F309064

General Info

Members Datasets Scaffolds Average Seq Length
201 137 402 97

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0040626|Ga0501046_0040626_695_1027
Length 110
Sequence MIAAALIHTITIMRLSRLSEDEIQLALGGLKNWQVMDGKLHREYRFPDFVHAFGFMATSAIAIEKRNHHPEWSNVYNRVVVNLTTHDSGGITQNDVDLAKLLDSIAEKLQ

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
7 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
62 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
63 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
64 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
65 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
66 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
67 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
69 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
95 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
99 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
115 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
116 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
117 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
118 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
119 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
122 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
123 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
134 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
135 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 1
Rhizosphere 94.03
Stem 0
Stem Tuber 0
Unclassified 13.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0040626 3300049580 Bacteria 3716
2 Ga0070677_10379386 3300005333 Bacteria 740
3 Ga0068869_100662258 3300005334 Bacteria 887
4 Ga0070714_100014070 3300005435 Bacteria 6420
5 Ga0070714_101241847 3300005435 Unclassified 727
6 Ga0070713_100000671 3300005436 Bacteria 21916
7 Ga0070713_100312119 3300005436 Bacteria 1450
8 Ga0070711_100018507 3300005439 Bacteria 4451
9 Ga0070705_100163365 3300005440 Bacteria 1491
10 Ga0070700_101622370 3300005441 Bacteria 553
11 Ga0070694_101737686 3300005444 Bacteria 531
12 Ga0070708_100883590 3300005445 Bacteria 839
13 Ga0070681_10369490 3300005458 Bacteria 1345
14 Ga0068867_101107035 3300005459 Unclassified 723
15 Ga0068867_101391857 3300005459 Bacteria 650
16 Ga0070706_100961472 3300005467 Bacteria 788
17 Ga0070679_101785222 3300005530 Bacteria 563
18 Ga0070672_101265673 3300005543 Bacteria 658
19 Ga0070665_100206912 3300005548 Unclassified 1963
20 Ga0070665_100229867 3300005548 Bacteria 1855
21 Ga0070665_100587936 3300005548 Bacteria 1126
22 Ga0070704_100152198 3300005549 Bacteria 1820
23 Ga0070704_101586824 3300005549 Unclassified 603
24 Ga0068859_101400152 3300005617 Unclassified 771
25 Ga0068859_101578269 3300005617 Bacteria 725
26 Ga0068859_103131865 3300005617 Bacteria 504
27 Ga0068861_100908815 3300005719 Bacteria 834
28 Ga0068863_100338268 3300005841 Unclassified 1464
29 Ga0068860_102644036 3300005843 Bacteria 521
30 Ga0070717_10096436 3300006028 Unclassified 2505
31 Ga0070717_10291560 3300006028 Bacteria 1449
32 Ga0070717_11093152 3300006028 Bacteria 726
33 Ga0070716_100315330 3300006173 Bacteria 1093
34 Ga0068871_101243210 3300006358 Bacteria 699
35 Ga0068871_101286801 3300006358 Unclassified 687
36 Ga0075430_100089230 3300006846 Bacteria 2580
37 Ga0075431_100015376 3300006847 Bacteria 7755
38 Ga0075433_10547929 3300006852 Bacteria 1017
39 Ga0075429_100569296 3300006880 Bacteria 993
40 Ga0097620_101400162 3300006931 Unclassified 771
41 Ga0097620_101578445 3300006931 Bacteria 725
42 Ga0097620_103131522 3300006931 Bacteria 504
43 Ga0075435_101534839 3300007076 Bacteria 584
44 Ga0105240_10016781 3300009093 Bacteria 9901
45 Ga0105240_10024068 3300009093 Bacteria 8039
46 Ga0114129_11624780 3300009147 Bacteria 791
47 Ga0114129_11946603 3300009147 Bacteria 712
48 Ga0105243_10985963 3300009148 Bacteria 844
49 Ga0105243_11989769 3300009148 Bacteria 615
50 Ga0105248_10061783 3300009177 Bacteria 4207
51 Ga0105248_10280057 3300009177 Bacteria 1877
52 Ga0105237_10124194 3300009545 Bacteria 2576
53 Ga0105237_12190115 3300009545 Bacteria 562
54 Ga0105238_10328300 3300009551 Bacteria 1516
55 Ga0105239_10220642 3300010375 Bacteria 2126
56 Ga0157370_10077911 3300013104 Bacteria 3122
57 Ga0157378_12540787 3300013297 Bacteria 564
58 Ga0163162_10993523 3300013306 Bacteria 949
59 Ga0163162_12006533 3300013306 Bacteria 663
60 Ga0157375_10867889 3300013308 Unclassified 1048
61 Ga0163163_10326720 3300014325 Bacteria 1588
62 Ga0163163_10630995 3300014325 Bacteria 1135
63 Ga0163163_11164503 3300014325 Bacteria 834
64 Ga0163163_12526089 3300014325 Bacteria 572
65 Ga0157380_10096444 3300014326 Bacteria 2452
66 Ga0157380_10182860 3300014326 Unclassified 1843
67 Ga0157380_11407873 3300014326 Unclassified 748
68 Ga0157379_10060413 3300014968 Bacteria 3389
69 Ga0157379_11486652 3300014968 Bacteria 659
70 Ga0157376_12862246 3300014969 Unclassified 522
71 Ga0213875_10015458 3300021388 Bacteria 3713
72 Ga0213875_10134011 3300021388 Bacteria 1158
73 Ga0213875_10236006 3300021388 Bacteria 862
74 Ga0207699_10010023 3300025906 Bacteria 4739
75 Ga0207699_10200007 3300025906 Bacteria 1353
76 Ga0207695_10070835 3300025913 Bacteria 3562
77 Ga0207695_10216191 3300025913 Bacteria 1826
78 Ga0207663_10013349 3300025916 Bacteria 4463
79 Ga0207694_11139033 3300025924 Bacteria 660
80 Ga0207700_10001522 3300025928 Bacteria 13124
81 Ga0207664_10013568 3300025929 Bacteria 5854
82 Ga0207664_10142411 3300025929 Bacteria 2030
83 Ga0207664_10451018 3300025929 Bacteria 1148
84 Ga0207665_10293111 3300025939 Unclassified 1214
85 Ga0207665_11609459 3300025939 Bacteria 515
86 Ga0207711_10046738 3300025941 Bacteria 3699
87 Ga0207711_10828133 3300025941 Bacteria 862
88 Ga0207689_10658496 3300025942 Bacteria 882
89 Ga0207641_10368632 3300026088 Unclassified 1373
90 Ga0207648_11997098 3300026089 Unclassified 541
91 Ga0207676_12319796 3300026095 Bacteria 534
92 Ga0268266_10066271 3300028379 Bacteria 3123
93 Ga0265325_10001883 3300031241 Bacteria 14480
94 Ga0265325_10084280 3300031241 Bacteria 1576
95 Ga0316579_10057194 3300031691 Unclassified 1832
96 Ga0316577_10054265 3300031733 Bacteria 2237
97 Ga0373926_0176676 3300035083 Unclassified 818
98 Ga0373934_0065451 3300035086 Bacteria 1451
99 Ga0373944_0270517 3300035089 Bacteria 631
100 Ga0373923_0016531 3300035111 Bacteria 2806
101 Ga0373936_0322035 3300035113 Bacteria 700
102 Ga0373941_0447963 3300035115 Bacteria 541
103 Ga0373945_0010776 3300035116 Unclassified 3013
104 Ga0373954_0025621 3300035118 Bacteria 2698
105 Ga0373954_0131956 3300035118 Bacteria 1216
106 Ga0373956_0179030 3300035119 Bacteria 1002
107 Ga0373956_0242167 3300035119 Bacteria 857
108 Ga0373943_0652732 3300035170 Bacteria 622
109 Ga0373955_0402156 3300035172 Bacteria 832
110 Ga0373935_0328804 3300035692 Bacteria 1086
111 Ga0373927_0000717 3300035695 Bacteria 25359
112 Ga0373927_0020749 3300035695 Unclassified 4308
113 Ga0373927_0125434 3300035695 Bacteria 1676
114 Ga0373927_0242539 3300035695 Bacteria 1184
115 Ga0373933_0097033 3300035724 Bacteria 1825
116 Ga0373933_0662630 3300035724 Bacteria 686
117 Ga0373947_0000449 3300035725 Bacteria 23433
118 Ga0373947_0055564 3300035725 Unclassified 2391
119 Ga0373947_0939065 3300035725 Bacteria 590
120 Ga0373937_0004947 3300036401 Bacteria 11329
121 Ga0373937_0050749 3300036401 Bacteria 3801
122 Ga0373937_1491752 3300036401 Bacteria 624
123 Ga0316584_0285627 3300036712 Unclassified 1198
124 Ga0373925_0000027 3300037068 Bacteria 154706
125 Ga0373925_0023508 3300037068 Bacteria 4498
126 Ga0373925_0442199 3300037068 Bacteria 1064
127 Ga0395900_0861071 3300037418 Bacteria 831
128 Ga0436364_0754333 3300037853 Bacteria 5199
129 Ga0436364_0920446 3300037853 Bacteria 1683
130 Ga0436364_1286504 3300037853 Bacteria 1570
131 Ga0436364_1311648 3300037853 Bacteria 664
132 Ga0436365_0743436 3300039437 Bacteria 1118
133 Ga0451837_1376509 3300041494 Bacteria 731
134 Ga0466963_0924330 3300044694 Bacteria 615
135 Ga0495580_0770979 3300046472 Bacteria 625
136 Ga0495662_0307020 3300046476 Unclassified 780
137 Ga0495664_0183174 3300046477 Bacteria 1270
138 Ga0495608_0198539 3300046511 Bacteria 1265
139 Ga0495628_0288427 3300046516 Bacteria 1217
140 Ga0495630_0346289 3300046517 Bacteria 1137
141 Ga0495630_0526713 3300046517 Bacteria 906
142 Ga0495667_0144102 3300046559 Bacteria 1535
143 Ga0495634_0440091 3300046642 Unclassified 770
144 Ga0495624_0004824 3300046690 Bacteria 9806
145 Ga0495636_0093861 3300047318 Bacteria 1305
146 Ga0495674_1210429 3300047319 Bacteria 570
147 Ga0495675_0528333 3300047444 Bacteria 675
148 Ga0495684_0133898 3300047471 Bacteria 1860
149 Ga0495593_0501951 3300047673 Bacteria 608
150 Ga0495602_0118701 3300048088 Bacteria 2133
151 Ga0495602_0862061 3300048088 Bacteria 605
152 Ga0496104_0711841 3300048907 Bacteria 912
153 Ga0496106_0971605 3300048909 Bacteria 669
154 Ga0501031_0004510 3300049568 Bacteria 9032
155 Ga0501032_0001438 3300049569 Bacteria 18907
156 Ga0501033_0003120 3300049570 Bacteria 13765
157 Ga0501034_0157686 3300049571 Bacteria 2242
158 Ga0501034_0756823 3300049571 Unclassified 867
159 Ga0501034_1034351 3300049571 Bacteria 704
160 Ga0501036_0000315 3300049572 Bacteria 33767
161 Ga0501037_0002720 3300049573 Bacteria 12784
162 Ga0501038_0004646 3300049574 Bacteria 12784
163 Ga0501039_0011894 3300049575 Bacteria 6633
164 Ga0501043_0005471 3300049579 Bacteria 10262
165 Ga0501043_0899557 3300049579 Bacteria 635
166 Ga0501046_0001558 3300049580 Bacteria 21891
167 Ga0501046_1208814 3300049580 Unclassified 519
168 Ga0501047_0120538 3300049581 Bacteria 2505
169 Ga0501047_0123918 3300049581 Bacteria 2464
170 Ga0501048_0030025 3300049582 Bacteria 3937
171 Ga0501067_0011705 3300049583 Bacteria 4860
172 Ga0501068_0001420 3300049584 Bacteria 12729
173 Ga0501070_0012934 3300049586 Bacteria 7033
174 Ga0501070_0037888 3300049586 Bacteria 4024
175 Ga0501072_0003098 3300049588 Bacteria 12530
176 Ga0501073_0003728 3300049589 Bacteria 11445
177 Ga0501073_0466712 3300049589 Unclassified 873
178 Ga0501074_0043075 3300049590 Bacteria 3266
179 Ga0501076_0038581 3300049592 Bacteria 3750
180 Ga0501079_0000528 3300049741 Bacteria 24901
181 Ga0501080_0000017 3300049742 Bacteria 96079
182 Ga0501081_0623370 3300049743 Unclassified 808
183 Ga0501083_0004818 3300049744 Bacteria 9537
184 Ga0501035_0132438 3300049822 Bacteria 2172
185 Ga0501035_0295484 3300049822 Bacteria 1366
186 Ga0501044_0007708 3300049823 Bacteria 11840
187 Ga0501044_0008607 3300049823 Bacteria 11173
188 Ga0501044_0020230 3300049823 Bacteria 7103
189 Ga0501044_0646485 3300049823 Bacteria 947
190 Ga0501045_0997058 3300049824 Bacteria 614
191 nmdc:mga05p37_880446_c1 3300050507 Bacteria 968
192 nmdc:mga09592_410956_c1 3300050508 Bacteria 1169
193 nmdc:mga0qj67_28244_c2 3300050509 Bacteria 1685
194 nmdc:mga06r32_501754_c1 3300050510 Bacteria 1190
195 nmdc:mga0n895_2071015_c1 3300050512 Bacteria 526
196 nmdc:mga0rr50_1433456_c1 3300050513 Bacteria 584
197 nmdc:mga0a205_366692_c1 3300050515 Bacteria 1306
198 Ga0500604_0020491 3300053151 Bacteria 1862
199 Ga0501084_0000152 3300054114 Bacteria 52780
200 Ga0501084_1467067 3300054114 Bacteria 571
201 Ga0501082_0008652 3300060353 Bacteria 8775
202 Ga0501046_0040626
203 Ga0070677_10379386
204 Ga0068869_100662258
205 Ga0070714_100014070
206 Ga0070714_101241847
207 Ga0070713_100000671
208 Ga0070713_100312119
209 Ga0070711_100018507
210 Ga0070705_100163365
211 Ga0070700_101622370
212 Ga0070694_101737686
213 Ga0070708_100883590
214 Ga0070681_10369490
215 Ga0068867_101107035
216 Ga0068867_101391857
217 Ga0070706_100961472
218 Ga0070679_101785222
219 Ga0070672_101265673
220 Ga0070665_100206912
221 Ga0070665_100229867
222 Ga0070665_100587936
223 Ga0070704_100152198
224 Ga0070704_101586824
225 Ga0068859_101400152
226 Ga0068859_101578269
227 Ga0068859_103131865
228 Ga0068861_100908815
229 Ga0068863_100338268
230 Ga0068860_102644036
231 Ga0070717_10096436
232 Ga0070717_10291560
233 Ga0070717_11093152
234 Ga0070716_100315330
235 Ga0068871_101243210
236 Ga0068871_101286801
237 Ga0075430_100089230
238 Ga0075431_100015376
239 Ga0075433_10547929
240 Ga0075429_100569296
241 Ga0097620_101400162
242 Ga0097620_101578445
243 Ga0097620_103131522
244 Ga0075435_101534839
245 Ga0105240_10016781
246 Ga0105240_10024068
247 Ga0114129_11624780
248 Ga0114129_11946603
249 Ga0105243_10985963
250 Ga0105243_11989769
251 Ga0105248_10061783
252 Ga0105248_10280057
253 Ga0105237_10124194
254 Ga0105237_12190115
255 Ga0105238_10328300
256 Ga0105239_10220642
257 Ga0157370_10077911
258 Ga0157378_12540787
259 Ga0163162_10993523
260 Ga0163162_12006533
261 Ga0157375_10867889
262 Ga0163163_10326720
263 Ga0163163_10630995
264 Ga0163163_11164503
265 Ga0163163_12526089
266 Ga0157380_10096444
267 Ga0157380_10182860
268 Ga0157380_11407873
269 Ga0157379_10060413
270 Ga0157379_11486652
271 Ga0157376_12862246
272 Ga0213875_10015458
273 Ga0213875_10134011
274 Ga0213875_10236006
275 Ga0207699_10010023
276 Ga0207699_10200007
277 Ga0207695_10070835
278 Ga0207695_10216191
279 Ga0207663_10013349
280 Ga0207694_11139033
281 Ga0207700_10001522
282 Ga0207664_10013568
283 Ga0207664_10142411
284 Ga0207664_10451018
285 Ga0207665_10293111
286 Ga0207665_11609459
287 Ga0207711_10046738
288 Ga0207711_10828133
289 Ga0207689_10658496
290 Ga0207641_10368632
291 Ga0207648_11997098
292 Ga0207676_12319796
293 Ga0268266_10066271
294 Ga0265325_10001883
295 Ga0265325_10084280
296 Ga0316579_10057194
297 Ga0316577_10054265
298 Ga0373926_0176676
299 Ga0373934_0065451
300 Ga0373944_0270517
301 Ga0373923_0016531
302 Ga0373936_0322035
303 Ga0373941_0447963
304 Ga0373945_0010776
305 Ga0373954_0025621
306 Ga0373954_0131956
307 Ga0373956_0179030
308 Ga0373956_0242167
309 Ga0373943_0652732
310 Ga0373955_0402156
311 Ga0373935_0328804
312 Ga0373927_0000717
313 Ga0373927_0020749
314 Ga0373927_0125434
315 Ga0373927_0242539
316 Ga0373933_0097033
317 Ga0373933_0662630
318 Ga0373947_0000449
319 Ga0373947_0055564
320 Ga0373947_0939065
321 Ga0373937_0004947
322 Ga0373937_0050749
323 Ga0373937_1491752
324 Ga0316584_0285627
325 Ga0373925_0000027
326 Ga0373925_0023508
327 Ga0373925_0442199
328 Ga0395900_0861071
329 Ga0436364_0754333
330 Ga0436364_0920446
331 Ga0436364_1286504
332 Ga0436364_1311648
333 Ga0436365_0743436
334 Ga0451837_1376509
335 Ga0466963_0924330
336 Ga0495580_0770979
337 Ga0495662_0307020
338 Ga0495664_0183174
339 Ga0495608_0198539
340 Ga0495628_0288427
341 Ga0495630_0346289
342 Ga0495630_0526713
343 Ga0495667_0144102
344 Ga0495634_0440091
345 Ga0495624_0004824
346 Ga0495636_0093861
347 Ga0495674_1210429
348 Ga0495675_0528333
349 Ga0495684_0133898
350 Ga0495593_0501951
351 Ga0495602_0118701
352 Ga0495602_0862061
353 Ga0496104_0711841
354 Ga0496106_0971605
355 Ga0501031_0004510
356 Ga0501032_0001438
357 Ga0501033_0003120
358 Ga0501034_0157686
359 Ga0501034_0756823
360 Ga0501034_1034351
361 Ga0501036_0000315
362 Ga0501037_0002720
363 Ga0501038_0004646
364 Ga0501039_0011894
365 Ga0501043_0005471
366 Ga0501043_0899557
367 Ga0501046_0001558
368 Ga0501046_1208814
369 Ga0501047_0120538
370 Ga0501047_0123918
371 Ga0501048_0030025
372 Ga0501067_0011705
373 Ga0501068_0001420
374 Ga0501070_0012934
375 Ga0501070_0037888
376 Ga0501072_0003098
377 Ga0501073_0003728
378 Ga0501073_0466712
379 Ga0501074_0043075
380 Ga0501076_0038581
381 Ga0501079_0000528
382 Ga0501080_0000017
383 Ga0501081_0623370
384 Ga0501083_0004818
385 Ga0501035_0132438
386 Ga0501035_0295484
387 Ga0501044_0007708
388 Ga0501044_0008607
389 Ga0501044_0020230
390 Ga0501044_0646485
391 Ga0501045_0997058
392 nmdc:mga05p37_880446_c1
393 nmdc:mga09592_410956_c1
394 nmdc:mga0qj67_28244_c2
395 nmdc:mga06r32_501754_c1
396 nmdc:mga0n895_2071015_c1
397 nmdc:mga0rr50_1433456_c1
398 nmdc:mga0a205_366692_c1
399 Ga0500604_0020491
400 Ga0501084_0000152
401 Ga0501084_1467067
402 Ga0501082_0008652

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01329

Pterin_4a

Pterin 4 alpha carbinolamine dehydratase

16

105

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jst-assembly2.cif.gz_B crystal structure of transcriptional coactivator/pterin dehydratase from brucella melitensis 0.9719 3 92
2ebb-assembly1.cif.gz_A-2 crystal structure of pterin-4-alpha-carbinolamine dehydratase (pterin carbinolamine dehydratase) from geobacillus kaustophilus hta426 0.9669 3 96
1ru0-assembly1.cif.gz_A crystal structure of dcoh2, a paralog of dcoh, the dimerization cofactor of hnf-1 0.9409 3 94
4wil-assembly1.cif.gz_A crystal structure of dcoh2 s51t 0.9402 3 94
3hxa-assembly1.cif.gz_D crystal structure of dcoh1thr51ser 0.9398 3 94
ID Description Score Start End Superfamily
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9717 1 91 3.30.1360.20
af_Q4CYK3_54_151_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9695 1 91 3.30.1360.20
2ebbA00 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9669 3 96 3.30.1360.20
af_Q5ACY8_6_110_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9589 1 91 3.30.1360.20
af_P9WI93_1_93_3.30.1360.20 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Transcriptional coactivator/pterin dehydratase 0.9415 1 91 3.30.1360.20
ID Description Score Start End GO Terms
AF-A0RWH7-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 1.001 2 91 GO:0006729
GO:0008124
AF-A0A539D1F9-F1-model_v4 4a-hydroxytetrahydrobiopterin dehydratase (EC 4.2.1.96) 1.001 21 96 GO:0006729
GO:0008124
AF-A0A7C5I899-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 1 3 96 GO:0006729
GO:0008124
AF-A0A832SG50-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9999 1 91 GO:0006729
GO:0008124
AF-K0BAK0-F1-model_v4 Putative pterin-4-alpha-carbinolamine dehydratase (PHS) (EC 4.2.1.96) (4-alpha-hydroxy-tetrahydropterin dehydratase) (Pterin carbinolamine dehydratase) (PCD) 0.9998 3 91 GO:0006729
GO:0008124

Map