F308106

General Info

Members Datasets Scaffolds Average Seq Length
201 155 197 186

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100244625|Ga0070680_1002446252
Length 198
Sequence LHRRTLLASLAPFGVLSGAAIATLATGALMSEDANAQPKLDPENTIYLDLKQGRVVIELLPDIAPHHVERIKTLARKGFYDGTPFHRVIEGFMAQGGDPTGTGTGGSDLPNLKAEFTNKRHFLRGTCGMARSSSPDSANSQFFIMFAPAPHLDGQYTIWGQVVEGMQFVDEIKRGSGGSGTVSDPDRIIHMRVAADVK

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
3 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
4 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
5 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
67 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
68 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
69 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
70 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
71 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
72 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
73 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
74 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
75 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
76 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
80 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
86 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
87 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
88 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
89 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
90 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
91 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
92 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
93 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
94 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
95 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
101 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
108 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
111 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
118 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
143 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
149 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
153 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 3.48
Isolates 1.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.48
Nodule 0.5
Rhizoplane 1.49
Rhizosphere 82.59
Stem 0
Stem Tuber 0
Unclassified 11.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006778J45830_1042871 3300003162 Bacteria 848
2 JGI25406J46586_10000467 3300003203 Bacteria 18878
3 Ga0007417J51691_1045094 3300003544 Bacteria 720
4 Ga0007410J51695_1033050 3300003574 Bacteria 1313
5 Ga0070683_100405209 3300005329 Bacteria 1301
6 Ga0068869_101253466 3300005334 Bacteria 653
7 Ga0070680_100244625 3300005336 Bacteria 1516
8 Ga0070668_100526645 3300005347 Bacteria 1026
9 Ga0070714_100518318 3300005435 Bacteria 1138
10 Ga0070713_100097161 3300005436 Bacteria 2545
11 Ga0070713_100981335 3300005436 Bacteria 814
12 Ga0070710_10104473 3300005437 Bacteria 1692
13 Ga0070711_100061538 3300005439 Bacteria 2614
14 Ga0070663_100064872 3300005455 Bacteria 2641
15 Ga0070678_100026393 3300005456 Bacteria 3926
16 Ga0070679_100333320 3300005530 Bacteria 1466
17 Ga0070665_100199307 3300005548 Bacteria 2002
18 Ga0068855_100710581 3300005563 Bacteria 1075
19 Ga0068856_100869100 3300005614 Bacteria 921
20 Ga0068863_100312878 3300005841 Bacteria 1524
21 Ga0068860_100994012 3300005843 Bacteria 857
22 Ga0081455_10152460 3300005937 Bacteria 1780
23 Ga0081540_1220384 3300005983 Bacteria 675
24 Ga0081539_10001207 3300005985 Bacteria 46468
25 Ga0070717_10104760 3300006028 Bacteria 2407
26 Ga0070716_100194228 3300006173 Bacteria 1344
27 Ga0075362_10011572 3300006177 Bacteria 3480
28 Ga0075362_10142829 3300006177 Bacteria 1145
29 Ga0068871_100773095 3300006358 Bacteria 884
30 Ga0075430_100632382 3300006846 Bacteria 883
31 Ga0075435_100137075 3300007076 Bacteria 2051
32 Ga0105240_10722216 3300009093 Bacteria 1086
33 Ga0114129_10976192 3300009147 Bacteria 1068
34 Ga0114129_11027223 3300009147 Bacteria 1036
35 Ga0105243_11195337 3300009148 Bacteria 773
36 Ga0105239_10130640 3300010375 Bacteria 2793
37 Ga0105239_10575223 3300010375 Bacteria 1284
38 Ga0105246_10368506 3300011119 Bacteria 1183
39 Ga0157373_10338890 3300013100 Bacteria 1071
40 Ga0157369_10672284 3300013105 Bacteria 1067
41 Ga0163163_10410175 3300014325 Bacteria 1413
42 Ga0182008_10154924 3300014497 Bacteria 1150
43 Ga0157376_10073660 3300014969 Bacteria 2909
44 Ga0206354_10809147 3300020081 Bacteria 1213
45 Ga0206353_10244524 3300020082 Bacteria 1136
46 Ga0213876_10263400 3300021384 Bacteria 916
47 Ga0213875_10049478 3300021388 Bacteria 1970
48 Ga0213875_10052836 3300021388 Bacteria 1903
49 Ga0213875_10170535 3300021388 Bacteria 1022
50 Ga0224572_1056722 3300024225 Bacteria 727
51 Ga0207692_10029610 3300025898 Bacteria 2604
52 Ga0207693_10300576 3300025915 Bacteria 1257
53 Ga0207652_10372186 3300025921 Bacteria 1289
54 Ga0207694_10343636 3300025924 Bacteria 1234
55 Ga0207700_10111174 3300025928 Bacteria 2205
56 Ga0207700_10898399 3300025928 Bacteria 793
57 Ga0207664_10002551 3300025929 Bacteria 12036
58 Ga0207665_10223974 3300025939 Bacteria 1379
59 Ga0207702_10138512 3300026078 Bacteria 2199
60 Ga0207702_10350988 3300026078 Bacteria 1412
61 Ga0207702_10534641 3300026078 Bacteria 1145
62 Ga0207641_10649548 3300026088 Bacteria 1036
63 Ga0207683_10038897 3300026121 Bacteria 4149
64 Ga0268266_10404606 3300028379 Bacteria 1291
65 Ga0268264_10570942 3300028381 Bacteria 1112
66 Ga0265338_10016849 3300028800 Bacteria 7915
67 Ga0311004_103845 3300029276 Bacteria 981
68 Ga0265314_10092524 3300031711 Bacteria 1965
69 Ga0307410_10457614 3300031852 Bacteria 1042
70 Ga0307407_10303542 3300031903 Bacteria 1114
71 Ga0373926_0032153 3300035083 Bacteria 1851
72 Ga0373934_0066532 3300035086 Bacteria 1439
73 Ga0373945_0146625 3300035116 Bacteria 954
74 Ga0373945_0251108 3300035116 Bacteria 747
75 Ga0373953_0090678 3300035117 Bacteria 1278
76 Ga0373953_0360104 3300035117 Bacteria 638
77 Ga0373954_0182523 3300035118 Bacteria 1029
78 Ga0373956_0071723 3300035119 Bacteria 1581
79 Ga0373957_0008548 3300035120 Bacteria 3321
80 Ga0373943_0098734 3300035170 Bacteria 1524
81 Ga0373946_0068278 3300035171 Bacteria 1529
82 Ga0373955_0034820 3300035172 Bacteria 2663
83 Ga0373924_0187966 3300035410 Bacteria 910
84 Ga0373931_0026581 3300035691 Bacteria 2947
85 Ga0373935_0047365 3300035692 Bacteria 2718
86 Ga0373935_0154507 3300035692 Bacteria 1560
87 Ga0373935_0613084 3300035692 Bacteria 796
88 Ga0373927_0103409 3300035695 Bacteria 1853
89 Ga0373927_0206072 3300035695 Bacteria 1291
90 Ga0373933_0128576 3300035724 Bacteria 1591
91 Ga0373947_0019452 3300035725 Bacteria 3915
92 Ga0373947_0220419 3300035725 Bacteria 1247
93 Ga0373937_0003351 3300036401 Bacteria 13446
94 Ga0373937_0029460 3300036401 Bacteria 4971
95 Ga0373937_0061307 3300036401 Bacteria 3457
96 Ga0373937_0157076 3300036401 Bacteria 2132
97 Ga0373937_0427113 3300036401 Bacteria 1258
98 Ga0373925_0122345 3300037068 Bacteria 2021
99 Ga0373925_0127058 3300037068 Bacteria 1984
100 Ga0373925_0276368 3300037068 Bacteria 1352
101 Ga0373925_0589284 3300037068 Bacteria 915
102 Ga0436364_0037128 3300037853 Bacteria 1169
103 Ga0436364_0173332 3300037853 Bacteria 20937
104 Ga0436364_1080787 3300037853 Bacteria 39578
105 Ga0436364_1089933 3300037853 Bacteria 5818
106 Ga0436364_1173139 3300037853 Bacteria 4254
107 Ga0436364_1189942 3300037853 Bacteria 1418
108 Ga0436364_1392850 3300037853 Bacteria 1276
109 Ga0400490_01207 3300038726 Bacteria 4384
110 Ga0400485_11471 3300038735 Bacteria 1172
111 Ga0400486_12778 3300038742 Bacteria 6056
112 Ga0400486_15526 3300038742 Bacteria 1781
113 Ga0400487_45198 3300039110 Bacteria 2032
114 Ga0436365_0570461 3300039437 Bacteria 913
115 Ga0436365_0633000 3300039437 Bacteria 842
116 Ga0436360_1264447 3300039438 Bacteria 647
117 Ga0436363_1470209 3300039450 Bacteria 2537
118 Ga0436363_1709026 3300039450 Bacteria 1030
119 Ga0436362_0047167 3300039453 Bacteria 1351
120 Ga0439461_0104248 3300041410 Bacteria 694
121 Ga0439433_0042090 3300041999 Bacteria 1065
122 Ga0450904_015557 3300042139 Bacteria 760
123 Ga0495592_0314331 3300046454 Bacteria 1014
124 Ga0495629_0345045 3300046459 Bacteria 1016
125 Ga0495629_0350577 3300046459 Bacteria 1007
126 Ga0495651_0012921 3300046462 Bacteria 6452
127 Ga0495651_0354674 3300046462 Bacteria 968
128 Ga0495651_0492976 3300046462 Bacteria 785
129 Ga0495580_0729188 3300046472 Bacteria 647
130 Ga0495662_0026068 3300046476 Bacteria 2824
131 Ga0495664_0000424 3300046477 Bacteria 20707
132 Ga0495652_0042204 3300046529 Bacteria 3934
133 Ga0495640_0073606 3300046533 Bacteria 2287
134 Ga0495587_0202527 3300046536 Bacteria 1122
135 Ga0495597_0059904 3300046542 Bacteria 1661
136 Ga0495645_0000661 3300046543 Bacteria 23778
137 Ga0495645_0197922 3300046543 Bacteria 1365
138 Ga0495667_0048799 3300046559 Bacteria 2795
139 Ga0495657_0180563 3300046675 Bacteria 1296
140 Ga0495599_0020129 3300046678 Bacteria 4156
141 Ga0495623_0013411 3300046679 Bacteria 5313
142 Ga0495646_0012466 3300046680 Bacteria 5406
143 Ga0495613_0607733 3300046689 Bacteria 727
144 Ga0495581_0541677 3300047315 Bacteria 676
145 Ga0495604_0013578 3300047317 Bacteria 6496
146 Ga0495674_0011945 3300047319 Bacteria 8189
147 Ga0495674_0070621 3300047319 Bacteria 3017
148 Ga0495680_0084707 3300047322 Bacteria 2388
149 Ga0495680_0184758 3300047322 Bacteria 1502
150 Ga0495684_0017022 3300047471 Bacteria 5600
151 Ga0495602_0003478 3300048088 Bacteria 16284
152 Ga0496103_0450166 3300048906 Bacteria 826
153 Ga0496106_0020859 3300048909 Bacteria 4862
154 Ga0496112_0217139 3300048915 Bacteria 1869
155 Ga0496119_0041887 3300048922 Bacteria 2910
156 Ga0496120_0155176 3300048923 Bacteria 1146
157 Ga0501305_055141 3300049161 Bacteria 674
158 Ga0501031_0049352 3300049568 Bacteria 2743
159 Ga0501032_0120847 3300049569 Bacteria 1732
160 Ga0501032_0256463 3300049569 Bacteria 1134
161 Ga0501033_0020781 3300049570 Bacteria 4960
162 Ga0501034_0021272 3300049571 Bacteria 6614
163 Ga0501036_0118490 3300049572 Bacteria 2236
164 Ga0501036_0145609 3300049572 Bacteria 1998
165 Ga0501037_0221877 3300049573 Bacteria 1330
166 Ga0501039_0028844 3300049575 Bacteria 4274
167 Ga0501042_0025835 3300049578 Bacteria 4127
168 Ga0501043_0451479 3300049579 Bacteria 966
169 Ga0501047_0005846 3300049581 Bacteria 11577
170 Ga0501047_0208394 3300049581 Bacteria 1814
171 Ga0501047_0334845 3300049581 Bacteria 1352
172 Ga0501047_0821112 3300049581 Bacteria 744
173 Ga0501048_0423586 3300049582 Bacteria 952
174 Ga0501070_0031872 3300049586 Bacteria 4415
175 Ga0501071_0117119 3300049587 Bacteria 1973
176 Ga0501073_0220639 3300049589 Bacteria 1310
177 Ga0501076_0446757 3300049592 Bacteria 1064
178 Ga0501080_0638273 3300049742 Bacteria 943
179 Ga0501035_0124356 3300049822 Bacteria 2252
180 Ga0501035_0567728 3300049822 Bacteria 928
181 Ga0501035_1093839 3300049822 Bacteria 623
182 Ga0501044_0006787 3300049823 Bacteria 12617
183 Ga0501044_0207154 3300049823 Bacteria 1917
184 nmdc:mga03683_114162_c1 3300050489 Bacteria 1197
185 nmdc:mga03683_3161_c1 3300050489 Bacteria 5253
186 nmdc:mga00v17_349468_c1 3300050491 Bacteria 961
187 nmdc:mga05p37_840750_c1 3300050507 Bacteria 998
188 nmdc:mga0qj67_1050216_c1 3300050509 Bacteria 638
189 nmdc:mga0rr50_1018949_c1 3300050513 Bacteria 705
190 nmdc:mga0a205_889552_c1 3300050515 Bacteria 737
191 nmdc:mga0sz30_16354_c1 3300050516 Bacteria 2945
192 Ga0495601_0008145 3300053077 Bacteria 6180
193 Ga0495595_0024707 3300053084 Bacteria 2655
194 Ga0495619_0041723 3300053085 Bacteria 3002
195 Ga0500655_112371 3300053133 Bacteria 575
196 Ga0501084_1300410 3300054114 Bacteria 610
197 Ga0501082_0896361 3300060353 Bacteria 776

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10976192 Ga0114129_109761921 153
2 3300050507 nmdc:mga05p37_840750_c1 nmdc:mga05p37_840750_c1_91_624 153
3 3300046542 Ga0495597_0059904 Ga0495597_0059904_114_614 156
4 3300053133 Ga0500655_112371 Ga0500655_112371_20_520 156
5 3300005983 Ga0081540_1220384 Ga0081540_12203842 160
6 3300039438 Ga0436360_1264447 Ga0436360_1264447_85_582 160
7 iso_pu_bacteria 2883577096 2883580059 161
8 3300006177 Ga0075362_10011572 Ga0075362_100115722 162
9 3300049822 Ga0501035_0567728 Ga0501035_0567728_363_854 162
10 3300050489 nmdc:mga03683_3161_c1 nmdc:mga03683_3161_c1_4036_4545 162
11 3300060353 Ga0501082_0896361 Ga0501082_0896361_261_755 162
12 3300035117 Ga0373953_0360104 Ga0373953_0360104_112_624 163
13 3300037853 Ga0436364_0037128 Ga0436364_0037128_443_955 163
14 3300039437 Ga0436365_0570461 Ga0436365_0570461_165_677 163
15 3300039450 Ga0436363_1470209 Ga0436363_1470209_1599_2111 163
16 3300047315 Ga0495581_0541677 Ga0495581_0541677_138_650 163
17 3300047317 Ga0495604_0013578 Ga0495604_0013578_56_568 163
18 3300025929 Ga0207664_10002551 Ga0207664_100025516 167
19 3300049592 Ga0501076_0446757 Ga0501076_0446757_290_862 168
20 3300050516 nmdc:mga0sz30_16354_c1 nmdc:mga0sz30_16354_c1_1849_2370 168
21 3300031711 Ga0265314_10092524 Ga0265314_100925243 171
22 3300036401 Ga0373937_0427113 Ga0373937_0427113_511_1077 171
23 3300049823 Ga0501044_0207154 Ga0501044_0207154_703_1281 171
24 3300038742 Ga0400486_12778 Ga0400486_12778_1346_1885 172
25 3300039110 Ga0400487_45198 Ga0400487_45198_265_804 172
26 3300049581 Ga0501047_0821112 Ga0501047_0821112_153_695 172
27 3300049822 Ga0501035_1093839 Ga0501035_1093839_53_595 172
28 3300013100 Ga0157373_10338890 Ga0157373_103388902 173
29 3300048906 Ga0496103_0450166 Ga0496103_0450166_247_777 173
30 3300048909 Ga0496106_0020859 Ga0496106_0020859_3509_4039 173
31 3300050513 nmdc:mga0rr50_1018949_c1 nmdc:mga0rr50_1018949_c1_25_555 173
32 3300009147 Ga0114129_11027223 Ga0114129_110272231 174
33 3300042139 Ga0450904_015557 Ga0450904_015557_102_626 174
34 3300049161 Ga0501305_055141 Ga0501305_055141_11_535 174
35 3300049573 Ga0501037_0221877 Ga0501037_0221877_763_1320 175
36 3300050489 nmdc:mga03683_114162_c1 nmdc:mga03683_114162_c1_186_749 175
37 3300005455 Ga0070663_100064872 Ga0070663_1000648723 176
38 3300003203 JGI25406J46586_10000467 JGI25406J46586_100004679 177
39 3300005334 Ga0068869_101253466 Ga0068869_1012534661 177
40 3300005347 Ga0070668_100526645 Ga0070668_1005266452 177
41 3300005548 Ga0070665_100199307 Ga0070665_1001993073 177
42 3300005841 Ga0068863_100312878 Ga0068863_1003128782 177
43 3300005985 Ga0081539_10001207 Ga0081539_1000120711 177
44 3300006177 Ga0075362_10142829 Ga0075362_101428291 177
45 3300007076 Ga0075435_100137075 Ga0075435_1001370752 177
46 3300009148 Ga0105243_11195337 Ga0105243_111953372 177
47 3300011119 Ga0105246_10368506 Ga0105246_103685062 177
48 3300021384 Ga0213876_10263400 Ga0213876_102634002 177
49 3300021388 Ga0213875_10052836 Ga0213875_100528361 177
50 3300021388 Ga0213875_10170535 Ga0213875_101705351 177
51 3300025924 Ga0207694_10343636 Ga0207694_103436362 177
52 3300026088 Ga0207641_10649548 Ga0207641_106495482 177
53 3300028379 Ga0268266_10404606 Ga0268266_104046062 177
54 3300037853 Ga0436364_1080787 Ga0436364_1080787_28735_29301 177
55 3300049569 Ga0501032_0120847 Ga0501032_0120847_680_1225 177
56 3300049581 Ga0501047_0208394 Ga0501047_0208394_215_760 177
57 3300050491 nmdc:mga00v17_349468_c1 nmdc:mga00v17_349468_c1_25_579 177
58 3300050515 nmdc:mga0a205_889552_c1 nmdc:mga0a205_889552_c1_67_618 177
59 iso_pu_bacteria 2522572158 2523103935 177
60 3300005436 Ga0070713_100981335 Ga0070713_1009813351 178
61 3300014497 Ga0182008_10154924 Ga0182008_101549242 178
62 3300025928 Ga0207700_10898399 Ga0207700_108983992 178
63 3300028800 Ga0265338_10016849 Ga0265338_100168496 178
64 3300037853 Ga0436364_0173332 Ga0436364_0173332_9087_9656 178
65 3300038735 Ga0400485_11471 Ga0400485_11471_596_1156 178
66 iso_pu_bacteria 2842333319 2842333825 178
67 3300005329 Ga0070683_100405209 Ga0070683_1004052092 179
68 3300005336 Ga0070680_100244625 Ga0070680_1002446252 179
69 3300005435 Ga0070714_100518318 Ga0070714_1005183181 179
70 3300005436 Ga0070713_100097161 Ga0070713_1000971612 179
71 3300005437 Ga0070710_10104473 Ga0070710_101044731 179
72 3300005439 Ga0070711_100061538 Ga0070711_1000615384 179
73 3300005456 Ga0070678_100026393 Ga0070678_1000263934 179
74 3300005530 Ga0070679_100333320 Ga0070679_1003333202 179
75 3300005563 Ga0068855_100710581 Ga0068855_1007105811 179
76 3300005614 Ga0068856_100869100 Ga0068856_1008691002 179
77 3300005843 Ga0068860_100994012 Ga0068860_1009940122 179
78 3300005937 Ga0081455_10152460 Ga0081455_101524602 179
79 3300006028 Ga0070717_10104760 Ga0070717_101047604 179
80 3300006173 Ga0070716_100194228 Ga0070716_1001942283 179
81 3300006358 Ga0068871_100773095 Ga0068871_1007730952 179
82 3300009093 Ga0105240_10722216 Ga0105240_107222161 179
83 3300010375 Ga0105239_10130640 Ga0105239_101306403 179
84 3300010375 Ga0105239_10575223 Ga0105239_105752232 179
85 3300013105 Ga0157369_10672284 Ga0157369_106722842 179
86 3300014325 Ga0163163_10410175 Ga0163163_104101752 179
87 3300014969 Ga0157376_10073660 Ga0157376_100736603 179
88 3300020081 Ga0206354_10809147 Ga0206354_108091472 179
89 3300020082 Ga0206353_10244524 Ga0206353_102445242 179
90 3300021388 Ga0213875_10049478 Ga0213875_100494783 179
91 3300024225 Ga0224572_1056722 Ga0224572_10567221 179
92 3300025898 Ga0207692_10029610 Ga0207692_100296103 179
93 3300025915 Ga0207693_10300576 Ga0207693_103005763 179
94 3300025921 Ga0207652_10372186 Ga0207652_103721862 179
95 3300025928 Ga0207700_10111174 Ga0207700_101111743 179
96 3300025939 Ga0207665_10223974 Ga0207665_102239742 179
97 3300026078 Ga0207702_10138512 Ga0207702_101385122 179
98 3300026078 Ga0207702_10350988 Ga0207702_103509883 179
99 3300026078 Ga0207702_10534641 Ga0207702_105346412 179
100 3300026121 Ga0207683_10038897 Ga0207683_100388973 179
101 3300028381 Ga0268264_10570942 Ga0268264_105709422 179
102 3300035083 Ga0373926_0032153 Ga0373926_0032153_204_776 179
103 3300035086 Ga0373934_0066532 Ga0373934_0066532_717_1289 179
104 3300035116 Ga0373945_0146625 Ga0373945_0146625_252_824 179
105 3300035116 Ga0373945_0251108 Ga0373945_0251108_98_670 179
106 3300035117 Ga0373953_0090678 Ga0373953_0090678_158_730 179
107 3300035118 Ga0373954_0182523 Ga0373954_0182523_266_838 179
108 3300035119 Ga0373956_0071723 Ga0373956_0071723_763_1335 179
109 3300035120 Ga0373957_0008548 Ga0373957_0008548_711_1283 179
110 3300035170 Ga0373943_0098734 Ga0373943_0098734_469_1041 179
111 3300035171 Ga0373946_0068278 Ga0373946_0068278_927_1499 179
112 3300035172 Ga0373955_0034820 Ga0373955_0034820_1051_1623 179
113 3300035410 Ga0373924_0187966 Ga0373924_0187966_14_586 179
114 3300035692 Ga0373935_0047365 Ga0373935_0047365_804_1376 179
115 3300035692 Ga0373935_0154507 Ga0373935_0154507_847_1419 179
116 3300035692 Ga0373935_0613084 Ga0373935_0613084_116_688 179
117 3300035695 Ga0373927_0103409 Ga0373927_0103409_28_600 179
118 3300035695 Ga0373927_0206072 Ga0373927_0206072_143_715 179
119 3300035724 Ga0373933_0128576 Ga0373933_0128576_146_718 179
120 3300035725 Ga0373947_0019452 Ga0373947_0019452_3264_3836 179
121 3300035725 Ga0373947_0220419 Ga0373947_0220419_96_668 179
122 3300036401 Ga0373937_0003351 Ga0373937_0003351_8701_9273 179
123 3300036401 Ga0373937_0029460 Ga0373937_0029460_3145_3717 179
124 3300036401 Ga0373937_0061307 Ga0373937_0061307_821_1393 179
125 3300037068 Ga0373925_0122345 Ga0373925_0122345_283_855 179
126 3300037068 Ga0373925_0127058 Ga0373925_0127058_109_681 179
127 3300037068 Ga0373925_0276368 Ga0373925_0276368_721_1293 179
128 3300037068 Ga0373925_0589284 Ga0373925_0589284_210_782 179
129 3300037853 Ga0436364_1089933 Ga0436364_1089933_3275_3856 179
130 3300037853 Ga0436364_1173139 Ga0436364_1173139_811_1383 179
131 3300037853 Ga0436364_1392850 Ga0436364_1392850_611_1183 179
132 3300039437 Ga0436365_0633000 Ga0436365_0633000_240_821 179
133 3300039450 Ga0436363_1709026 Ga0436363_1709026_149_721 179
134 3300039453 Ga0436362_0047167 Ga0436362_0047167_273_845 179
135 3300046454 Ga0495592_0314331 Ga0495592_0314331_345_917 179
136 3300046459 Ga0495629_0345045 Ga0495629_0345045_340_912 179
137 3300046459 Ga0495629_0350577 Ga0495629_0350577_80_652 179
138 3300046462 Ga0495651_0012921 Ga0495651_0012921_5763_6335 179
139 3300046462 Ga0495651_0354674 Ga0495651_0354674_281_853 179
140 3300046462 Ga0495651_0492976 Ga0495651_0492976_186_758 179
141 3300046472 Ga0495580_0729188 Ga0495580_0729188_17_589 179
142 3300046476 Ga0495662_0026068 Ga0495662_0026068_1257_1829 179
143 3300046477 Ga0495664_0000424 Ga0495664_0000424_3506_4078 179
144 3300046529 Ga0495652_0042204 Ga0495652_0042204_2950_3522 179
145 3300046533 Ga0495640_0073606 Ga0495640_0073606_284_856 179
146 3300046536 Ga0495587_0202527 Ga0495587_0202527_156_728 179
147 3300046543 Ga0495645_0000661 Ga0495645_0000661_11489_12061 179
148 3300046543 Ga0495645_0197922 Ga0495645_0197922_337_909 179
149 3300046559 Ga0495667_0048799 Ga0495667_0048799_669_1241 179
150 3300046675 Ga0495657_0180563 Ga0495657_0180563_273_845 179
151 3300046678 Ga0495599_0020129 Ga0495599_0020129_462_1034 179
152 3300046679 Ga0495623_0013411 Ga0495623_0013411_3320_3892 179
153 3300046680 Ga0495646_0012466 Ga0495646_0012466_4689_5261 179
154 3300046689 Ga0495613_0607733 Ga0495613_0607733_89_661 179
155 3300047319 Ga0495674_0011945 Ga0495674_0011945_4909_5481 179
156 3300047319 Ga0495674_0070621 Ga0495674_0070621_141_713 179
157 3300047322 Ga0495680_0084707 Ga0495680_0084707_1591_2163 179
158 3300047322 Ga0495680_0184758 Ga0495680_0184758_827_1399 179
159 3300047471 Ga0495684_0017022 Ga0495684_0017022_614_1186 179
160 3300048088 Ga0495602_0003478 Ga0495602_0003478_5916_6488 179
161 3300048915 Ga0496112_0217139 Ga0496112_0217139_1284_1856 179
162 3300048922 Ga0496119_0041887 Ga0496119_0041887_1295_1879 179
163 3300048923 Ga0496120_0155176 Ga0496120_0155176_51_635 179
164 3300053077 Ga0495601_0008145 Ga0495601_0008145_348_920 179
165 3300053084 Ga0495595_0024707 Ga0495595_0024707_323_895 179
166 3300053085 Ga0495619_0041723 Ga0495619_0041723_1897_2469 179
167 3300036401 Ga0373937_0157076 Ga0373937_0157076_731_1312 180
168 3300049568 Ga0501031_0049352 Ga0501031_0049352_1923_2495 180
169 3300049569 Ga0501032_0256463 Ga0501032_0256463_214_786 180
170 3300049570 Ga0501033_0020781 Ga0501033_0020781_233_805 180
171 3300049571 Ga0501034_0021272 Ga0501034_0021272_1723_2295 180
172 3300049572 Ga0501036_0118490 Ga0501036_0118490_1456_2007 180
173 3300049572 Ga0501036_0145609 Ga0501036_0145609_1263_1835 180
174 3300049575 Ga0501039_0028844 Ga0501039_0028844_3214_3786 180
175 3300049578 Ga0501042_0025835 Ga0501042_0025835_2818_3369 180
176 3300049579 Ga0501043_0451479 Ga0501043_0451479_71_643 180
177 3300049581 Ga0501047_0005846 Ga0501047_0005846_6526_7098 180
178 3300049581 Ga0501047_0334845 Ga0501047_0334845_127_699 180
179 3300049582 Ga0501048_0423586 Ga0501048_0423586_70_642 180
180 3300049586 Ga0501070_0031872 Ga0501070_0031872_483_1055 180
181 3300049587 Ga0501071_0117119 Ga0501071_0117119_1296_1847 180
182 3300049742 Ga0501080_0638273 Ga0501080_0638273_139_711 180
183 3300049822 Ga0501035_0124356 Ga0501035_0124356_1504_2076 180
184 3300049823 Ga0501044_0006787 Ga0501044_0006787_3991_4563 180
185 3300054114 Ga0501084_1300410 Ga0501084_1300410_24_575 180
186 iso_pu_bacteria 2828305725 2828305792 180
187 3300003574 Ga0007410J51695_1033050 Ga0007410J51695_10330502 181
188 3300035691 Ga0373931_0026581 Ga0373931_0026581_626_1201 181
189 3300003544 Ga0007417J51691_1045094 Ga0007417J51691_10450941 182
190 3300006846 Ga0075430_100632382 Ga0075430_1006323821 182
191 3300029276 Ga0311004_103845 Ga0311004_1038452 182
192 3300031903 Ga0307407_10303542 Ga0307407_103035422 182
193 3300049589 Ga0501073_0220639 Ga0501073_0220639_618_1181 182
194 3300037853 Ga0436364_1189942 Ga0436364_1189942_727_1335 186
195 3300041410 Ga0439461_0104248 Ga0439461_0104248_28_588 186
196 3300050509 nmdc:mga0qj67_1050216_c1 nmdc:mga0qj67_1050216_c1_66_626 186
197 3300038726 Ga0400490_01207 Ga0400490_01207_1636_2235 189
198 3300038742 Ga0400486_15526 Ga0400486_15526_784_1383 189
199 3300003162 Ga0006778J45830_1042871 Ga0006778J45830_10428711 195
200 3300031852 Ga0307410_10457614 Ga0307410_104576142 195
201 3300041999 Ga0439433_0042090 Ga0439433_0042090_153_740 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00160

Pro_isomerase

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

45

193

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xyh-assembly1.cif.gz_A crystal structure of recombinant human cyclophilin j 0.9126 43 190
2igw-assembly1.cif.gz_A cyclophilin 3 complexed with dipeptide gly-pro 0.898 43 189
1zmf-assembly1.cif.gz_A c domain of human cyclophilin-33(hcyp33) 0.8957 43 189
8g9q-assembly1.cif.gz_D tricomplex of compound-1, kras g12c, and cypa 0.8939 43 189
4i9y-assembly6.cif.gz_F structure of the c-terminal domain of nup358 0.8897 43 189
ID Description Score Start End Superfamily
af_A0A0R0L6H2_25_167_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9255 43 167 2.40.100.10
af_A4IBQ0_1_166_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9207 43 159 2.40.100.10
1xyhA00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9126 43 190 2.40.100.10
af_A0A0R4J2Z8_2_164_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.9045 43 189 2.40.100.10
af_Q7K2I4_1_164_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.883 43 189 2.40.100.10
ID Description Score Start End GO Terms
AF-W9H1Z8-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9761 38 195 GO:0006457
GO:0140839
GO:0140840
AF-A0A522A6C1-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9723 38 193 GO:0140839
GO:0140840
AF-A0A1Y5FRD3-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9708 34 195 GO:0140839
GO:0140840
AF-W9H1Z8-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.97 38 195 GO:0006457
GO:0140839
GO:0140840
AF-A0A1Q6UBS2-F1-model_v4 Peptidyl-prolyl cis-trans isomerase (PPIase) (EC 5.2.1.8) 0.9699 39 194 GO:0006457
GO:0140839
GO:0140840

Feature Viewer

pLDDT pTM Quality
83.91 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map