F307508

General Info

Members Datasets Scaffolds Average Seq Length
200 133 183 152

Family's Representative Sequence

Representative Sequence 3300041405|Ga0439438_002783|Ga0439438_002783_3451_3936
Length 161
Sequence MDRAEVTNRLETLEDWAAGLLGQLEPASRNKLARSIGQALRRSQQQRIIAQRNPDGSKYAPRKQRNLRGKQGRVKRKVQMFQKLRTASFLKVQGDGNAISVGFTGRIARIARVHQHGLKDRAERGAPDVKYEQREVLGFTDAEHDLIRDFLVDHFAQLQPW

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2519103095 Burkholderia sp. KJ006 Isolate Nodule
5 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
6 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
7 2773857670 Pseudomonas sp. 478 Isolate Unclassified
8 2784132063 Pseudomonas sp. 424 Isolate Unclassified
9 2784132072 Pseudomonas sp. 460 Isolate Unclassified
10 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
11 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
12 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
13 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
14 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
15 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
16 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
17 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
18 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
19 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
20 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
21 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
50 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
61 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
62 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
63 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
64 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
65 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
66 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
67 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
68 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
69 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
70 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
71 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
72 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
73 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
74 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
75 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
76 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
77 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
78 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
79 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
84 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
87 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
88 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
89 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
90 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
91 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
94 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
95 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
101 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
102 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
103 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
104 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
105 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
106 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
107 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
116 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
117 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
118 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
119 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
120 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
121 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
122 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
129 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
130 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
131 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
132 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
133 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.5
Metatranscriptomes 0
Isolates 8.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.5
Nodule 2
Rhizoplane 1
Rhizosphere 78.5
Stem 0
Stem Tuber 0
Unclassified 12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_6816 2124908027 Bacteria 5482
2 MRS1b_contig_3527482 2162886011 Bacteria 2148
3 JGI25162J39368_1001201 3300002737 Bacteria 15116
4 JGI25163J39215_1000357 3300002771 Bacteria 15009
5 JGI25164J39214_1000618 3300002772 Bacteria 15116
6 JGI25165J46597_1001240 3300003214 Bacteria 15116
7 rootL2_10055997 3300003322 Bacteria 4482
8 Ga0055527_1005455 3300003760 Bacteria 1654
9 Ga0065714_10002247 3300005288 Bacteria 35975
10 Ga0065714_10003904 3300005288 Bacteria 6754
11 Ga0065714_10007214 3300005288 Bacteria 3456
12 Ga0065714_10064966 3300005288 Bacteria 14782
13 Ga0065714_10071675 3300005288 Bacteria 3518
14 Ga0065714_10080112 3300005288 Bacteria 2459
15 Ga0065714_10187545 3300005288 Bacteria 939
16 Ga0065712_10125371 3300005290 Bacteria 1614
17 Ga0068851_10000238 3300005834 Bacteria 25999
18 Ga0075364_10061625 3300006051 Bacteria 2461
19 Ga0075432_10000029 3300006058 Bacteria 26660
20 Ga0075436_100880339 3300006914 Bacteria 669
21 Ga0079104_1000213 3300006946 Bacteria 81349
22 Ga0105244_10005022 3300009036 Bacteria 8908
23 Ga0105250_10001555 3300009092 Bacteria 12328
24 Ga0105250_10013586 3300009092 Bacteria 3355
25 Ga0105250_10042974 3300009092 Bacteria 1811
26 Ga0105240_10619203 3300009093 Bacteria 1190
27 Ga0105237_10040311 3300009545 Bacteria 4710
28 Ga0157373_10001161 3300013100 Bacteria 20181
29 Ga0157373_10004055 3300013100 Bacteria 11037
30 Ga0157373_10089358 3300013100 Bacteria 2170
31 Ga0157371_10004525 3300013102 Bacteria 12112
32 Ga0157371_10004738 3300013102 Bacteria 11741
33 Ga0157371_10011434 3300013102 Bacteria 6838
34 Ga0157371_10021053 3300013102 Bacteria 4794
35 Ga0157371_10057198 3300013102 Bacteria 2766
36 Ga0157371_10063017 3300013102 Bacteria 2628
37 Ga0157370_10011677 3300013104 Bacteria 9169
38 Ga0157370_10116635 3300013104 Bacteria 2494
39 Ga0157370_10124751 3300013104 Bacteria 2404
40 Ga0157369_10002090 3300013105 Bacteria 24149
41 Ga0163162_10014959 3300013306 Bacteria 7578
42 Ga0157375_10794726 3300013308 Bacteria 1095
43 Ga0182008_10000440 3300014497 Bacteria 31545
44 Ga0182008_10001637 3300014497 Bacteria 14811
45 Ga0182008_10008480 3300014497 Bacteria 5611
46 Ga0182008_10013385 3300014497 Bacteria 4314
47 Ga0182008_10048147 3300014497 Bacteria 2117
48 Ga0182008_10321415 3300014497 Bacteria 814
49 Ga0182006_1000336 3300015261 Bacteria 40117
50 Ga0182006_1000494 3300015261 Bacteria 30731
51 Ga0182006_1025497 3300015261 Bacteria 2428
52 Ga0182007_10000336 3300015262 Bacteria 29777
53 Ga0182007_10004691 3300015262 Bacteria 6162
54 Ga0182007_10024073 3300015262 Bacteria 2135
55 Ga0182005_1000479 3300015265 Bacteria 20684
56 Ga0182005_1153835 3300015265 Bacteria 671
57 Ga0163161_10000558 3300017792 Bacteria 29997
58 Ga0163161_10317005 3300017792 Bacteria 1232
59 Ga0209760_100079 3300025207 Bacteria 77345
60 Ga0209672_100236 3300025228 Bacteria 42014
61 Ga0207427_100001 3300025231 Bacteria 1410763
62 Ga0209437_100003 3300025233 Bacteria 1517827
63 Ga0209233_1000007 3300025261 Bacteria 1411234
64 Ga0207656_10000086 3300025321 Bacteria 34526
65 Ga0207696_1012377 3300025711 Bacteria 3018
66 Ga0207655_1000368 3300025728 Bacteria 63458
67 Ga0207695_10651072 3300025913 Bacteria 934
68 Ga0207671_10083284 3300025914 Bacteria 2401
69 Ga0209281_1000011 3300027111 Bacteria 695292
70 Ga0207428_10000817 3300027907 Bacteria 35134
71 Ga0307408_100003009 3300031548 Bacteria 11654
72 Ga0307514_10268315 3300031649 Bacteria 991
73 Ga0307412_11305754 3300031911 Bacteria 653
74 Ga0439438_000482 3300041405 Bacteria 18062
75 Ga0439438_002783 3300041405 Bacteria 7322
76 Ga0439447_000027 3300041407 Bacteria 50469
77 Ga0439447_035211 3300041407 Bacteria 1242
78 Ga0439466_0000138 3300041411 Bacteria 28784
79 Ga0439466_0008190 3300041411 Bacteria 3941
80 Ga0439431_0000010 3300041997 Bacteria 33799
81 Ga0439432_000117 3300042006 Bacteria 25873
82 Ga0439432_008274 3300042006 Bacteria 3656
83 Ga0439451_005696 3300042009 Bacteria 2548
84 Ga0439451_071215 3300042009 Bacteria 696
85 Ga0439452_001224 3300042010 Bacteria 10948
86 Ga0439452_001341 3300042010 Bacteria 10269
87 Ga0439456_000048 3300042013 Bacteria 43556
88 Ga0439456_000073 3300042013 Bacteria 35533
89 Ga0439456_000374 3300042013 Bacteria 10060
90 Ga0439456_005804 3300042013 Bacteria 2510
91 Ga0439463_001334 3300042016 Bacteria 6578
92 Ga0439463_003934 3300042016 Bacteria 3737
93 Ga0439463_008374 3300042016 Bacteria 2549
94 Ga0450919_035630 3300042121 Bacteria 574
95 Ga0450920_000040 3300042122 Bacteria 15762
96 Ga0450922_000036 3300042124 Bacteria 11720
97 Ga0450907_000075 3300042146 Bacteria 37674
98 Ga0450910_000008 3300042147 Bacteria 39330
99 Ga0450908_000022 3300042184 Bacteria 37153
100 Ga0450909_050363 3300042185 Bacteria 649
101 Ga0439440_0000424 3300042993 Bacteria 7061
102 Ga0466972_0331687 3300044658 Bacteria 711
103 Ga0466958_0063082 3300045836 Bacteria 2260
104 Ga0495617_000649 3300046452 Bacteria 17435
105 Ga0495617_035625 3300046452 Bacteria 1671
106 Ga0495638_0061856 3300046460 Bacteria 2312
107 Ga0495653_0001209 3300046463 Bacteria 19997
108 Ga0495653_0002454 3300046463 Bacteria 14733
109 Ga0495653_0041157 3300046463 Bacteria 3608
110 Ga0495650_0000294 3300046471 Bacteria 91542
111 Ga0495650_0015651 3300046471 Bacteria 3880
112 Ga0495605_0121450 3300046474 Bacteria 1184
113 Ga0495606_0001579 3300046507 Bacteria 29835
114 Ga0495610_0000988 3300046512 Bacteria 26225
115 Ga0495616_0064374 3300046513 Bacteria 1789
116 Ga0495616_0092689 3300046513 Bacteria 1428
117 Ga0495628_0504386 3300046516 Viruses 873
118 Ga0495630_0016872 3300046517 Bacteria 5343
119 Ga0495632_0004267 3300046519 Bacteria 9758
120 Ga0495632_0094565 3300046519 Bacteria 1413
121 Ga0495643_0346904 3300046522 Bacteria 666
122 Ga0495648_0000175 3300046524 Bacteria 74095
123 Ga0495648_0000260 3300046524 Bacteria 59856
124 Ga0495666_0000208 3300046526 Bacteria 24982
125 Ga0495666_0064932 3300046526 Bacteria 1742
126 Ga0495654_0002393 3300046530 Bacteria 12101
127 Ga0495654_0009325 3300046530 Bacteria 5379
128 Ga0495654_0015652 3300046530 Bacteria 4026
129 Ga0495587_0000256 3300046536 Bacteria 38302
130 Ga0495597_0011579 3300046542 Bacteria 4272
131 Ga0495622_0009007 3300046557 Bacteria 4622
132 Ga0495622_0061484 3300046557 Bacteria 1739
133 Ga0495625_0000940 3300046660 Bacteria 39084
134 Ga0495625_0001052 3300046660 Bacteria 36208
135 Ga0495625_0455340 3300046660 Bacteria 790
136 Ga0495659_0085715 3300046664 Bacteria 1202
137 Ga0495623_0000419 3300046679 Bacteria 27995
138 Ga0495646_0000121 3300046680 Bacteria 38979
139 Ga0495669_0100274 3300046684 Bacteria 1344
140 Ga0495613_0019227 3300046689 Bacteria 5093
141 Ga0495624_0000344 3300046690 Bacteria 36909
142 Ga0495670_0227460 3300046691 Bacteria 991
143 Ga0495671_0000114 3300046692 Bacteria 72267
144 Ga0495671_0000993 3300046692 Bacteria 19779
145 Ga0495671_0027119 3300046692 Bacteria 2961
146 Ga0495671_0255275 3300046692 Bacteria 846
147 Ga0495649_0002272 3300046694 Bacteria 13652
148 Ga0495649_0042740 3300046694 Bacteria 2475
149 Ga0495649_0360972 3300046694 Bacteria 733
150 Ga0495660_0135125 3300046810 Bacteria 1233
151 Ga0495604_0000461 3300047317 Bacteria 36131
152 Ga0495672_0000616 3300047320 Bacteria 39736
153 Ga0495680_0000619 3300047322 Bacteria 40007
154 Ga0495683_0111392 3300047323 Bacteria 1306
155 Ga0495675_0084469 3300047444 Bacteria 1997
156 Ga0495679_000310 3300047446 Bacteria 39018
157 Ga0495673_0000198 3300047469 Bacteria 93985
158 Ga0495673_0057401 3300047469 Bacteria 1681
159 Ga0495681_0003796 3300047470 Bacteria 10467
160 Ga0495686_0000731 3300047472 Bacteria 43974
161 Ga0495686_0000745 3300047472 Bacteria 43335
162 Ga0495626_0000229 3300048091 Bacteria 65975
163 Ga0496117_0000849 3300048920 Bacteria 47293
164 Ga0496117_0001076 3300048920 Bacteria 41369
165 Ga0496117_0009413 3300048920 Bacteria 9092
166 Ga0496118_0000293 3300048921 Bacteria 86751
167 Ga0496118_0001122 3300048921 Bacteria 41463
168 Ga0496118_0012552 3300048921 Bacteria 8115
169 Ga0496119_0000866 3300048922 Bacteria 39894
170 Ga0496120_0000831 3300048923 Bacteria 44084
171 Ga0496121_0000299 3300048924 Bacteria 103000
172 Ga0496121_0001353 3300048924 Bacteria 41915
173 Ga0496122_0002544 3300048925 Bacteria 25640
174 Ga0496122_0012214 3300048925 Bacteria 8587
175 Ga0496123_0012336 3300048926 Bacteria 7296
176 Ga0496123_0024969 3300048926 Bacteria 4521
177 Ga0496124_0010651 3300048927 Bacteria 9278
178 Ga0496125_0004154 3300048928 Bacteria 16887
179 Ga0496125_0253212 3300048928 Bacteria 1109
180 Ga0501259_203483 3300049688 Bacteria 508
181 nmdc:mga00v17_38199_c1 3300050491 Bacteria 2870
182 nmdc:mga08x19_307168_c1 3300050514 Bacteria 1102
183 Ga0500572_006940 3300053111 Bacteria 2608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014497 Ga0182008_10321415 Ga0182008_103214152 130
2 3300042013 Ga0439456_000374 Ga0439456_000374_3906_4391 141
3 3300046474 Ga0495605_0121450 Ga0495605_0121450_108_563 141
4 3300046692 Ga0495671_0027119 Ga0495671_0027119_1896_2351 141
5 3300046810 Ga0495660_0135125 Ga0495660_0135125_652_1107 141
6 3300047470 Ga0495681_0003796 Ga0495681_0003796_8789_9244 141
7 3300009092 Ga0105250_10001555 Ga0105250_1000155515 142
8 3300013104 Ga0157370_10116635 Ga0157370_101166352 142
9 3300015261 Ga0182006_1000336 Ga0182006_100033630 142
10 3300031911 Ga0307412_11305754 Ga0307412_113057541 142
11 3300047320 Ga0495672_0000616 Ga0495672_0000616_26866_27339 142
12 3300048920 Ga0496117_0000849 Ga0496117_0000849_22027_22491 142
13 3300048920 Ga0496117_0009413 Ga0496117_0009413_4969_5397 142
14 3300048921 Ga0496118_0000293 Ga0496118_0000293_61477_61941 142
15 3300048921 Ga0496118_0012552 Ga0496118_0012552_4941_5369 142
16 3300048925 Ga0496122_0012214 Ga0496122_0012214_3140_3568 142
17 3300048926 Ga0496123_0024969 Ga0496123_0024969_2747_3175 142
18 3300048927 Ga0496124_0010651 Ga0496124_0010651_4969_5397 142
19 3300046452 Ga0495617_035625 Ga0495617_035625_69_548 145
20 iso_pu_bacteria 2519103095 2519461272 145
21 iso_pu_bacteria 2928157003 2928157609 145
22 3300042016 Ga0439463_008374 Ga0439463_008374_1637_2116 146
23 iso_pu_bacteria 2599185319 2600039667 147
24 iso_pu_bacteria 2917070673 2917072793 147
25 iso_pu_bacteria 8019769354 8019775478 147
26 iso_pu_bacteria 2511231006 2511264110 148
27 iso_pu_bacteria 2773857670 2774120521 148
28 iso_pu_bacteria 2784132063 2784263582 148
29 iso_pu_bacteria 2784132072 2784312994 148
30 iso_pu_bacteria 2808606376 2808925733 148
31 iso_pu_bacteria 2808606380 2808947834 148
32 iso_pu_bacteria 2816332298 2817489640 148
33 iso_pu_bacteria 2923586266 2923587055 148
34 iso_pu_bacteria 2998139840 2998143771 148
35 3300003322 rootL2_10055997 rootL2_100559976 149
36 3300003760 Ga0055527_1005455 Ga0055527_10054553 149
37 3300009093 Ga0105240_10619203 Ga0105240_106192032 149
38 3300009545 Ga0105237_10040311 Ga0105237_100403118 149
39 3300013102 Ga0157371_10021053 Ga0157371_100210535 149
40 3300013104 Ga0157370_10011677 Ga0157370_1001167710 149
41 3300013308 Ga0157375_10794726 Ga0157375_107947262 149
42 3300014497 Ga0182008_10008480 Ga0182008_100084803 149
43 3300015262 Ga0182007_10024073 Ga0182007_100240733 149
44 3300015265 Ga0182005_1000479 Ga0182005_100047921 149
45 3300025228 Ga0209672_100236 Ga0209672_10023625 149
46 3300025913 Ga0207695_10651072 Ga0207695_106510722 149
47 3300025914 Ga0207671_10083284 Ga0207671_100832842 149
48 3300044658 Ga0466972_0331687 Ga0466972_0331687_233_682 149
49 3300045836 Ga0466958_0063082 Ga0466958_0063082_1323_1772 149
50 3300002737 JGI25162J39368_1001201 JGI25162J39368_100120116 151
51 3300002771 JGI25163J39215_1000357 JGI25163J39215_10003577 151
52 3300002772 JGI25164J39214_1000618 JGI25164J39214_10006187 151
53 3300003214 JGI25165J46597_1001240 JGI25165J46597_10012407 151
54 3300006914 Ga0075436_100880339 Ga0075436_1008803392 151
55 3300009092 Ga0105250_10042974 Ga0105250_100429742 151
56 3300013306 Ga0163162_10014959 Ga0163162_100149599 151
57 3300014497 Ga0182008_10001637 Ga0182008_100016379 151
58 3300015262 Ga0182007_10004691 Ga0182007_100046917 151
59 3300017792 Ga0163161_10317005 Ga0163161_103170053 151
60 3300025207 Ga0209760_100079 Ga0209760_10007976 151
61 3300025231 Ga0207427_100001 Ga0207427_1000011265 151
62 3300025233 Ga0209437_100003 Ga0209437_100003107 151
63 3300025261 Ga0209233_1000007 Ga0209233_10000071265 151
64 3300041405 Ga0439438_000482 Ga0439438_000482_9772_10227 151
65 3300041997 Ga0439431_0000010 Ga0439431_0000010_22806_23276 151
66 3300046452 Ga0495617_000649 Ga0495617_000649_10481_10936 151
67 3300046471 Ga0495650_0015651 Ga0495650_0015651_2639_3106 151
68 3300046507 Ga0495606_0001579 Ga0495606_0001579_7400_7867 151
69 3300046513 Ga0495616_0092689 Ga0495616_0092689_648_1103 151
70 3300046519 Ga0495632_0004267 Ga0495632_0004267_5116_5571 151
71 3300046519 Ga0495632_0094565 Ga0495632_0094565_208_675 151
72 3300046522 Ga0495643_0346904 Ga0495643_0346904_138_593 151
73 3300046530 Ga0495654_0002393 Ga0495654_0002393_8176_8631 151
74 3300046530 Ga0495654_0015652 Ga0495654_0015652_3080_3547 151
75 3300046542 Ga0495597_0011579 Ga0495597_0011579_497_952 151
76 3300046557 Ga0495622_0061484 Ga0495622_0061484_862_1317 151
77 3300046660 Ga0495625_0000940 Ga0495625_0000940_25743_26198 151
78 3300046660 Ga0495625_0001052 Ga0495625_0001052_17829_18284 151
79 3300046684 Ga0495669_0100274 Ga0495669_0100274_47_502 151
80 3300046692 Ga0495671_0000993 Ga0495671_0000993_12406_12861 151
81 3300046692 Ga0495671_0255275 Ga0495671_0255275_201_656 151
82 3300046694 Ga0495649_0002272 Ga0495649_0002272_1525_1992 151
83 3300046694 Ga0495649_0042740 Ga0495649_0042740_1927_2382 151
84 3300046694 Ga0495649_0360972 Ga0495649_0360972_238_693 151
85 3300047323 Ga0495683_0111392 Ga0495683_0111392_337_792 151
86 3300047444 Ga0495675_0084469 Ga0495675_0084469_1449_1904 151
87 3300047446 Ga0495679_000310 Ga0495679_000310_20091_20546 151
88 3300047472 Ga0495686_0000745 Ga0495686_0000745_20634_21089 151
89 3300048924 Ga0496121_0000299 Ga0496121_0000299_36049_36507 151
90 3300050514 nmdc:mga08x19_307168_c1 nmdc:mga08x19_307168_c1_548_1003 151
91 2124908027 MRS2a_Contig_6816 MRS2a_00671290 152
92 2162886011 MRS1b_contig_3527482 MRS1b_0235.00002930 152
93 3300005288 Ga0065714_10002247 Ga0065714_1000224732 152
94 3300005288 Ga0065714_10003904 Ga0065714_100039046 152
95 3300005288 Ga0065714_10007214 Ga0065714_100072145 152
96 3300005288 Ga0065714_10064966 Ga0065714_1006496610 152
97 3300005288 Ga0065714_10071675 Ga0065714_100716753 152
98 3300005288 Ga0065714_10080112 Ga0065714_100801123 152
99 3300005288 Ga0065714_10187545 Ga0065714_101875452 152
100 3300005290 Ga0065712_10125371 Ga0065712_101253713 152
101 3300005834 Ga0068851_10000238 Ga0068851_1000023835 152
102 3300006051 Ga0075364_10061625 Ga0075364_100616255 152
103 3300006058 Ga0075432_10000029 Ga0075432_1000002910 152
104 3300006946 Ga0079104_1000213 Ga0079104_100021342 152
105 3300009036 Ga0105244_10005022 Ga0105244_100050225 152
106 3300009092 Ga0105250_10013586 Ga0105250_100135864 152
107 3300013100 Ga0157373_10001161 Ga0157373_1000116111 152
108 3300013100 Ga0157373_10004055 Ga0157373_1000405510 152
109 3300013100 Ga0157373_10089358 Ga0157373_100893585 152
110 3300013102 Ga0157371_10004525 Ga0157371_1000452510 152
111 3300013102 Ga0157371_10004738 Ga0157371_1000473811 152
112 3300013102 Ga0157371_10011434 Ga0157371_100114349 152
113 3300013102 Ga0157371_10057198 Ga0157371_100571984 152
114 3300013102 Ga0157371_10063017 Ga0157371_100630172 152
115 3300013104 Ga0157370_10124751 Ga0157370_101247513 152
116 3300013105 Ga0157369_10002090 Ga0157369_1000209017 152
117 3300014497 Ga0182008_10000440 Ga0182008_1000044010 152
118 3300014497 Ga0182008_10013385 Ga0182008_100133856 152
119 3300014497 Ga0182008_10048147 Ga0182008_100481471 152
120 3300015261 Ga0182006_1000494 Ga0182006_100049412 152
121 3300015261 Ga0182006_1025497 Ga0182006_10254974 152
122 3300015262 Ga0182007_10000336 Ga0182007_1000033632 152
123 3300015265 Ga0182005_1153835 Ga0182005_11538351 152
124 3300017792 Ga0163161_10000558 Ga0163161_1000055815 152
125 3300025321 Ga0207656_10000086 Ga0207656_1000008643 152
126 3300025711 Ga0207696_1012377 Ga0207696_10123773 152
127 3300025728 Ga0207655_1000368 Ga0207655_100036858 152
128 3300027111 Ga0209281_1000011 Ga0209281_1000011137 152
129 3300027907 Ga0207428_10000817 Ga0207428_1000081717 152
130 3300031548 Ga0307408_100003009 Ga0307408_1000030096 152
131 3300031649 Ga0307514_10268315 Ga0307514_102683152 152
132 3300041405 Ga0439438_002783 Ga0439438_002783_3451_3936 152
133 3300041407 Ga0439447_000027 Ga0439447_000027_29714_30175 152
134 3300041407 Ga0439447_035211 Ga0439447_035211_369_839 152
135 3300041411 Ga0439466_0000138 Ga0439466_0000138_27610_28074 152
136 3300041411 Ga0439466_0008190 Ga0439466_0008190_547_1026 152
137 3300042006 Ga0439432_000117 Ga0439432_000117_12593_13057 152
138 3300042006 Ga0439432_008274 Ga0439432_008274_176_643 152
139 3300042009 Ga0439451_005696 Ga0439451_005696_1132_1605 152
140 3300042009 Ga0439451_071215 Ga0439451_071215_136_609 152
141 3300042010 Ga0439452_001224 Ga0439452_001224_6209_6688 152
142 3300042010 Ga0439452_001341 Ga0439452_001341_3597_4070 152
143 3300042013 Ga0439456_000048 Ga0439456_000048_31107_31574 152
144 3300042013 Ga0439456_000073 Ga0439456_000073_24366_24842 152
145 3300042013 Ga0439456_005804 Ga0439456_005804_282_764 152
146 3300042016 Ga0439463_001334 Ga0439463_001334_5096_5557 152
147 3300042016 Ga0439463_003934 Ga0439463_003934_2572_3048 152
148 3300042121 Ga0450919_035630 Ga0450919_035630_24_485 152
149 3300042122 Ga0450920_000040 Ga0450920_000040_9023_9484 152
150 3300042124 Ga0450922_000036 Ga0450922_000036_1158_1625 152
151 3300042146 Ga0450907_000075 Ga0450907_000075_23670_24131 152
152 3300042147 Ga0450910_000008 Ga0450910_000008_24428_24889 152
153 3300042184 Ga0450908_000022 Ga0450908_000022_25870_26331 152
154 3300042185 Ga0450909_050363 Ga0450909_050363_155_628 152
155 3300042993 Ga0439440_0000424 Ga0439440_0000424_6433_6912 152
156 3300046460 Ga0495638_0061856 Ga0495638_0061856_1263_1721 152
157 3300046463 Ga0495653_0001209 Ga0495653_0001209_16520_16993 152
158 3300046463 Ga0495653_0002454 Ga0495653_0002454_3828_4301 152
159 3300046463 Ga0495653_0041157 Ga0495653_0041157_2259_2735 152
160 3300046471 Ga0495650_0000294 Ga0495650_0000294_39726_40187 152
161 3300046512 Ga0495610_0000988 Ga0495610_0000988_20724_21188 152
162 3300046513 Ga0495616_0064374 Ga0495616_0064374_1021_1479 152
163 3300046516 Ga0495628_0504386 Ga0495628_0504386_93_566 152
164 3300046517 Ga0495630_0016872 Ga0495630_0016872_4146_4619 152
165 3300046524 Ga0495648_0000175 Ga0495648_0000175_24572_25063 152
166 3300046524 Ga0495648_0000260 Ga0495648_0000260_27509_27982 152
167 3300046526 Ga0495666_0000208 Ga0495666_0000208_10418_10891 152
168 3300046526 Ga0495666_0064932 Ga0495666_0064932_797_1261 152
169 3300046530 Ga0495654_0009325 Ga0495654_0009325_2311_2778 152
170 3300046536 Ga0495587_0000256 Ga0495587_0000256_27397_27870 152
171 3300046557 Ga0495622_0009007 Ga0495622_0009007_3639_4121 152
172 3300046660 Ga0495625_0455340 Ga0495625_0455340_61_519 152
173 3300046664 Ga0495659_0085715 Ga0495659_0085715_225_698 152
174 3300046679 Ga0495623_0000419 Ga0495623_0000419_27366_27839 152
175 3300046680 Ga0495646_0000121 Ga0495646_0000121_28074_28547 152
176 3300046689 Ga0495613_0019227 Ga0495613_0019227_2926_3399 152
177 3300046690 Ga0495624_0000344 Ga0495624_0000344_11322_11801 152
178 3300046691 Ga0495670_0227460 Ga0495670_0227460_469_933 152
179 3300046692 Ga0495671_0000114 Ga0495671_0000114_47180_47638 152
180 3300047317 Ga0495604_0000461 Ga0495604_0000461_10433_10906 152
181 3300047322 Ga0495680_0000619 Ga0495680_0000619_12143_12616 152
182 3300047469 Ga0495673_0000198 Ga0495673_0000198_51174_51632 152
183 3300047469 Ga0495673_0057401 Ga0495673_0057401_1133_1591 152
184 3300047472 Ga0495686_0000731 Ga0495686_0000731_14534_15007 152
185 3300048091 Ga0495626_0000229 Ga0495626_0000229_36852_37316 152
186 3300048920 Ga0496117_0001076 Ga0496117_0001076_10636_11106 152
187 3300048921 Ga0496118_0001122 Ga0496118_0001122_10658_11128 152
188 3300048922 Ga0496119_0000866 Ga0496119_0000866_25729_26187 152
189 3300048923 Ga0496120_0000831 Ga0496120_0000831_26406_26864 152
190 3300048924 Ga0496121_0001353 Ga0496121_0001353_28919_29392 152
191 3300048925 Ga0496122_0002544 Ga0496122_0002544_14013_14474 152
192 3300048926 Ga0496123_0012336 Ga0496123_0012336_6648_7109 152
193 3300048928 Ga0496125_0004154 Ga0496125_0004154_5136_5594 152
194 3300048928 Ga0496125_0253212 Ga0496125_0253212_570_1031 152
195 3300049688 Ga0501259_203483 Ga0501259_203483_14_493 152
196 3300050491 nmdc:mga00v17_38199_c1 nmdc:mga00v17_38199_c1_102_560 152
197 3300053111 Ga0500572_006940 Ga0500572_006940_732_1217 152
198 iso_pu_bacteria 2599185323 2600064504 152
199 iso_pu_bacteria 2808606378 2808934461 152
200 iso_pu_bacteria 2919481497 2919482078 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05069

Phage_tail_S

Phage virion morphogenesis family

8

156

0.96

Feature Viewer

pLDDT pTM Quality
71.28 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map