F308344

General Info

Members Datasets Scaffolds Average Seq Length
201 131 402 240

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100279089|Ga0097621_1002790891
Length 283
Sequence VLGAVSLTFLPSLRILEQSRRGLRCPPTTLMLDLKGAAMADRPVETSPQVYARVGGVLYLIIIVAGLLGEVFIRGKMIVSGDATATAQNIMASQSLWRLGIAGDLIMHMCDVGLTMIFYVLLRPVNKNLALLAAFFNLVQTAILCANKLTLLIPLFLLGKADYLKAFEPRQLHALAYLSIKVHGYXXXVGLIYFGCMCLVLGHLIIRSGYFPRILGILMQVAGVCYLVNSFALLLSPSLANLLFPAILIPAFIAELSLCLWLLVKGVNVPKWTERDGLSRRAG

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
76 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
77 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
78 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
90 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
91 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
92 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
93 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
94 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
95 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
96 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
97 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
110 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
114 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
117 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
123 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
130 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
131 2739367866 Hymenobacter sp. YR204 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 4.48
Rhizosphere 93.03
Stem 0
Stem Tuber 0
Unclassified 20.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100279089 3300006237 Unclassified 1470
2 rootH1_10058360 3300003323 Bacteria 7323
3 Ga0065703_1019006 3300005272 Bacteria 4458
4 Ga0070670_100341569 3300005331 Bacteria 1314
5 Ga0070666_10000147 3300005335 Bacteria 48216
6 Ga0070680_100179877 3300005336 Bacteria 1781
7 Ga0070682_100447428 3300005337 Unclassified 988
8 Ga0068868_100166979 3300005338 Bacteria 1821
9 Ga0070660_100065863 3300005339 Bacteria 2820
10 Ga0070659_100442667 3300005366 Bacteria 1101
11 Ga0070667_100014927 3300005367 Bacteria 6416
12 Ga0070703_10002470 3300005406 Bacteria 5314
13 Ga0070709_10000002 3300005434 Bacteria 322903
14 Ga0070709_10255281 3300005434 Unclassified 1265
15 Ga0070713_100589951 3300005436 Unclassified 1055
16 Ga0070711_100015339 3300005439 Bacteria 4850
17 Ga0070711_100049376 3300005439 Bacteria 2881
18 Ga0070705_100007448 3300005440 Bacteria 5384
19 Ga0070705_100045878 3300005440 Bacteria 2517
20 Ga0070694_100581712 3300005444 Bacteria 900
21 Ga0070708_100000014 3300005445 Bacteria 130264
22 Ga0070708_100008418 3300005445 Bacteria 8279
23 Ga0070708_100017769 3300005445 Bacteria 5939
24 Ga0070708_100025216 3300005445 Bacteria 5081
25 Ga0070708_100056000 3300005445 Bacteria 3506
26 Ga0070708_100062618 3300005445 Bacteria 3327
27 Ga0070708_100175270 3300005445 Bacteria 2003
28 Ga0070708_100221909 3300005445 Unclassified 1773
29 Ga0070663_100059406 3300005455 Bacteria 2748
30 Ga0070681_10006185 3300005458 Bacteria 11633
31 Ga0070706_100001022 3300005467 Bacteria 30362
32 Ga0070706_100027799 3300005467 Bacteria 5202
33 Ga0070706_100384766 3300005467 Unclassified 1306
34 Ga0070707_100000172 3300005468 Bacteria 63116
35 Ga0070707_100000961 3300005468 Bacteria 28611
36 Ga0070707_100005144 3300005468 Bacteria 12254
37 Ga0070707_100042244 3300005468 Bacteria 4364
38 Ga0070707_100043227 3300005468 Bacteria 4313
39 Ga0070707_100052424 3300005468 Unclassified 3911
40 Ga0070707_100067344 3300005468 Bacteria 3444
41 Ga0070707_100379134 3300005468 Unclassified 1374
42 Ga0070707_100541176 3300005468 Bacteria 1126
43 Ga0070698_100012297 3300005471 Bacteria 9062
44 Ga0070698_100248987 3300005471 Bacteria 1710
45 Ga0070698_100394747 3300005471 Unclassified 1316
46 Ga0070699_100001052 3300005518 Bacteria 25646
47 Ga0070699_100011654 3300005518 Bacteria 7589
48 Ga0070699_100428780 3300005518 Bacteria 1197
49 Ga0070679_100028299 3300005530 Bacteria 5525
50 Ga0070697_100013062 3300005536 Bacteria 6509
51 Ga0070697_100174862 3300005536 Unclassified 1818
52 Ga0070697_100438624 3300005536 Bacteria 1136
53 Ga0070697_100439496 3300005536 Bacteria 1135
54 Ga0068853_100940440 3300005539 Unclassified 831
55 Ga0070695_100010807 3300005545 Bacteria 5455
56 Ga0070695_100247257 3300005545 Bacteria 1296
57 Ga0070696_100000611 3300005546 Bacteria 22935
58 Ga0070696_100113279 3300005546 Bacteria 1955
59 Ga0070693_100000041 3300005547 Bacteria 49532
60 Ga0070704_100032655 3300005549 Bacteria 3513
61 Ga0070704_100140639 3300005549 Bacteria 1884
62 Ga0070704_100408948 3300005549 Bacteria 1160
63 Ga0068855_100080690 3300005563 Bacteria 3772
64 Ga0068861_100083191 3300005719 Bacteria 2510
65 Ga0068851_10006238 3300005834 Bacteria 5441
66 Ga0068863_100335974 3300005841 Bacteria 1469
67 Ga0068858_100692580 3300005842 Unclassified 991
68 Ga0070717_10012222 3300006028 Bacteria 6546
69 Ga0070717_10478626 3300006028 Unclassified 1124
70 Ga0070715_10085248 3300006163 Unclassified 1442
71 Ga0070712_100107499 3300006175 Bacteria 2076
72 Ga0075431_100018402 3300006847 Bacteria 7113
73 Ga0075433_10050260 3300006852 Bacteria 3629
74 Ga0075433_10125727 3300006852 Bacteria 2277
75 Ga0075433_10268475 3300006852 Unclassified 1512
76 Ga0075433_10277460 3300006852 Bacteria 1485
77 Ga0075434_100001514 3300006871 Bacteria 19641
78 Ga0075434_100294490 3300006871 Unclassified 1643
79 Ga0075436_100000687 3300006914 Bacteria 22291
80 Ga0075435_100000063 3300007076 Bacteria 54855
81 Ga0075435_100083079 3300007076 Unclassified 2633
82 Ga0105240_10027557 3300009093 Bacteria 7437
83 Ga0105240_10080066 3300009093 Bacteria 4018
84 Ga0114129_10017313 3300009147 Bacteria 10260
85 Ga0114129_10086535 3300009147 Bacteria 4347
86 Ga0114129_10386534 3300009147 Bacteria 1847
87 Ga0114129_10824313 3300009147 Unclassified 1182
88 Ga0105237_10044940 3300009545 Bacteria 4447
89 Ga0105246_10005531 3300011119 Bacteria 7709
90 Ga0157372_10078284 3300013307 Unclassified 3735
91 Ga0157375_10052673 3300013308 Bacteria 4002
92 Ga0163163_10131485 3300014325 Bacteria 2543
93 Ga0207697_10195573 3300025315 Unclassified 889
94 Ga0207656_10003731 3300025321 Bacteria 5272
95 Ga0207653_10010082 3300025885 Bacteria 2947
96 Ga0207680_10001024 3300025903 Bacteria 13188
97 Ga0207647_10000055 3300025904 Bacteria 86547
98 Ga0207699_10000001 3300025906 Bacteria 695560
99 Ga0207699_10026691 3300025906 Bacteria 3188
100 Ga0207699_10095898 3300025906 Bacteria 1872
101 Ga0207699_10152723 3300025906 Bacteria 1530
102 Ga0207684_10000084 3300025910 Bacteria 176027
103 Ga0207684_10009435 3300025910 Bacteria 8619
104 Ga0207684_10015802 3300025910 Bacteria 6492
105 Ga0207684_10046095 3300025910 Bacteria 3698
106 Ga0207695_10009926 3300025913 Bacteria 11699
107 Ga0207695_10082272 3300025913 Bacteria 3256
108 Ga0207671_10020157 3300025914 Bacteria 5081
109 Ga0207693_10071522 3300025915 Bacteria 2715
110 Ga0207663_10014073 3300025916 Bacteria 4370
111 Ga0207660_10186275 3300025917 Bacteria 1614
112 Ga0207652_10096421 3300025921 Bacteria 2606
113 Ga0207646_10000031 3300025922 Bacteria 219144
114 Ga0207646_10000306 3300025922 Bacteria 66698
115 Ga0207646_10006944 3300025922 Bacteria 11618
116 Ga0207646_10011459 3300025922 Bacteria 8591
117 Ga0207646_10034750 3300025922 Bacteria 4556
118 Ga0207646_10054268 3300025922 Bacteria 3585
119 Ga0207646_10456840 3300025922 Unclassified 1152
120 Ga0207646_10523628 3300025922 Unclassified 1067
121 Ga0207700_10004563 3300025928 Bacteria 8190
122 Ga0207700_10521529 3300025928 Unclassified 1053
123 Ga0207700_10805873 3300025928 Unclassified 840
124 Ga0207690_10424339 3300025932 Bacteria 1064
125 Ga0207686_10038153 3300025934 Bacteria 2905
126 Ga0207658_10007176 3300025986 Bacteria 7594
127 Ga0207658_10131069 3300025986 Bacteria 2014
128 Ga0207677_10324212 3300026023 Unclassified 1281
129 Ga0207639_10089316 3300026041 Bacteria 2462
130 Ga0207708_10068304 3300026075 Bacteria 2720
131 Ga0207674_10133660 3300026116 Bacteria 2443
132 Ga0207675_100199592 3300026118 Bacteria 1921
133 Ga0265334_10060122 3300028573 Unclassified 1435
134 Ga0265322_10000407 3300028654 Bacteria 17682
135 Ga0265336_10051666 3300028666 Bacteria 1241
136 Ga0307515_10205938 3300028794 Unclassified 1827
137 Ga0307408_100006047 3300031548 Bacteria 8050
138 Ga0307405_10000970 3300031731 Bacteria 11526
139 Ga0307410_10001777 3300031852 Bacteria 9988
140 Ga0307406_10004765 3300031901 Bacteria 7388
141 Ga0307407_10000892 3300031903 Bacteria 10049
142 Ga0307412_10031148 3300031911 Bacteria 3365
143 Ga0307409_100000763 3300031995 Bacteria 14539
144 Ga0307416_100001347 3300032002 Bacteria 13258
145 Ga0307411_10000380 3300032005 Bacteria 15131
146 Ga0307415_100000177 3300032126 Bacteria 28430
147 Ga0373926_0017601 3300035083 Bacteria 2453
148 Ga0373940_0053214 3300035088 Unclassified 1142
149 Ga0373923_0011759 3300035111 Bacteria 3221
150 Ga0373936_0021663 3300035113 Bacteria 2500
151 Ga0373945_0003246 3300035116 Bacteria 5101
152 Ga0373956_0078227 3300035119 Bacteria 1515
153 Ga0373946_0026767 3300035171 Bacteria 2277
154 Ga0373955_0344812 3300035172 Unclassified 902
155 Ga0373924_0000247 3300035410 Bacteria 16559
156 Ga0373935_0043607 3300035692 Bacteria 2823
157 Ga0373927_0006573 3300035695 Bacteria 7919
158 Ga0373937_0015125 3300036401 Bacteria 6819
159 Ga0395905_0000941 3300037471 Bacteria 37467
160 Ga0436365_1898538 3300039437 Bacteria 4017
161 Ga0451577_0605835 3300042876 Unclassified 994
162 Ga0451577_0614094 3300042876 Unclassified 986
163 Ga0453683_0377303 3300044673 Unclassified 912
164 Ga0451576_0022056 3300045051 Bacteria 6910
165 Ga0451576_0243213 3300045051 Bacteria 1880
166 Ga0495580_0004978 3300046472 Bacteria 11096
167 Ga0495580_0262071 3300046472 Bacteria 1182
168 Ga0495580_0268055 3300046472 Unclassified 1167
169 Ga0495608_0204760 3300046511 Unclassified 1242
170 Ga0495630_0459053 3300046517 Unclassified 976
171 Ga0495666_0080233 3300046526 Bacteria 1544
172 Ga0495665_0195107 3300046531 Unclassified 1050
173 Ga0495586_0314431 3300046535 Unclassified 898
174 Ga0495661_0008121 3300046665 Bacteria 7276
175 Ga0495674_0148732 3300047319 Bacteria 1965
176 Ga0495686_0252379 3300047472 Bacteria 991
177 Ga0496104_0000031 3300048907 Bacteria 194537
178 Ga0496104_0063257 3300048907 Unclassified 3509
179 Ga0496105_0644605 3300048908 Unclassified 818
180 Ga0496109_0217944 3300048912 Bacteria 1795
181 Ga0496111_0240999 3300048914 Bacteria 1343
182 Ga0496112_0005825 3300048915 Bacteria 10725
183 Ga0496112_0035874 3300048915 Bacteria 4833
184 Ga0496113_0031709 3300048916 Bacteria 3837
185 Ga0496114_0000018 3300048917 Bacteria 251239
186 Ga0501083_0002153 3300049744 Bacteria 13509
187 nmdc:mga05p37_114490_c1 3300050507 Unclassified 3315
188 nmdc:mga05p37_735840_c1 3300050507 Bacteria 1090
189 nmdc:mga05p37_821783_c1 3300050507 Unclassified 1013
190 nmdc:mga06r32_9648_c1 3300050510 Bacteria 8718
191 nmdc:mga0n895_131_c1 3300050512 Bacteria 44684
192 nmdc:mga0n895_288349_c1 3300050512 Unclassified 1664
193 nmdc:mga0n895_32897_c1 3300050512 Bacteria 4979
194 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
195 nmdc:mga08x19_412325_c1 3300050514 Bacteria 948
196 nmdc:mga08x19_92_c1 3300050514 Bacteria 80986
197 nmdc:mga0a205_177195_c1 3300050515 Bacteria 2027
198 nmdc:mga0a205_56106_c1 3300050515 Bacteria 3804
199 Ga0495619_0106943 3300053085 Bacteria 1908
200 Ga0500651_0021532 3300053093 Bacteria 4021
201 2740031387 2739367866 Bacteria 4215900
202 Ga0097621_100279089
203 rootH1_10058360
204 Ga0065703_1019006
205 Ga0070670_100341569
206 Ga0070666_10000147
207 Ga0070680_100179877
208 Ga0070682_100447428
209 Ga0068868_100166979
210 Ga0070660_100065863
211 Ga0070659_100442667
212 Ga0070667_100014927
213 Ga0070703_10002470
214 Ga0070709_10000002
215 Ga0070709_10255281
216 Ga0070713_100589951
217 Ga0070711_100015339
218 Ga0070711_100049376
219 Ga0070705_100007448
220 Ga0070705_100045878
221 Ga0070694_100581712
222 Ga0070708_100000014
223 Ga0070708_100008418
224 Ga0070708_100017769
225 Ga0070708_100025216
226 Ga0070708_100056000
227 Ga0070708_100062618
228 Ga0070708_100175270
229 Ga0070708_100221909
230 Ga0070663_100059406
231 Ga0070681_10006185
232 Ga0070706_100001022
233 Ga0070706_100027799
234 Ga0070706_100384766
235 Ga0070707_100000172
236 Ga0070707_100000961
237 Ga0070707_100005144
238 Ga0070707_100042244
239 Ga0070707_100043227
240 Ga0070707_100052424
241 Ga0070707_100067344
242 Ga0070707_100379134
243 Ga0070707_100541176
244 Ga0070698_100012297
245 Ga0070698_100248987
246 Ga0070698_100394747
247 Ga0070699_100001052
248 Ga0070699_100011654
249 Ga0070699_100428780
250 Ga0070679_100028299
251 Ga0070697_100013062
252 Ga0070697_100174862
253 Ga0070697_100438624
254 Ga0070697_100439496
255 Ga0068853_100940440
256 Ga0070695_100010807
257 Ga0070695_100247257
258 Ga0070696_100000611
259 Ga0070696_100113279
260 Ga0070693_100000041
261 Ga0070704_100032655
262 Ga0070704_100140639
263 Ga0070704_100408948
264 Ga0068855_100080690
265 Ga0068861_100083191
266 Ga0068851_10006238
267 Ga0068863_100335974
268 Ga0068858_100692580
269 Ga0070717_10012222
270 Ga0070717_10478626
271 Ga0070715_10085248
272 Ga0070712_100107499
273 Ga0075431_100018402
274 Ga0075433_10050260
275 Ga0075433_10125727
276 Ga0075433_10268475
277 Ga0075433_10277460
278 Ga0075434_100001514
279 Ga0075434_100294490
280 Ga0075436_100000687
281 Ga0075435_100000063
282 Ga0075435_100083079
283 Ga0105240_10027557
284 Ga0105240_10080066
285 Ga0114129_10017313
286 Ga0114129_10086535
287 Ga0114129_10386534
288 Ga0114129_10824313
289 Ga0105237_10044940
290 Ga0105246_10005531
291 Ga0157372_10078284
292 Ga0157375_10052673
293 Ga0163163_10131485
294 Ga0207697_10195573
295 Ga0207656_10003731
296 Ga0207653_10010082
297 Ga0207680_10001024
298 Ga0207647_10000055
299 Ga0207699_10000001
300 Ga0207699_10026691
301 Ga0207699_10095898
302 Ga0207699_10152723
303 Ga0207684_10000084
304 Ga0207684_10009435
305 Ga0207684_10015802
306 Ga0207684_10046095
307 Ga0207695_10009926
308 Ga0207695_10082272
309 Ga0207671_10020157
310 Ga0207693_10071522
311 Ga0207663_10014073
312 Ga0207660_10186275
313 Ga0207652_10096421
314 Ga0207646_10000031
315 Ga0207646_10000306
316 Ga0207646_10006944
317 Ga0207646_10011459
318 Ga0207646_10034750
319 Ga0207646_10054268
320 Ga0207646_10456840
321 Ga0207646_10523628
322 Ga0207700_10004563
323 Ga0207700_10521529
324 Ga0207700_10805873
325 Ga0207690_10424339
326 Ga0207686_10038153
327 Ga0207658_10007176
328 Ga0207658_10131069
329 Ga0207677_10324212
330 Ga0207639_10089316
331 Ga0207708_10068304
332 Ga0207674_10133660
333 Ga0207675_100199592
334 Ga0265334_10060122
335 Ga0265322_10000407
336 Ga0265336_10051666
337 Ga0307515_10205938
338 Ga0307408_100006047
339 Ga0307405_10000970
340 Ga0307410_10001777
341 Ga0307406_10004765
342 Ga0307407_10000892
343 Ga0307412_10031148
344 Ga0307409_100000763
345 Ga0307416_100001347
346 Ga0307411_10000380
347 Ga0307415_100000177
348 Ga0373926_0017601
349 Ga0373940_0053214
350 Ga0373923_0011759
351 Ga0373936_0021663
352 Ga0373945_0003246
353 Ga0373956_0078227
354 Ga0373946_0026767
355 Ga0373955_0344812
356 Ga0373924_0000247
357 Ga0373935_0043607
358 Ga0373927_0006573
359 Ga0373937_0015125
360 Ga0395905_0000941
361 Ga0436365_1898538
362 Ga0451577_0605835
363 Ga0451577_0614094
364 Ga0453683_0377303
365 Ga0451576_0022056
366 Ga0451576_0243213
367 Ga0495580_0004978
368 Ga0495580_0262071
369 Ga0495580_0268055
370 Ga0495608_0204760
371 Ga0495630_0459053
372 Ga0495666_0080233
373 Ga0495665_0195107
374 Ga0495586_0314431
375 Ga0495661_0008121
376 Ga0495674_0148732
377 Ga0495686_0252379
378 Ga0496104_0000031
379 Ga0496104_0063257
380 Ga0496105_0644605
381 Ga0496109_0217944
382 Ga0496111_0240999
383 Ga0496112_0005825
384 Ga0496112_0035874
385 Ga0496113_0031709
386 Ga0496114_0000018
387 Ga0501083_0002153
388 nmdc:mga05p37_114490_c1
389 nmdc:mga05p37_735840_c1
390 nmdc:mga05p37_821783_c1
391 nmdc:mga06r32_9648_c1
392 nmdc:mga0n895_131_c1
393 nmdc:mga0n895_288349_c1
394 nmdc:mga0n895_32897_c1
395 nmdc:mga0rr50_1_c1
396 nmdc:mga08x19_412325_c1
397 nmdc:mga08x19_92_c1
398 nmdc:mga0a205_177195_c1
399 nmdc:mga0a205_56106_c1
400 Ga0495619_0106943
401 Ga0500651_0021532
402 2740031387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14329

DUF4386

Domain of unknown function (DUF4386)

54

266

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6upw-assembly1.cif.gz_M metavinculin abd-f-actin complex 0.5211 7 184
2ap3-assembly1.cif.gz_A 1.6 a crystal structure of a conserved protein of unknown function from staphylococcus aureus 0.4972 7 166
6upw-assembly1.cif.gz_M metavinculin abd-f-actin complex 0.4889 7 184
6bbi-assembly1.cif.gz_B-2 the crac channel orai in an unlatched-closed conformation; k163w loss-of-function mutation; p42212 crystal form 0.4568 54 209
6bbi-assembly1.cif.gz_B-2 the crac channel orai in an unlatched-closed conformation; k163w loss-of-function mutation; p42212 crystal form 0.4499 54 209
ID Description Score Start End Superfamily
af_Q8IE80_1_303_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.6377 19 203 1.20.1070.10
af_P02649_18_201_1.20.120.20 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.607 2 186 1.20.120.20
af_P02649_18_201_1.20.120.20 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Apolipoprotein 0.5704 2 186 1.20.120.20
af_A0A0G2JZL7_452_626_1.20.120.830 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Serine-rich domain 0.5419 9 148 1.20.120.830
af_Q09232_97_289_1.20.140.140 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Calcium release-activated calcium channel protein Orai 0.5136 41 240 1.20.140.140
ID Description Score Start End GO Terms
AF-A0A2V9ZPY3-F1-model_v4 DUF4386 domain-containing protein 0.9778 7 148 GO:0016020
AF-A0A1Q7SY46-F1-model_v4 DUF4386 domain-containing protein 0.9777 2 192 GO:0016020
AF-A0A2V5YZ10-F1-model_v4 DUF4386 domain-containing protein 0.9693 8 155 GO:0016020
AF-A0A7Y4QCR8-F1-model_v4 DUF4386 domain-containing protein 0.9669 9 144 GO:0016020
AF-A0A535XKA2-F1-model_v4 DUF4386 domain-containing protein 0.9662 27 186 GO:0016020

Map