009147 Ga0114129_10510109 Ga0114129_105101091 317
56 3300046684 Ga0495669_0029419 Ga0495669_0029419_1093_2088 317
57 3300050507 nmdc:mga05p37_504631_c1 nmdc:mga05p37_504631_c1_107_1066 317
58 3300050512 nmdc:mga0n895_838_c1 nmdc:mga0n895_838_c1_761_1720 317
59 3300050513 nmdc:mga0rr50_1337_c1 nmdc:mga0rr50_1337_c1_2167_3126 317
60 3300050514 nmdc:mga08x19_7079_c1 nmdc:mga08x19_7079_c1_1183_2142 317
61 3300050515 nmdc:mga0a205_181_c2 nmdc:mga0a205_181_c2_30488_31447 317
62 3300005841 Ga0068863_100270057 Ga0068863_1002700572 318
63 3300009177 Ga0105248_10149069 Ga0105248_101490692 318
64 3300014968 Ga0157379_10291856 Ga0157379_102918561 318
65 3300026088 Ga0207641_10252304 Ga0207641_102523042 318
66 3300035724 Ga0373933_0058322 Ga0373933_0058322_872_1873 318
67 3300036401 Ga0373937_0025887 Ga0373937_0025887_2069_3070 318
68 3300046472 Ga0495580_0038266 Ga0495580_0038266_1755_2744 318
69 3300005437 Ga0070710_10058372 Ga0070710_100583722 319
70 3300005439 Ga0070711_100016684 Ga0070711_1000166841 319
71 3300009093 Ga0105240_10064437 Ga0105240_100644374 319
72 3300009174 Ga0105241_10020634 Ga0105241_100206343 319
73 3300013307 Ga0157372_10004384 Ga0157372_100043849 319
74 3300025898 Ga0207692_10019893 Ga0207692_100198933 319
75 3300025916 Ga0207663_10079819 Ga0207663_100798191 319
76 3300025928 Ga0207700_10050051 Ga0207700_100500512 319
77 3300048929 Ga0496126_0021790 Ga0496126_0021790_2186_3175 319
78 3300049744 Ga0501083_0076212 Ga0501083_0076212_403_1368 319
79 3300005467 Ga0070706_100014239 Ga0070706_1000142392 320
80 3300009545 Ga0105237_10195112 Ga0105237_101951122 320
81 3300014968 Ga0157379_10428470 Ga0157379_104284702 320
82 3300048907 Ga0496104_0319979 Ga0496104_0319979_51_1019 320
83 3300005334 Ga0068869_100055049 Ga0068869_1000550493 321
84 3300006028 Ga0070717_10016413 Ga0070717_100164133 321
85 3300006237 Ga0097621_100033870 Ga0097621_1000338704 321
86 3300025944 Ga0207661_10079876 Ga0207661_100798762 321
87 3300026142 Ga0207698_10004759 Ga0207698_100047597 321
88 3300005435 Ga0070714_100147873 Ga0070714_1001478732 322
89 3300044694 Ga0466963_0006072 Ga0466963_0006072_5325_6323 322
90 3300045836 Ga0466958_0092739 Ga0466958_0092739_568_1551 322
91 3300005339 Ga0070660_100072033 Ga0070660_1000720332 323
92 3300005366 Ga0070659_100153068 Ga0070659_1001530681 323
93 3300005539 Ga0068853_100087044 Ga0068853_1000870442 323
94 3300005834 Ga0068851_10017475 Ga0068851_100174753 323
95 3300005841 Ga0068863_100088157 Ga0068863_1000881573 323
96 3300007265 Ga0099794_10067093 Ga0099794_100670932 323
97 3300010375 Ga0105239_10050965 Ga0105239_100509655 323
98 3300013100 Ga0157373_10113322 Ga0157373_101133222 323
99 3300013296 Ga0157374_10092212 Ga0157374_100922122 323
100 3300013307 Ga0157372_10076864 Ga0157372_100768642 323
101 3300014497 Ga0182008_10025148 Ga0182008_100251483 323
102 3300025912 Ga0207707_10235850 Ga0207707_102358502 323
103 3300025914 Ga0207671_10068961 Ga0207671_100689612 323
104 3300025919 Ga0207657_10028695 Ga0207657_100286955 323
105 3300025921 Ga0207652_10266714 Ga0207652_102667141 323
106 3300025945 Ga0207679_10061055 Ga0207679_100610552 323
107 3300025949 Ga0207667_10260485 Ga0207667_102604852 323
108 3300026078 Ga0207702_10034072 Ga0207702_100340721 323
109 3300045976 Ga0466967_0253538 Ga0466967_0253538_10_1011 323
110 3300048903 Ga0496100_0107245 Ga0496100_0107245_279_1256 323
111 3300048905 Ga0496102_0218299 Ga0496102_0218299_764_1741 323
112 3300048909 Ga0496106_0021891 Ga0496106_0021891_3453_4430 323
113 3300048910 Ga0496107_0317248 Ga0496107_0317248_10_987 323
114 3300048912 Ga0496109_0314543 Ga0496109_0314543_302_1279 323
115 3300025911 Ga0207654_10069491 Ga0207654_100694912 324
116 3300045976 Ga0466967_0026328 Ga0466967_0026328_2723_3709 324
117 3300005467 Ga0070706_100011331 Ga0070706_1000113318 325
118 3300005471 Ga0070698_100000689 Ga0070698_10000068920 325
119 3300005518 Ga0070699_100000679 Ga0070699_1000006793 325
120 3300005518 Ga0070699_100053765 Ga0070699_1000537652 325
121 3300005536 Ga0070697_100000053 Ga0070697_10000005352 325
122 3300005539 Ga0068853_100089587 Ga0068853_1000895871 325
123 3300005563 Ga0068855_100517778 Ga0068855_1005177782 325
124 3300005614 Ga0068856_100086487 Ga0068856_1000864871 325
125 3300025910 Ga0207684_10000223 Ga0207684_1000022320 325
126 3300025922 Ga0207646_10000348 Ga0207646_1000034835 325
127 3300026041 Ga0207639_10229184 Ga0207639_102291842 325
128 3300033180 Ga0307510_10091317 Ga0307510_100913171 325
129 3300025904 Ga0207647_10050395 Ga0207647_100503952 326
130 3300028800 Ga0265338_10006677 Ga0265338_100066773 326
131 3300031344 Ga0265316_10148699 Ga0265316_101486992 326
132 3300048905 Ga0496102_0117173 Ga0496102_0117173_548_1627 326
133 3300048912 Ga0496109_0160772 Ga0496109_0160772_969_2048 326
134 3300048915 Ga0496112_0172137 Ga0496112_0172137_636_1715 326
135 3300048916 Ga0496113_0013144 Ga0496113_0013144_982_2061 326
136 3300005329 Ga0070683_100090564 Ga0070683_1000905642 327
137 3300005563 Ga0068855_100034867 Ga0068855_1000348674 327
138 3300005618 Ga0068864_100048249 Ga0068864_1000482492 327
139 3300025949 Ga0207667_10372054 Ga0207667_103720542 327
140 3300026095 Ga0207676_10062099 Ga0207676_100620991 327
141 3300026116 Ga0207674_10027369 Ga0207674_100273699 327
142 3300037418 Ga0395900_0020477 Ga0395900_0020477_5083_6090 327
143 3300050512 nmdc:mga0n895_19993_c1 nmdc:mga0n895_19993_c1_3370_4371 327
144 3300050513 nmdc:mga0rr50_3443_c1 nmdc:mga0rr50_3443_c1_5618_6619 327
145 3300013307 Ga0157372_10039140 Ga0157372_100391402 328
146 3300013308 Ga0157375_10054585 Ga0157375_100545852 328
147 3300014969 Ga0157376_10034034 Ga0157376_100340342 328
148 3300014969 Ga0157376_10360099 Ga0157376_103600992 328
149 3300046459 Ga0495629_0143800 Ga0495629_0143800_476_1498 328
150 3300046543 Ga0495645_0176527 Ga0495645_0176527_94_1116 328
151 3300048903 Ga0496100_0003409 Ga0496100_0003409_6006_7028 328
152 3300048907 Ga0496104_0038527 Ga0496104_0038527_544_1566 328
153 3300048908 Ga0496105_0021464 Ga0496105_0021464_548_1570 328
154 3300048910 Ga0496107_0107735 Ga0496107_0107735_530_1552 328
155 3300048917 Ga0496114_0053895 Ga0496114_0053895_190_1212 328
156 3300048918 Ga0496115_0132255 Ga0496115_0132255_41_1063 328
157 3300005466 Ga0070685_10030039 Ga0070685_100300394 329
158 3300005548 Ga0070665_100075094 Ga0070665_1000750942 329
159 3300005563 Ga0068855_100531642 Ga0068855_1005316421 329
160 3300005578 Ga0068854_100315973 Ga0068854_1003159731 329
161 3300005719 Ga0068861_100124461 Ga0068861_1001244613 329
162 3300005841 Ga0068863_100196666 Ga0068863_1001966661 329
163 3300005843 Ga0068860_100033292 Ga0068860_1000332925 329
164 3300005844 Ga0068862_100107344 Ga0068862_1001073443 329
165 3300006358 Ga0068871_100155226 Ga0068871_1001552261 329
166 3300009093 Ga0105240_10214674 Ga0105240_102146742 329
167 3300009174 Ga0105241_10019275 Ga0105241_100192755 329
168 3300013105 Ga0157369_10013671 Ga0157369_100136717 329
169 3300013308 Ga0157375_10458468 Ga0157375_104584682 329
170 3300025933 Ga0207706_10220777 Ga0207706_102207772 329
171 3300025942 Ga0207689_10001592 Ga0207689_100015928 329
172 3300026023 Ga0207677_10091711 Ga0207677_100917112 329
173 3300026035 Ga0207703_10020571 Ga0207703_100205712 329
174 3300026078 Ga0207702_10019031 Ga0207702_100190314 329
175 3300026118 Ga0207675_100167810 Ga0207675_1001678103 329
176 3300028380 Ga0268265_10155521 Ga0268265_101555212 329
177 3300028381 Ga0268264_10122525 Ga0268264_101225252 329
178 3300048915 Ga0496112_0020038 Ga0496112_0020038_45_1064 329
179 3300005458 Ga0070681_10274738 Ga0070681_102747381 330
180 3300037068 Ga0373925_0032451 Ga0373925_0032451_600_1637 330
181 3300048903 Ga0496100_0082636 Ga0496100_0082636_900_1979 330
182 3300005327 Ga0070658_10284909 Ga0070658_102849092 331
183 3300005435 Ga0070714_100037007 Ga0070714_1000370072 331
184 3300013104 Ga0157370_10119679 Ga0157370_101196792 331
185 3300025929 Ga0207664_10027184 Ga0207664_100271845 331
186 3300048929 Ga0496126_0003413 Ga0496126_0003413_9816_10862 331
187 3300025915 Ga0207693_10009489 Ga0207693_100094892 332
188 3300005445 Ga0070708_100075815 Ga0070708_1000758152 333
189 3300005468 Ga0070707_100188756 Ga0070707_1001887562 333
190 3300048929 Ga0496126_0000215 Ga0496126_0000215_6435_7478 333
191 3300013105 Ga0157369_10089029 Ga0157369_100890292 334
192 3300048906 Ga0496103_0129075 Ga0496103_0129075_341_1384 334
193 3300009148 Ga0105243_10036902 Ga0105243_100369022 338
194 3300014325 Ga0163163_10054995 Ga0163163_100549953 338
195 3300039447 Ga0436361_0034168 Ga0436361_0034168_10820_11917 342
196 3300039447 Ga0436361_0488590 Ga0436361_0488590_421_1518 342
197 3300021361 Ga0213872_10002403 Ga0213872_1000240310 343
198 3300039438 Ga0436360_0111474 Ga0436360_0111474_305_1405 343
199 3300039447 Ga0436361_0159168 Ga0436361_0159168_1865_2965 343
200 3300039447 Ga0436361_0337014 Ga0436361_0337014_2340_3440 343
201 3300005455 Ga0070663_100082718 Ga0070663_1000827182 344
202 3300003320 rootH2_10185140 rootH2_101851401 351

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00586

AIRS

AIR synthase related protein, N-terminal domain

82

196

0.96

PF02769

AIRS_C

AIR synthase related protein, C-terminal domain

208

356

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mfm-assembly1.cif.gz_A structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form 0.9082 16 345
6mfm-assembly1.cif.gz_A structure of thiamine-monophosphate kinase from acinetobacter baumannii in complex with adenosine diphosphate (adp) and thiamine diphosphate (tpp), orthorhombic crystal form 0.9024 16 345
7du3-assembly1.cif.gz_A error: 404 client error: for url: https://data.rcsb.org/rest/v1/core/entry/7du3 0.8616 15 334
6xep-assembly1.cif.gz_A-2 crystal structure of thiamine-monophosphate kinase from stenotrophomonas maltophilia k279a 0.8587 22 336
3mcq-assembly1.cif.gz_A-2 crystal structure of thiamine-monophosphate kinase (mfla_0573) from methylobacillus flagellatus kt at 1.91 a resolution 0.8525 47 334
ID Description Score Start End Superfamily
5d9uB01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9531 14 162 3.30.1330.10
5d9uB01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9466 14 162 3.30.1330.10
af_P9WG71_14_154_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.9078 21 156 3.30.1330.10
3mcqA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8796 47 162 3.30.1330.10
af_P9WG71_14_154_3.30.1330.10 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;PurM-like, N-terminal domain 0.8593 21 156 3.30.1330.10
ID Description Score Start End GO Terms
AF-A0A2V9ZQI8-F1-model_v4 Thiamine-phosphate kinase 0.9958 65 171 GO:0009030
GO:0009228
AF-A0A2V9ZQI8-F1-model_v4 Thiamine-phosphate kinase 0.9776 65 171 GO:0009030
GO:0009228
AF-A0A523XJ50-F1-model_v4 Thiamine-monophosphate kinase 0.9598 15 172 GO:0009030
GO:0009228
AF-A0A7C5H3C1-F1-model_v4 Thiamine-monophosphate kinase 0.9387 49 274 GO:0009030
GO:0009228
AF-A0A7Y5DXH5-F1-model_v4 Thiamine-phosphate kinase 0.9372 13 170 GO:0009030
GO:0009228

Feature Viewer

pLDDT pTM Quality
87.23 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map