F308642

General Info

Members Datasets Scaffolds Average Seq Length
201 120 402 209

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10025661|Ga0265323_100256612
Length 212
Sequence VLIRVHCRSNMCAMIPAEESELITRCRRGEAKAWDELFDLHYAAAGRFIFQLSSDFTREDTEEICQEVFLSVIKNLDSFHGGSRFQTWLFRIAANKARDYREMRMAAKRGGGRTTVSLQAEDPETGLAPEDEFLMNAEQMAGVRAALDRLGEPCREIIELRYFGDLSYEELSATLKLNPKTVSSRLSKCLDRLEEAARGIFTRENPGGFPSN

Samples

Sample ID Description Type Environment
1 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
17 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
52 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
53 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
54 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
55 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
58 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
59 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
68 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
69 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
71 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
72 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
73 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
78 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
79 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
84 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
85 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
86 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
97 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
98 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
101 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
119 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
120 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 1
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 31.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265323_10025661 3300028653 Bacteria 2227
2 rootH1_10021352 3300003323 Bacteria 3521
3 Ga0070660_100129294 3300005339 Bacteria 2020
4 Ga0070713_100997773 3300005436 Unclassified 808
5 Ga0070701_10396858 3300005438 Unclassified 873
6 Ga0070681_10071997 3300005458 Unclassified 3420
7 Ga0070681_10587581 3300005458 Unclassified 1028
8 Ga0070707_100242471 3300005468 Bacteria 1754
9 Ga0070679_100941075 3300005530 Unclassified 808
10 Ga0070693_100217388 3300005547 Bacteria 1250
11 Ga0068855_100045696 3300005563 Bacteria 5179
12 Ga0068857_100279995 3300005577 Bacteria 1534
13 Ga0068856_100171280 3300005614 Unclassified 2183
14 Ga0068856_100349943 3300005614 Bacteria 1496
15 Ga0070702_100082100 3300005615 Unclassified 1933
16 Ga0068859_100297797 3300005617 Bacteria 1706
17 Ga0068864_100088306 3300005618 Bacteria 2731
18 Ga0068863_100010140 3300005841 Bacteria 9162
19 Ga0068863_100887805 3300005841 Unclassified 891
20 Ga0068858_100958210 3300005842 Unclassified 838
21 Ga0081455_10285955 3300005937 Bacteria 1189
22 Ga0097621_100009753 3300006237 Bacteria 6989
23 Ga0097621_100591733 3300006237 Unclassified 1013
24 Ga0068871_100031155 3300006358 Bacteria 4203
25 Ga0068871_101197942 3300006358 Unclassified 712
26 Ga0075434_101152717 3300006871 Bacteria 788
27 Ga0068865_100214003 3300006881 Bacteria 1503
28 Ga0075436_100182036 3300006914 Bacteria 1485
29 Ga0097620_100297811 3300006931 Bacteria 1706
30 Ga0075435_100074115 3300007076 Unclassified 2784
31 Ga0099794_10154934 3300007265 Bacteria 1164
32 Ga0099794_10258921 3300007265 Bacteria 898
33 Ga0105240_10047843 3300009093 Bacteria 5409
34 Ga0105240_10059976 3300009093 Unclassified 4745
35 Ga0105240_10210745 3300009093 Bacteria 2271
36 Ga0105240_10896346 3300009093 Unclassified 954
37 Ga0105241_10086278 3300009174 Unclassified 2468
38 Ga0105241_10162478 3300009174 Bacteria 1837
39 Ga0105241_10776647 3300009174 Bacteria 881
40 Ga0105242_10176198 3300009176 Bacteria 1883
41 Ga0105242_10449350 3300009176 Unclassified 1214
42 Ga0105242_10550008 3300009176 Unclassified 1107
43 Ga0105248_10495660 3300009177 Unclassified 1377
44 Ga0105238_10062515 3300009551 Bacteria 3724
45 Ga0105238_10147645 3300009551 Unclassified 2327
46 Ga0105239_11367961 3300010375 Bacteria 817
47 Ga0105246_11014143 3300011119 Unclassified 752
48 Ga0157374_10407452 3300013296 Unclassified 1357
49 Ga0157374_11496035 3300013296 Bacteria 698
50 Ga0157378_10136628 3300013297 Bacteria 2273
51 Ga0157378_11157213 3300013297 Unclassified 812
52 Ga0157372_10398521 3300013307 Unclassified 1604
53 Ga0163163_10022907 3300014325 Bacteria 5921
54 Ga0157376_10113602 3300014969 Unclassified 2388
55 Ga0157376_10474822 3300014969 Unclassified 1224
56 Ga0207654_10171666 3300025911 Bacteria 1408
57 Ga0207707_10038266 3300025912 Unclassified 4192
58 Ga0207707_10938522 3300025912 Unclassified 713
59 Ga0207695_10102788 3300025913 Unclassified 2850
60 Ga0207695_10252415 3300025913 Bacteria 1663
61 Ga0207695_10683910 3300025913 Bacteria 907
62 Ga0207652_10292614 3300025921 Unclassified 1469
63 Ga0207646_10245129 3300025922 Bacteria 1619
64 Ga0207664_10621677 3300025929 Bacteria 970
65 Ga0207670_10110248 3300025936 Unclassified 1982
66 Ga0207704_10228699 3300025938 Bacteria 1381
67 Ga0207702_10107598 3300026078 Unclassified 2473
68 Ga0207641_10576954 3300026088 Unclassified 1099
69 Ga0207676_10047625 3300026095 Bacteria 3324
70 Ga0207674_10218063 3300026116 Bacteria 1856
71 Ga0265326_10003708 3300028558 Bacteria 4987
72 Ga0265326_10017210 3300028558 Bacteria 2085
73 Ga0265319_1003148 3300028563 Bacteria 8694
74 Ga0265334_10001932 3300028573 Bacteria 9838
75 Ga0265318_10032501 3300028577 Bacteria 2019
76 Ga0265318_10060459 3300028577 Unclassified 1412
77 Ga0265323_10000086 3300028653 Bacteria 53173
78 Ga0265323_10006324 3300028653 Bacteria 4980
79 Ga0265323_10049402 3300028653 Unclassified 1497
80 Ga0265322_10008257 3300028654 Bacteria 3034
81 Ga0265338_10000048 3300028800 Bacteria 218859
82 Ga0265338_10000103 3300028800 Bacteria 157336
83 Ga0265338_10000200 3300028800 Bacteria 113123
84 Ga0265338_10004517 3300028800 Bacteria 18755
85 Ga0265338_10006472 3300028800 Bacteria 14921
86 Ga0265338_10006598 3300028800 Bacteria 14710
87 Ga0265338_10006899 3300028800 Bacteria 14286
88 Ga0265338_10014798 3300028800 Bacteria 8635
89 Ga0265338_10028391 3300028800 Bacteria 5580
90 Ga0265338_10031393 3300028800 Bacteria 5210
91 Ga0265338_10103418 3300028800 Bacteria 2313
92 Ga0265338_10112071 3300028800 Bacteria 2194
93 Ga0265338_10172239 3300028800 Unclassified 1658
94 Ga0265324_10000179 3300029957 Bacteria 48472
95 Ga0265324_10004658 3300029957 Bacteria 6109
96 Ga0265324_10015612 3300029957 Bacteria 2789
97 Ga0265324_10018709 3300029957 Bacteria 2501
98 Ga0265332_10095095 3300031238 Unclassified 1259
99 Ga0265328_10049153 3300031239 Bacteria 1549
100 Ga0265320_10004926 3300031240 Bacteria 8663
101 Ga0265320_10103246 3300031240 Bacteria 1311
102 Ga0265325_10005376 3300031241 Bacteria 7915
103 Ga0265325_10018357 3300031241 Unclassified 3878
104 Ga0265339_10035145 3300031249 Bacteria 2813
105 Ga0265331_10082262 3300031250 Bacteria 1494
106 Ga0265327_10031514 3300031251 Bacteria 2977
107 Ga0265327_10033340 3300031251 Bacteria 2871
108 Ga0265327_10045274 3300031251 Unclassified 2340
109 Ga0265327_10061232 3300031251 Bacteria 1921
110 Ga0265316_10022749 3300031344 Bacteria 5276
111 Ga0265316_10054980 3300031344 Bacteria 3115
112 Ga0265316_10129205 3300031344 Bacteria 1904
113 Ga0265316_10386427 3300031344 Bacteria 1009
114 Ga0265316_10470088 3300031344 Bacteria 901
115 Ga0265313_10006806 3300031595 Bacteria 7983
116 Ga0265313_10115111 3300031595 Bacteria 1178
117 Ga0265342_10131364 3300031712 Bacteria 1403
118 Ga0373951_0074418 3300035091 Bacteria 870
119 Ga0373923_0173949 3300035111 Bacteria 987
120 Ga0373953_0008908 3300035117 Bacteria 3428
121 Ga0373954_0003436 3300035118 Bacteria 6716
122 Ga0373954_0032283 3300035118 Bacteria 2420
123 Ga0373956_0007968 3300035119 Bacteria 4280
124 Ga0373956_0015620 3300035119 Bacteria 3182
125 Ga0373946_0032006 3300035171 Bacteria 2110
126 Ga0373935_0017217 3300035692 Bacteria 4381
127 Ga0373927_0007072 3300035695 Bacteria 7610
128 Ga0373927_0485801 3300035695 Unclassified 816
129 Ga0373933_0109263 3300035724 Unclassified 1723
130 Ga0373947_0105273 3300035725 Bacteria 1777
131 Ga0373937_0129636 3300036401 Bacteria 2355
132 Ga0316582_0418406 3300036647 Unclassified 923
133 Ga0373925_0006502 3300037068 Bacteria 8593
134 Ga0373925_0291572 3300037068 Bacteria 1316
135 Ga0451807_2676391 3300041486 Bacteria 1072
136 Ga0451577_0000347 3300042876 Bacteria 86343
137 Ga0451577_0125186 3300042876 Unclassified 2303
138 Ga0453683_0551349 3300044673 Unclassified 750
139 Ga0453684_0011133 3300044712 Bacteria 15173
140 Ga0453684_0019872 3300044712 Bacteria 10190
141 Ga0451576_0156278 3300045051 Unclassified 2379
142 Ga0451576_0157585 3300045051 Bacteria 2369
143 Ga0451576_0402015 3300045051 Bacteria 1436
144 Ga0451576_0414127 3300045051 Bacteria 1414
145 Ga0451576_0433314 3300045051 Unclassified 1380
146 Ga0451576_0873333 3300045051 Bacteria 944
147 Ga0451576_0876096 3300045051 Bacteria 942
148 Ga0495629_0110288 3300046459 Bacteria 1918
149 Ga0495651_0242918 3300046462 Bacteria 1234
150 Ga0495651_0445348 3300046462 Bacteria 838
151 Ga0495653_0307936 3300046463 Unclassified 1031
152 Ga0495582_0140388 3300046473 Bacteria 1369
153 Ga0495628_0053259 3300046516 Bacteria 3194
154 Ga0495630_0033428 3300046517 Bacteria 3836
155 Ga0495630_0118113 3300046517 Unclassified 2011
156 Ga0495630_0248176 3300046517 Bacteria 1360
157 Ga0495630_0340495 3300046517 Bacteria 1147
158 Ga0495630_0551379 3300046517 Bacteria 884
159 Ga0495666_0079066 3300046526 Bacteria 1557
160 Ga0495652_0270489 3300046529 Bacteria 1249
161 Ga0495586_0001588 3300046535 Bacteria 12503
162 Ga0495586_0006179 3300046535 Bacteria 6404
163 Ga0495587_0039142 3300046536 Bacteria 2840
164 Ga0495645_0032733 3300046543 Unclassified 3793
165 Ga0495645_0050682 3300046543 Bacteria 3022
166 Ga0495622_0091888 3300046557 Unclassified 1394
167 Ga0495667_0050719 3300046559 Unclassified 2739
168 Ga0495667_0072818 3300046559 Bacteria 2239
169 Ga0495634_0002051 3300046642 Bacteria 17068
170 Ga0495634_0164872 3300046642 Bacteria 1395
171 Ga0495635_0287220 3300046663 Unclassified 1104
172 Ga0495657_0375278 3300046675 Bacteria 839
173 Ga0495599_0349498 3300046678 Bacteria 886
174 Ga0495647_0021504 3300046681 Unclassified 2323
175 Ga0495613_0077648 3300046689 Unclassified 2416
176 Ga0495613_0228685 3300046689 Bacteria 1304
177 Ga0495613_0348450 3300046689 Unclassified 1017
178 Ga0495613_0509073 3300046689 Unclassified 810
179 Ga0495613_0574106 3300046689 Unclassified 753
180 Ga0495624_0201409 3300046690 Unclassified 1209
181 Ga0495624_0394750 3300046690 Unclassified 831
182 Ga0495674_0057557 3300047319 Bacteria 3402
183 Ga0495674_0273351 3300047319 Bacteria 1386
184 Ga0495674_0380427 3300047319 Bacteria 1142
185 Ga0495680_0007193 3300047322 Bacteria 10254
186 Ga0495680_0486492 3300047322 Bacteria 840
187 Ga0495675_0061220 3300047444 Unclassified 2385
188 Ga0495684_0060179 3300047471 Bacteria 2892
189 Ga0495684_0381618 3300047471 Bacteria 994
190 Ga0496107_0140298 3300048910 Bacteria 1786
191 Ga0501031_0000133 3300049568 Bacteria 41137
192 Ga0501033_0001976 3300049570 Bacteria 17862
193 Ga0501033_0098096 3300049570 Unclassified 2140
194 Ga0501034_0591069 3300049571 Bacteria 1016
195 Ga0501036_0548843 3300049572 Unclassified 960
196 Ga0501046_0266438 3300049580 Bacteria 1257
197 Ga0501035_0010039 3300049822 Bacteria 8786
198 Ga0501044_0000767 3300049823 Bacteria 38872
199 nmdc:mga0rr50_856192_c1 3300050513 Unclassified 775
200 Ga0495601_0367619 3300053077 Bacteria 934
201 Ga0500636_0080072 3300053177 Unclassified 1883
202 Ga0265323_10025661
203 rootH1_10021352
204 Ga0070660_100129294
205 Ga0070713_100997773
206 Ga0070701_10396858
207 Ga0070681_10071997
208 Ga0070681_10587581
209 Ga0070707_100242471
210 Ga0070679_100941075
211 Ga0070693_100217388
212 Ga0068855_100045696
213 Ga0068857_100279995
214 Ga0068856_100171280
215 Ga0068856_100349943
216 Ga0070702_100082100
217 Ga0068859_100297797
218 Ga0068864_100088306
219 Ga0068863_100010140
220 Ga0068863_100887805
221 Ga0068858_100958210
222 Ga0081455_10285955
223 Ga0097621_100009753
224 Ga0097621_100591733
225 Ga0068871_100031155
226 Ga0068871_101197942
227 Ga0075434_101152717
228 Ga0068865_100214003
229 Ga0075436_100182036
230 Ga0097620_100297811
231 Ga0075435_100074115
232 Ga0099794_10154934
233 Ga0099794_10258921
234 Ga0105240_10047843
235 Ga0105240_10059976
236 Ga0105240_10210745
237 Ga0105240_10896346
238 Ga0105241_10086278
239 Ga0105241_10162478
240 Ga0105241_10776647
241 Ga0105242_10176198
242 Ga0105242_10449350
243 Ga0105242_10550008
244 Ga0105248_10495660
245 Ga0105238_10062515
246 Ga0105238_10147645
247 Ga0105239_11367961
248 Ga0105246_11014143
249 Ga0157374_10407452
250 Ga0157374_11496035
251 Ga0157378_10136628
252 Ga0157378_11157213
253 Ga0157372_10398521
254 Ga0163163_10022907
255 Ga0157376_10113602
256 Ga0157376_10474822
257 Ga0207654_10171666
258 Ga0207707_10038266
259 Ga0207707_10938522
260 Ga0207695_10102788
261 Ga0207695_10252415
262 Ga0207695_10683910
263 Ga0207652_10292614
264 Ga0207646_10245129
265 Ga0207664_10621677
266 Ga0207670_10110248
267 Ga0207704_10228699
268 Ga0207702_10107598
269 Ga0207641_10576954
270 Ga0207676_10047625
271 Ga0207674_10218063
272 Ga0265326_10003708
273 Ga0265326_10017210
274 Ga0265319_1003148
275 Ga0265334_10001932
276 Ga0265318_10032501
277 Ga0265318_10060459
278 Ga0265323_10000086
279 Ga0265323_10006324
280 Ga0265323_10049402
281 Ga0265322_10008257
282 Ga0265338_10000048
283 Ga0265338_10000103
284 Ga0265338_10000200
285 Ga0265338_10004517
286 Ga0265338_10006472
287 Ga0265338_10006598
288 Ga0265338_10006899
289 Ga0265338_10014798
290 Ga0265338_10028391
291 Ga0265338_10031393
292 Ga0265338_10103418
293 Ga0265338_10112071
294 Ga0265338_10172239
295 Ga0265324_10000179
296 Ga0265324_10004658
297 Ga0265324_10015612
298 Ga0265324_10018709
299 Ga0265332_10095095
300 Ga0265328_10049153
301 Ga0265320_10004926
302 Ga0265320_10103246
303 Ga0265325_10005376
304 Ga0265325_10018357
305 Ga0265339_10035145
306 Ga0265331_10082262
307 Ga0265327_10031514
308 Ga0265327_10033340
309 Ga0265327_10045274
310 Ga0265327_10061232
311 Ga0265316_10022749
312 Ga0265316_10054980
313 Ga0265316_10129205
314 Ga0265316_10386427
315 Ga0265316_10470088
316 Ga0265313_10006806
317 Ga0265313_10115111
318 Ga0265342_10131364
319 Ga0373951_0074418
320 Ga0373923_0173949
321 Ga0373953_0008908
322 Ga0373954_0003436
323 Ga0373954_0032283
324 Ga0373956_0007968
325 Ga0373956_0015620
326 Ga0373946_0032006
327 Ga0373935_0017217
328 Ga0373927_0007072
329 Ga0373927_0485801
330 Ga0373933_0109263
331 Ga0373947_0105273
332 Ga0373937_0129636
333 Ga0316582_0418406
334 Ga0373925_0006502
335 Ga0373925_0291572
336 Ga0451807_2676391
337 Ga0451577_0000347
338 Ga0451577_0125186
339 Ga0453683_0551349
340 Ga0453684_0011133
341 Ga0453684_0019872
342 Ga0451576_0156278
343 Ga0451576_0157585
344 Ga0451576_0402015
345 Ga0451576_0414127
346 Ga0451576_0433314
347 Ga0451576_0873333
348 Ga0451576_0876096
349 Ga0495629_0110288
350 Ga0495651_0242918
351 Ga0495651_0445348
352 Ga0495653_0307936
353 Ga0495582_0140388
354 Ga0495628_0053259
355 Ga0495630_0033428
356 Ga0495630_0118113
357 Ga0495630_0248176
358 Ga0495630_0340495
359 Ga0495630_0551379
360 Ga0495666_0079066
361 Ga0495652_0270489
362 Ga0495586_0001588
363 Ga0495586_0006179
364 Ga0495587_0039142
365 Ga0495645_0032733
366 Ga0495645_0050682
367 Ga0495622_0091888
368 Ga0495667_0050719
369 Ga0495667_0072818
370 Ga0495634_0002051
371 Ga0495634_0164872
372 Ga0495635_0287220
373 Ga0495657_0375278
374 Ga0495599_0349498
375 Ga0495647_0021504
376 Ga0495613_0077648
377 Ga0495613_0228685
378 Ga0495613_0348450
379 Ga0495613_0509073
380 Ga0495613_0574106
381 Ga0495624_0201409
382 Ga0495624_0394750
383 Ga0495674_0057557
384 Ga0495674_0273351
385 Ga0495674_0380427
386 Ga0495680_0007193
387 Ga0495680_0486492
388 Ga0495675_0061220
389 Ga0495684_0060179
390 Ga0495684_0381618
391 Ga0496107_0140298
392 Ga0501031_0000133
393 Ga0501033_0001976
394 Ga0501033_0098096
395 Ga0501034_0591069
396 Ga0501036_0548843
397 Ga0501046_0266438
398 Ga0501035_0010039
399 Ga0501044_0000767
400 nmdc:mga0rr50_856192_c1
401 Ga0495601_0367619
402 Ga0500636_0080072

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

146

195

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

141

193

0.93

PF04542

Sigma70_r2

Sigma-70 region 2

37

106

0.82

PF07638

Sigma70_ECF

ECF sigma factor

16

198

0.81

Map