F309475

General Info

Members Datasets Scaffolds Average Seq Length
202 158 202 146

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10054261|Ga0070709_100542612
Length 156
Sequence MWAGLPGCLNPQMIEFTLRRTTTAPIEKVFDALTNHRGIADYVAMARRSTLDREGVPAPNGVGAVRRIEALGPAIVEEIIEYERPTRYAYKMVSGAPVRDHVGTVTLRAAGTGTEAEWHLRSTPKIPGLDWLLTPVLKKVIGDLFKGAITAAERNS

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
69 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
70 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
71 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
80 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
90 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
94 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
97 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
101 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
102 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
103 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
111 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
115 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
116 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
122 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
128 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
129 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.96
Rhizosphere 94.06
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000183 3300001977 Bacteria 8260
2 JGI24748J21848_1000323 3300002074 Bacteria 5521
3 JGI24034J26672_10000116 3300002239 Bacteria 12920
4 rootL2_10300801 3300003322 Bacteria 1740
5 Ga0070682_101605355 3300005337 Unclassified 562
6 Ga0068868_100064867 3300005338 Bacteria 2900
7 Ga0068868_100586505 3300005338 Bacteria 986
8 Ga0070660_101802293 3300005339 Unclassified 521
9 Ga0070691_10000186 3300005341 Bacteria 20683
10 Ga0070673_100003392 3300005364 Bacteria 9911
11 Ga0070659_100023363 3300005366 Bacteria 4730
12 Ga0070709_10054261 3300005434 Bacteria 2526
13 Ga0070714_100012275 3300005435 Bacteria 6835
14 Ga0070713_100744006 3300005436 Bacteria 938
15 Ga0070700_100083676 3300005441 Unclassified 2066
16 Ga0070694_100887287 3300005444 Bacteria 735
17 Ga0070663_100270847 3300005455 Bacteria 1350
18 Ga0070662_100000079 3300005457 Bacteria 53583
19 Ga0070681_10366583 3300005458 Bacteria 1351
20 Ga0070685_10476903 3300005466 Bacteria 879
21 Ga0070679_100000077 3300005530 Bacteria 74222
22 Ga0070684_100714804 3300005535 Bacteria 934
23 Ga0070684_100807724 3300005535 Unclassified 877
24 Ga0068853_100003821 3300005539 Bacteria 11534
25 Ga0070686_100122539 3300005544 Bacteria 1787
26 Ga0070695_100121880 3300005545 Bacteria 1785
27 Ga0070693_100001830 3300005547 Bacteria 9710
28 Ga0070702_100249195 3300005615 Unclassified 1203
29 Ga0068852_100384091 3300005616 Bacteria 1378
30 Ga0068863_100000039 3300005841 Bacteria 161450
31 Ga0068863_100044544 3300005841 Bacteria 4212
32 Ga0068863_100050554 3300005841 Bacteria 3940
33 Ga0068860_100214669 3300005843 Unclassified 1867
34 Ga0068860_100412242 3300005843 Unclassified 1338
35 Ga0081540_1000044 3300005983 Bacteria 134269
36 Ga0081540_1064001 3300005983 Unclassified 1737
37 Ga0081539_10003996 3300005985 Bacteria 17009
38 Ga0070717_10282635 3300006028 Bacteria 1472
39 Ga0070717_11331056 3300006028 Bacteria 653
40 Ga0070716_100256963 3300006173 Bacteria 1193
41 Ga0097621_100172691 3300006237 Unclassified 1864
42 Ga0068871_100375275 3300006358 Unclassified 1262
43 Ga0105240_10585645 3300009093 Bacteria 1230
44 Ga0105247_10207261 3300009101 Bacteria 1320
45 Ga0105237_10418913 3300009545 Bacteria 1345
46 Ga0105237_10727586 3300009545 Bacteria 999
47 Ga0105249_10729400 3300009553 Bacteria 1052
48 Ga0105239_11227448 3300010375 Bacteria 864
49 Ga0157369_10115894 3300013105 Bacteria 2845
50 Ga0157374_10001271 3300013296 Bacteria 21520
51 Ga0157374_10064641 3300013296 Bacteria 3434
52 Ga0157374_10329406 3300013296 Bacteria 1514
53 Ga0157375_10084939 3300013308 Bacteria 3215
54 Ga0163163_11356067 3300014325 Unclassified 773
55 Ga0157377_10522768 3300014745 Unclassified 833
56 Ga0157379_10172643 3300014968 Bacteria 1951
57 Ga0163161_10000013 3300017792 Bacteria 258747
58 Ga0213875_10044735 3300021388 Bacteria 2079
59 Ga0207699_10035542 3300025906 Bacteria 2835
60 Ga0207652_10000138 3300025921 Bacteria 77564
61 Ga0207700_10087529 3300025928 Bacteria 2450
62 Ga0207664_10211965 3300025929 Bacteria 1676
63 Ga0207690_10015393 3300025932 Bacteria 4634
64 Ga0207706_10000302 3300025933 Bacteria 53541
65 Ga0207704_10169271 3300025938 Bacteria 1565
66 Ga0207665_10256613 3300025939 Bacteria 1294
67 Ga0207651_10001092 3300025960 Bacteria 12041
68 Ga0207712_10000003 3300025961 Bacteria 615314
69 Ga0207668_10454233 3300025972 Bacteria 1094
70 Ga0207640_10297511 3300025981 Bacteria 1275
71 Ga0207677_10000426 3300026023 Bacteria 28416
72 Ga0207639_10000838 3300026041 Bacteria 20868
73 Ga0207678_10292840 3300026067 Bacteria 1398
74 Ga0207708_10113230 3300026075 Unclassified 2108
75 Ga0207641_10000065 3300026088 Bacteria 156066
76 Ga0207641_10001058 3300026088 Bacteria 27805
77 Ga0207698_10493693 3300026142 Bacteria 1190
78 Ga0268264_10159571 3300028381 Unclassified 2030
79 Ga0265337_1000074 3300028556 Bacteria 46897
80 Ga0265326_10000035 3300028558 Bacteria 89561
81 Ga0265319_1000091 3300028563 Bacteria 70394
82 Ga0265322_10000009 3300028654 Bacteria 170768
83 Ga0265336_10100582 3300028666 Unclassified 861
84 Ga0265336_10114964 3300028666 Bacteria 801
85 Ga0265338_10000752 3300028800 Bacteria 55238
86 Ga0265324_10000168 3300029957 Bacteria 50622
87 Ga0265332_10018941 3300031238 Bacteria 3039
88 Ga0265328_10002915 3300031239 Bacteria 7633
89 Ga0265320_10000024 3300031240 Bacteria 170768
90 Ga0265325_10027934 3300031241 Bacteria 3046
91 Ga0265329_10002105 3300031242 Bacteria 9248
92 Ga0265331_10031178 3300031250 Bacteria 2650
93 Ga0265327_10000227 3300031251 Bacteria 114777
94 Ga0265316_10036209 3300031344 Bacteria 3991
95 Ga0265314_10001556 3300031711 Bacteria 25291
96 Ga0265342_10172176 3300031712 Bacteria 1190
97 Ga0316583_10042421 3300032133 Unclassified 1609
98 Ga0373955_0148777 3300035172 Bacteria 1377
99 Ga0373933_0217870 3300035724 Bacteria 1224
100 Ga0373937_0218406 3300036401 Bacteria 1794
101 Ga0436364_1461304 3300037853 Bacteria 10672
102 Ga0451849_1315595 3300041505 Bacteria 1312
103 Ga0466969_0006190 3300044656 Bacteria 6370
104 Ga0466966_0097868 3300044684 Unclassified 1817
105 Ga0466961_0075975 3300044693 Unclassified 2129
106 Ga0466961_0643412 3300044693 Bacteria 636
107 Ga0466964_0211614 3300044706 Bacteria 937
108 Ga0466968_0012725 3300044735 Bacteria 3300
109 Ga0466957_0087435 3300044842 Bacteria 1949
110 Ga0466960_0475318 3300044901 Unclassified 729
111 Ga0466959_0007776 3300045049 Bacteria 7541
112 Ga0466959_0020523 3300045049 Bacteria 4869
113 Ga0466958_0083662 3300045836 Bacteria 1967
114 Ga0466967_0169767 3300045976 Bacteria 2052
115 Ga0495592_0000401 3300046454 Bacteria 33431
116 Ga0495603_0023891 3300046455 Bacteria 3698
117 Ga0495629_0002409 3300046459 Bacteria 14397
118 Ga0495629_0089001 3300046459 Unclassified 2154
119 Ga0495638_0008706 3300046460 Bacteria 7174
120 Ga0495641_0095862 3300046461 Bacteria 1324
121 Ga0495653_0067959 3300046463 Bacteria 2674
122 Ga0495639_0025000 3300046475 Bacteria 2632
123 Ga0495594_0000345 3300046499 Bacteria 23182
124 Ga0495608_0001938 3300046511 Bacteria 14858
125 Ga0495618_0000097 3300046514 Bacteria 63474
126 Ga0495618_0183065 3300046514 Bacteria 1331
127 Ga0495620_0000158 3300046515 Bacteria 54704
128 Ga0495628_0006170 3300046516 Bacteria 10479
129 Ga0495628_0042129 3300046516 Bacteria 3643
130 Ga0495628_0265824 3300046516 Bacteria 1277
131 Ga0495630_0000011 3300046517 Bacteria 232063
132 Ga0495630_0000082 3300046517 Bacteria 75280
133 Ga0495630_0001301 3300046517 Bacteria 17211
134 Ga0495644_0000404 3300046523 Bacteria 19389
135 Ga0495587_0004210 3300046536 Bacteria 9520
136 Ga0495587_0023048 3300046536 Bacteria 3829
137 Ga0495587_0097690 3300046536 Bacteria 1693
138 Ga0495587_0379727 3300046536 Bacteria 786
139 Ga0495587_0433537 3300046536 Bacteria 729
140 Ga0495587_0769021 3300046536 Bacteria 526
141 Ga0495598_0000798 3300046537 Bacteria 6025
142 Ga0495609_0409156 3300046538 Bacteria 542
143 Ga0495621_0000793 3300046539 Bacteria 7983
144 Ga0495621_0145510 3300046539 Bacteria 929
145 Ga0495667_0000053 3300046559 Bacteria 105370
146 Ga0495656_0007301 3300046615 Bacteria 3901
147 Ga0495668_0349383 3300046616 Bacteria 812
148 Ga0495634_0046338 3300046642 Bacteria 2935
149 Ga0495625_0000095 3300046660 Bacteria 143468
150 Ga0495635_0000006 3300046663 Bacteria 301820
151 Ga0495635_0056023 3300046663 Bacteria 2715
152 Ga0495657_0079479 3300046675 Bacteria 2124
153 Ga0495599_0217813 3300046678 Bacteria 1169
154 Ga0495647_0023862 3300046681 Unclassified 2222
155 Ga0495647_0087355 3300046681 Bacteria 1273
156 Ga0495658_0530698 3300046683 Unclassified 753
157 Ga0495624_0000049 3300046690 Bacteria 75485
158 Ga0495624_0030911 3300046690 Bacteria 3486
159 Ga0495600_0000893 3300046809 Bacteria 15969
160 Ga0495581_0099270 3300047315 Unclassified 1691
161 Ga0495604_0000038 3300047317 Bacteria 123703
162 Ga0495676_0693594 3300047321 Bacteria 659
163 Ga0495680_0000050 3300047322 Bacteria 95945
164 Ga0495680_0007552 3300047322 Bacteria 9943
165 Ga0495680_0293720 3300047322 Bacteria 1142
166 Ga0495680_0769272 3300047322 Bacteria 631
167 Ga0495685_206372 3300047447 Unclassified 629
168 Ga0495684_0025020 3300047471 Bacteria 4592
169 Ga0495686_0095312 3300047472 Bacteria 1802
170 Ga0495686_0185859 3300047472 Unclassified 1201
171 Ga0495593_0023550 3300047673 Unclassified 3422
172 Ga0496102_0000132 3300048905 Bacteria 103176
173 Ga0496103_0000077 3300048906 Bacteria 112223
174 Ga0496112_0000002 3300048915 Bacteria 782039
175 Ga0496114_0000003 3300048917 Bacteria 630981
176 Ga0496114_0015360 3300048917 Bacteria 6157
177 Ga0496115_0000004 3300048918 Bacteria 319734
178 Ga0496115_0000856 3300048918 Bacteria 22091
179 Ga0496115_0057528 3300048918 Bacteria 3128
180 Ga0501032_0432917 3300049569 Bacteria 843
181 Ga0501040_0510323 3300049576 Bacteria 867
182 Ga0501042_0557152 3300049578 Bacteria 833
183 Ga0501042_0862844 3300049578 Bacteria 659
184 Ga0501046_0186309 3300049580 Bacteria 1550
185 Ga0501047_0166261 3300049581 Bacteria 2076
186 Ga0501048_0597150 3300049582 Bacteria 792
187 Ga0501070_0085966 3300049586 Unclassified 2604
188 Ga0501070_0205969 3300049586 Unclassified 1615
189 Ga0501075_0000897 3300049591 Bacteria 18804
190 Ga0501077_0242383 3300049593 Bacteria 1146
191 Ga0501035_0004921 3300049822 Bacteria 12672
192 Ga0501044_0002890 3300049823 Bacteria 19564
193 Ga0495601_0062942 3300053077 Bacteria 2357
194 Ga0495601_0186011 3300053077 Bacteria 1358
195 Ga0495601_0190062 3300053077 Unclassified 1342
196 Ga0495612_0000295 3300053078 Bacteria 20271
197 Ga0495612_0161466 3300053078 Bacteria 978
198 Ga0495595_0001535 3300053084 Bacteria 9010
199 Ga0495619_0000516 3300053085 Bacteria 25730
200 Ga0495619_0000896 3300053085 Bacteria 19523
201 Ga0495619_0016176 3300053085 Bacteria 4722
202 Ga0495619_0936160 3300053085 Unclassified 582

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025938 Ga0207704_10169271 Ga0207704_101692712 129
2 3300005535 Ga0070684_100807724 Ga0070684_1008077242 133
3 3300017792 Ga0163161_10000013 Ga0163161_10000013266 134
4 3300046455 Ga0495603_0023891 Ga0495603_0023891_2092_2496 134
5 3300046463 Ga0495653_0067959 Ga0495653_0067959_1101_1544 134
6 3300046536 Ga0495587_0769021 Ga0495587_0769021_17_460 134
7 3300046663 Ga0495635_0000006 Ga0495635_0000006_146140_146583 134
8 3300046681 Ga0495647_0023862 Ga0495647_0023862_1689_2093 134
9 3300046690 Ga0495624_0030911 Ga0495624_0030911_2500_2943 134
10 3300053084 Ga0495595_0001535 Ga0495595_0001535_1108_1551 134
11 3300046514 Ga0495618_0000097 Ga0495618_0000097_12410_12853 135
12 3300046809 Ga0495600_0000893 Ga0495600_0000893_11597_12040 135
13 3300046516 Ga0495628_0006170 Ga0495628_0006170_8208_8651 136
14 3300046681 Ga0495647_0087355 Ga0495647_0087355_112_555 136
15 3300047322 Ga0495680_0000050 Ga0495680_0000050_23098_23631 136
16 3300047447 Ga0495685_206372 Ga0495685_206372_72_515 136
17 3300005615 Ga0070702_100249195 Ga0070702_1002491952 137
18 3300046616 Ga0495668_0349383 Ga0495668_0349383_107_553 137
19 3300009093 Ga0105240_10585645 Ga0105240_105856452 138
20 3300046615 Ga0495656_0007301 Ga0495656_0007301_1218_1634 138
21 3300053085 Ga0495619_0936160 Ga0495619_0936160_97_543 138
22 3300005338 Ga0068868_100586505 Ga0068868_1005865052 140
23 3300006028 Ga0070717_11331056 Ga0070717_113310561 141
24 3300048915 Ga0496112_0000002 Ga0496112_0000002_303658_304089 141
25 3300005339 Ga0070660_101802293 Ga0070660_1018022931 143
26 3300005434 Ga0070709_10054261 Ga0070709_100542612 143
27 3300005435 Ga0070714_100012275 Ga0070714_1000122753 143
28 3300005436 Ga0070713_100744006 Ga0070713_1007440061 143
29 3300005458 Ga0070681_10366583 Ga0070681_103665832 143
30 3300005535 Ga0070684_100714804 Ga0070684_1007148041 143
31 3300006028 Ga0070717_10282635 Ga0070717_102826352 143
32 3300006173 Ga0070716_100256963 Ga0070716_1002569632 143
33 3300009545 Ga0105237_10418913 Ga0105237_104189132 143
34 3300009545 Ga0105237_10727586 Ga0105237_107275862 143
35 3300013105 Ga0157369_10115894 Ga0157369_101158944 143
36 3300021388 Ga0213875_10044735 Ga0213875_100447353 143
37 3300025906 Ga0207699_10035542 Ga0207699_100355423 143
38 3300025928 Ga0207700_10087529 Ga0207700_100875292 143
39 3300025929 Ga0207664_10211965 Ga0207664_102119652 143
40 3300025939 Ga0207665_10256613 Ga0207665_102566132 143
41 3300025981 Ga0207640_10297511 Ga0207640_102975112 143
42 3300037853 Ga0436364_1461304 Ga0436364_1461304_5464_5898 143
43 3300044656 Ga0466969_0006190 Ga0466969_0006190_114_548 143
44 3300044693 Ga0466961_0643412 Ga0466961_0643412_53_487 143
45 3300044706 Ga0466964_0211614 Ga0466964_0211614_366_800 143
46 3300044735 Ga0466968_0012725 Ga0466968_0012725_1356_1790 143
47 3300044842 Ga0466957_0087435 Ga0466957_0087435_153_587 143
48 3300045049 Ga0466959_0007776 Ga0466959_0007776_5990_6424 143
49 3300045836 Ga0466958_0083662 Ga0466958_0083662_66_500 143
50 3300047321 Ga0495676_0693594 Ga0495676_0693594_201_632 143
51 3300048918 Ga0496115_0057528 Ga0496115_0057528_2647_3087 143
52 3300049569 Ga0501032_0432917 Ga0501032_0432917_147_581 143
53 3300049580 Ga0501046_0186309 Ga0501046_0186309_623_1057 143
54 3300049581 Ga0501047_0166261 Ga0501047_0166261_23_457 143
55 3300049582 Ga0501048_0597150 Ga0501048_0597150_253_687 143
56 3300049822 Ga0501035_0004921 Ga0501035_0004921_5456_5890 143
57 3300049823 Ga0501044_0002890 Ga0501044_0002890_374_808 143
58 3300002074 JGI24748J21848_1000323 JGI24748J21848_10003236 145
59 3300002239 JGI24034J26672_10000116 JGI24034J26672_100001162 145
60 3300046536 Ga0495587_0379727 Ga0495587_0379727_243_680 145
61 3300048917 Ga0496114_0000003 Ga0496114_0000003_26683_27120 145
62 3300048918 Ga0496115_0000856 Ga0496115_0000856_5283_5720 145
63 3300005364 Ga0070673_100003392 Ga0070673_1000033928 146
64 3300005444 Ga0070694_100887287 Ga0070694_1008872872 146
65 3300005841 Ga0068863_100044544 Ga0068863_1000445446 146
66 3300005841 Ga0068863_100050554 Ga0068863_1000505543 146
67 3300005843 Ga0068860_100214669 Ga0068860_1002146692 146
68 3300009101 Ga0105247_10207261 Ga0105247_102072612 146
69 3300009553 Ga0105249_10729400 Ga0105249_107294002 146
70 3300010375 Ga0105239_11227448 Ga0105239_112274482 146
71 3300013296 Ga0157374_10329406 Ga0157374_103294062 146
72 3300025960 Ga0207651_10001092 Ga0207651_100010928 146
73 3300025972 Ga0207668_10454233 Ga0207668_104542332 146
74 3300026088 Ga0207641_10001058 Ga0207641_1000105825 146
75 3300028381 Ga0268264_10159571 Ga0268264_101595712 146
76 3300046459 Ga0495629_0002409 Ga0495629_0002409_11937_12380 146
77 3300046536 Ga0495587_0004210 Ga0495587_0004210_2839_3279 146
78 3300046536 Ga0495587_0023048 Ga0495587_0023048_1815_2255 146
79 3300046539 Ga0495621_0145510 Ga0495621_0145510_347_787 146
80 3300047472 Ga0495686_0095312 Ga0495686_0095312_574_1014 146
81 3300048918 Ga0496115_0000004 Ga0496115_0000004_48255_48695 146
82 3300049578 Ga0501042_0557152 Ga0501042_0557152_273_713 146
83 3300049578 Ga0501042_0862844 Ga0501042_0862844_59_499 146
84 3300049586 Ga0501070_0205969 Ga0501070_0205969_954_1394 146
85 3300053085 Ga0495619_0000516 Ga0495619_0000516_8248_8688 146
86 3300001977 JGI24746J21847_1000183 JGI24746J21847_10001832 147
87 3300003322 rootL2_10300801 rootL2_103008012 147
88 3300005337 Ga0070682_101605355 Ga0070682_1016053551 147
89 3300005338 Ga0068868_100064867 Ga0068868_1000648673 147
90 3300005341 Ga0070691_10000186 Ga0070691_1000018616 147
91 3300005366 Ga0070659_100023363 Ga0070659_1000233635 147
92 3300005441 Ga0070700_100083676 Ga0070700_1000836763 147
93 3300005455 Ga0070663_100270847 Ga0070663_1002708471 147
94 3300005457 Ga0070662_100000079 Ga0070662_10000007943 147
95 3300005466 Ga0070685_10476903 Ga0070685_104769032 147
96 3300005530 Ga0070679_100000077 Ga0070679_10000007726 147
97 3300005539 Ga0068853_100003821 Ga0068853_1000038215 147
98 3300005544 Ga0070686_100122539 Ga0070686_1001225392 147
99 3300005545 Ga0070695_100121880 Ga0070695_1001218802 147
100 3300005547 Ga0070693_100001830 Ga0070693_1000018303 147
101 3300005616 Ga0068852_100384091 Ga0068852_1003840912 147
102 3300005841 Ga0068863_100000039 Ga0068863_100000039105 147
103 3300005843 Ga0068860_100412242 Ga0068860_1004122422 147
104 3300005983 Ga0081540_1000044 Ga0081540_100004476 147
105 3300005983 Ga0081540_1064001 Ga0081540_10640011 147
106 3300005985 Ga0081539_10003996 Ga0081539_100039963 147
107 3300006237 Ga0097621_100172691 Ga0097621_1001726912 147
108 3300006358 Ga0068871_100375275 Ga0068871_1003752752 147
109 3300013296 Ga0157374_10001271 Ga0157374_1000127117 147
110 3300013296 Ga0157374_10064641 Ga0157374_100646413 147
111 3300013308 Ga0157375_10084939 Ga0157375_100849393 147
112 3300014325 Ga0163163_11356067 Ga0163163_113560672 147
113 3300014745 Ga0157377_10522768 Ga0157377_105227682 147
114 3300014968 Ga0157379_10172643 Ga0157379_101726432 147
115 3300025921 Ga0207652_10000138 Ga0207652_1000013826 147
116 3300025932 Ga0207690_10015393 Ga0207690_100153933 147
117 3300025933 Ga0207706_10000302 Ga0207706_1000030218 147
118 3300025961 Ga0207712_10000003 Ga0207712_10000003143 147
119 3300026023 Ga0207677_10000426 Ga0207677_100004263 147
120 3300026041 Ga0207639_10000838 Ga0207639_1000083817 147
121 3300026067 Ga0207678_10292840 Ga0207678_102928402 147
122 3300026075 Ga0207708_10113230 Ga0207708_101132302 147
123 3300026088 Ga0207641_10000065 Ga0207641_100000658 147
124 3300026142 Ga0207698_10493693 Ga0207698_104936931 147
125 3300028556 Ga0265337_1000074 Ga0265337_10000742 147
126 3300028558 Ga0265326_10000035 Ga0265326_1000003571 147
127 3300028563 Ga0265319_1000091 Ga0265319_100009121 147
128 3300028654 Ga0265322_10000009 Ga0265322_10000009152 147
129 3300028666 Ga0265336_10100582 Ga0265336_101005822 147
130 3300028666 Ga0265336_10114964 Ga0265336_101149642 147
131 3300028800 Ga0265338_10000752 Ga0265338_1000075221 147
132 3300029957 Ga0265324_10000168 Ga0265324_1000016851 147
133 3300031238 Ga0265332_10018941 Ga0265332_100189413 147
134 3300031239 Ga0265328_10002915 Ga0265328_100029154 147
135 3300031240 Ga0265320_10000024 Ga0265320_1000002423 147
136 3300031241 Ga0265325_10027934 Ga0265325_100279342 147
137 3300031242 Ga0265329_10002105 Ga0265329_100021054 147
138 3300031250 Ga0265331_10031178 Ga0265331_100311782 147
139 3300031251 Ga0265327_10000227 Ga0265327_1000022724 147
140 3300031344 Ga0265316_10036209 Ga0265316_100362093 147
141 3300031711 Ga0265314_10001556 Ga0265314_1000155623 147
142 3300031712 Ga0265342_10172176 Ga0265342_101721762 147
143 3300032133 Ga0316583_10042421 Ga0316583_100424212 147
144 3300035172 Ga0373955_0148777 Ga0373955_0148777_155_598 147
145 3300035724 Ga0373933_0217870 Ga0373933_0217870_638_1081 147
146 3300036401 Ga0373937_0218406 Ga0373937_0218406_855_1298 147
147 3300041505 Ga0451849_1315595 Ga0451849_1315595_198_641 147
148 3300044684 Ga0466966_0097868 Ga0466966_0097868_1285_1728 147
149 3300044693 Ga0466961_0075975 Ga0466961_0075975_421_864 147
150 3300044901 Ga0466960_0475318 Ga0466960_0475318_97_546 147
151 3300045049 Ga0466959_0020523 Ga0466959_0020523_2745_3188 147
152 3300045976 Ga0466967_0169767 Ga0466967_0169767_335_781 147
153 3300046454 Ga0495592_0000401 Ga0495592_0000401_3011_3454 147
154 3300046459 Ga0495629_0089001 Ga0495629_0089001_1677_2120 147
155 3300046460 Ga0495638_0008706 Ga0495638_0008706_299_742 147
156 3300046461 Ga0495641_0095862 Ga0495641_0095862_852_1295 147
157 3300046475 Ga0495639_0025000 Ga0495639_0025000_1355_1801 147
158 3300046499 Ga0495594_0000345 Ga0495594_0000345_7606_8049 147
159 3300046511 Ga0495608_0001938 Ga0495608_0001938_3398_3841 147
160 3300046514 Ga0495618_0183065 Ga0495618_0183065_297_740 147
161 3300046515 Ga0495620_0000158 Ga0495620_0000158_13338_13781 147
162 3300046516 Ga0495628_0042129 Ga0495628_0042129_217_660 147
163 3300046516 Ga0495628_0265824 Ga0495628_0265824_688_1134 147
164 3300046517 Ga0495630_0000011 Ga0495630_0000011_15503_15946 147
165 3300046517 Ga0495630_0000082 Ga0495630_0000082_39070_39516 147
166 3300046517 Ga0495630_0001301 Ga0495630_0001301_79_522 147
167 3300046523 Ga0495644_0000404 Ga0495644_0000404_8197_8640 147
168 3300046536 Ga0495587_0097690 Ga0495587_0097690_514_960 147
169 3300046536 Ga0495587_0433537 Ga0495587_0433537_133_579 147
170 3300046537 Ga0495598_0000798 Ga0495598_0000798_75_518 147
171 3300046538 Ga0495609_0409156 Ga0495609_0409156_18_461 147
172 3300046539 Ga0495621_0000793 Ga0495621_0000793_7520_7969 147
173 3300046559 Ga0495667_0000053 Ga0495667_0000053_60628_61074 147
174 3300046642 Ga0495634_0046338 Ga0495634_0046338_1718_2164 147
175 3300046660 Ga0495625_0000095 Ga0495625_0000095_118880_119323 147
176 3300046663 Ga0495635_0056023 Ga0495635_0056023_1492_1938 147
177 3300046675 Ga0495657_0079479 Ga0495657_0079479_512_958 147
178 3300046678 Ga0495599_0217813 Ga0495599_0217813_37_480 147
179 3300046683 Ga0495658_0530698 Ga0495658_0530698_44_487 147
180 3300046690 Ga0495624_0000049 Ga0495624_0000049_45660_46103 147
181 3300047315 Ga0495581_0099270 Ga0495581_0099270_1044_1487 147
182 3300047317 Ga0495604_0000038 Ga0495604_0000038_11478_11927 147
183 3300047322 Ga0495680_0007552 Ga0495680_0007552_3308_3754 147
184 3300047322 Ga0495680_0293720 Ga0495680_0293720_319_765 147
185 3300047322 Ga0495680_0769272 Ga0495680_0769272_145_591 147
186 3300047471 Ga0495684_0025020 Ga0495684_0025020_1830_2276 147
187 3300047472 Ga0495686_0185859 Ga0495686_0185859_737_1180 147
188 3300047673 Ga0495593_0023550 Ga0495593_0023550_2701_3144 147
189 3300048905 Ga0496102_0000132 Ga0496102_0000132_45762_46205 147
190 3300048906 Ga0496103_0000077 Ga0496103_0000077_56960_57403 147
191 3300048917 Ga0496114_0015360 Ga0496114_0015360_2030_2476 147
192 3300049576 Ga0501040_0510323 Ga0501040_0510323_376_819 147
193 3300049586 Ga0501070_0085966 Ga0501070_0085966_1086_1529 147
194 3300049591 Ga0501075_0000897 Ga0501075_0000897_14961_15404 147
195 3300049593 Ga0501077_0242383 Ga0501077_0242383_689_1132 147
196 3300053077 Ga0495601_0062942 Ga0495601_0062942_1361_1807 147
197 3300053077 Ga0495601_0186011 Ga0495601_0186011_690_1133 147
198 3300053077 Ga0495601_0190062 Ga0495601_0190062_29_475 147
199 3300053078 Ga0495612_0000295 Ga0495612_0000295_17275_17718 147
200 3300053078 Ga0495612_0161466 Ga0495612_0161466_433_879 147
201 3300053085 Ga0495619_0000896 Ga0495619_0000896_773_1219 147
202 3300053085 Ga0495619_0016176 Ga0495619_0016176_744_1190 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

13

155

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tmu-assembly4.cif.gz_D crystal structure of the protein of unknown function ypo0625 from yersinia pestis 0.8777 2 137
3neg-assembly2.cif.gz_B pyrabactin-bound pyl1 structure in the open and close forms 0.856 2 141
4n0g-assembly2.cif.gz_D crystal structure of pyl13-pp2ca complex 0.8501 2 141
5gwp-assembly2.cif.gz_D crystal structure of rcar3:pp2c wild-type with (+)-aba 0.8495 2 141
3oqu-assembly1.cif.gz_A crystal structure of native abscisic acid receptor pyl9 with aba 0.8484 2 143
ID Description Score Start End Superfamily
af_O53961_7_149_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9489 4 140 3.30.530.20
af_O53961_7_149_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9044 4 140 3.30.530.20
af_Q10MS2_34_228_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8723 2 143 3.30.530.20
af_A0A1D8PNQ2_25_168_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.868 2 141 3.30.530.20
af_L7N657_19_160_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.848 4 141 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A838V9E5-F1-model_v4 SRPBCC family protein 0.9861 1 143
AF-A0A0U1D4A6-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9825 3 143
AF-A0A0U0W9J4-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport 0.9758 1 114
AF-W5WD03-F1-model_v4 Polyketide cyclase/dehydrase 0.971 1 143
AF-A0A1X0I271-F1-model_v4 MxaD family protein 0.9699 1 143

Feature Viewer

pLDDT pTM Quality
93.29 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map