F307349

General Info

Members Datasets Scaffolds Average Seq Length
200 138 376 285

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10017301|Ga0307511_100173011
Length 334
Sequence LGPGADDEPFGTTSAPGPPFPLGERMRISATVAAVSGALVLSAFAVPAAQAAGSDAGSYRSDIAKIREAAHAASGKNSFAAATVATAADDQPYALDVTFSNLKVHGGKPIVVGAAARVSVPVTYTLTHGADVDVTASDFWTDLYLYKGSLDSPTNMLFGDDLATCTATSTTVASCKGTIDIYPDLGDLSSTDAGVWRAGAEAIAWNGQDPTSGSIDITKVGYADKGGFASPNVQRLSKLTVNAAPEPVKKGKTITVTGKLTRANWDTNKYAGYSTQPVKLQFRKKNSSTYTTVKTIGNLKTTVKATADGYFRYSFAGTSTTPAVNATGDYVDVK

Samples

Sample ID Description Type Environment
1 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
6 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
7 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
8 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
9 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
10 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
11 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
12 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
13 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
14 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
15 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
17 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
18 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
19 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
20 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
21 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
22 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
23 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
24 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
25 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
26 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
27 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
28 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
29 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
30 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
31 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
32 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
33 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
34 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
35 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
36 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
37 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
38 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
39 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
40 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
41 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
42 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
43 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
44 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
45 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
46 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
47 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
48 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
49 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
50 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
51 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
52 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
53 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
54 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
55 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
56 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
57 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
58 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
59 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
60 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
61 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
62 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
63 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
64 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
65 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
66 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
67 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
68 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
69 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
70 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
71 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
72 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
73 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
74 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
75 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
76 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
77 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
78 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
79 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
80 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
81 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
82 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
83 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
84 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
85 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
86 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
87 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
88 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
89 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
90 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
91 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
105 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
108 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
109 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
110 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
111 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
112 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
113 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
114 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
115 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
116 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
117 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
118 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
119 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
120 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
121 2643221548 Streptomyces sp. Root55 Isolate Unclassified
122 2643221578 Streptomyces sp. Root63 Isolate Unclassified
123 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
124 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
125 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
126 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
127 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
128 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
129 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
130 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
131 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
132 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
133 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
134 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
135 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
136 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
137 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
138 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.5
Metatranscriptomes 0.5
Isolates 10

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.5
Nodule 1
Rhizoplane 0
Rhizosphere 76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307511_10017301 3300030521 Bacteria 6920
2 JGI24739J22299_10006400 3300001989 Bacteria 4447
3 JGI24737J22298_10017800 3300001990 Bacteria 2286
4 rootH1_10158275 3300003323 Bacteria 1230
5 Ga0075368_10007409 3300006042 Bacteria 3872
6 Ga0075363_100026626 3300006048 Bacteria 2960
7 Ga0075363_100029736 3300006048 Bacteria 2823
8 Ga0075367_10010854 3300006178 Bacteria 4800
9 Ga0105244_10051110 3300009036 Bacteria 2107
10 Ga0105246_10011578 3300011119 Bacteria 5475
11 Ga0157372_10535260 3300013307 Bacteria 1365
12 Ga0182008_10001431 3300014497 Bacteria 16003
13 Ga0182007_10001295 3300015262 Bacteria 13522
14 Ga0183367_1005 3300015688 Bacteria 652063
15 Ga0209758_1001951 3300025297 Bacteria 22297
16 Ga0207655_1073305 3300025728 Bacteria 1263
17 Ga0207647_10022767 3300025904 Bacteria 4157
18 Ga0207702_10183206 3300026078 Bacteria 1930
19 Ga0209813_10005723 3300027866 Bacteria 3032
20 Ga0307517_10005563 3300028786 Bacteria 18935
21 Ga0307515_10320343 3300028794 Bacteria 1217
22 Ga0307511_10046931 3300030521 Bacteria 3544
23 Ga0307513_10057870 3300031456 Bacteria 4125
24 Ga0307508_10003587 3300031616 Bacteria 15620
25 Ga0307508_10008335 3300031616 Bacteria 9582
26 Ga0307514_10021941 3300031649 Bacteria 5198
27 Ga0307516_10174694 3300031730 Bacteria 1886
28 Ga0307518_10009928 3300031838 Bacteria 6792
29 Ga0307507_10011359 3300033179 Bacteria 11248
30 Ga0307510_10006030 3300033180 Bacteria 14452
31 Ga0395900_0709379 3300037418 Bacteria 939
32 Ga0451853_1542209 3300041512 Bacteria 2831
33 Ga0439449_0007762 3300042007 Bacteria 4074
34 Ga0439449_0008002 3300042007 Bacteria 4016
35 Ga0450903_015184 3300042138 Bacteria 1214
36 Ga0466972_0188714 3300044658 Bacteria 966
37 Ga0466963_0002506 3300044694 Bacteria 10278
38 Ga0466970_0003671 3300044765 Bacteria 7498
39 Ga0466967_0017634 3300045976 Bacteria 5678
40 Ga0495617_065153 3300046452 Bacteria 1202
41 Ga0495617_074075 3300046452 Bacteria 1118
42 Ga0495592_0004234 3300046454 Bacteria 10480
43 Ga0495603_0006199 3300046455 Bacteria 7152
44 Ga0495603_0213825 3300046455 Bacteria 1113
45 Ga0495638_0132220 3300046460 Bacteria 1464
46 Ga0495651_0102416 3300046462 Bacteria 2129
47 Ga0495580_0056412 3300046472 Bacteria 2766
48 Ga0495580_0273389 3300046472 Bacteria 1153
49 Ga0495580_0282784 3300046472 Bacteria 1131
50 Ga0495605_0028245 3300046474 Bacteria 2897
51 Ga0495605_0031531 3300046474 Bacteria 2707
52 Ga0495662_0008175 3300046476 Bacteria 5157
53 Ga0495585_0128090 3300046492 Bacteria 1338
54 Ga0495607_0091672 3300046501 Bacteria 1645
55 Ga0495583_0018845 3300046506 Bacteria 3620
56 Ga0495583_0047506 3300046506 Bacteria 1973
57 Ga0495606_0002906 3300046507 Bacteria 18927
58 Ga0495606_0033344 3300046507 Bacteria 3552
59 Ga0495608_0178284 3300046511 Bacteria 1345
60 Ga0495618_0030962 3300046514 Bacteria 3344
61 Ga0495620_0037431 3300046515 Bacteria 2161
62 Ga0495628_0023927 3300046516 Bacteria 5007
63 Ga0495632_0037849 3300046519 Bacteria 2445
64 Ga0495643_0002257 3300046522 Bacteria 15637
65 Ga0495643_0098494 3300046522 Bacteria 1501
66 Ga0495652_0134293 3300046529 Bacteria 1954
67 Ga0495640_0026290 3300046533 Bacteria 4208
68 Ga0495640_0114383 3300046533 Bacteria 1759
69 Ga0495640_0232827 3300046533 Bacteria 1158
70 Ga0495597_0041887 3300046542 Bacteria 2044
71 Ga0495622_0162080 3300046557 Bacteria 1008
72 Ga0495633_0041524 3300046558 Bacteria 2187
73 Ga0495633_0118563 3300046558 Bacteria 1226
74 Ga0495667_0091410 3300046559 Bacteria 1971
75 Ga0495667_0102356 3300046559 Bacteria 1852
76 Ga0495634_0163207 3300046642 Bacteria 1403
77 Ga0495611_0011153 3300046648 Bacteria 3808
78 Ga0495611_0227017 3300046648 Bacteria 868
79 Ga0495625_0023175 3300046660 Bacteria 4745
80 Ga0495625_0100903 3300046660 Bacteria 1983
81 Ga0495635_0020379 3300046663 Bacteria 4619
82 Ga0495588_0004158 3300046674 Bacteria 6379
83 Ga0495657_0030327 3300046675 Bacteria 3789
84 Ga0495657_0148095 3300046675 Bacteria 1459
85 Ga0495599_0097796 3300046678 Bacteria 1830
86 Ga0495623_0007300 3300046679 Bacteria 7173
87 Ga0495646_0158477 3300046680 Bacteria 1255
88 Ga0495613_0024658 3300046689 Bacteria 4481
89 Ga0495613_0063117 3300046689 Bacteria 2710
90 Ga0495624_0078838 3300046690 Bacteria 2042
91 Ga0495624_0158407 3300046690 Bacteria 1383
92 Ga0495670_0003161 3300046691 Bacteria 8111
93 Ga0495589_0026192 3300046794 Bacteria 2956
94 Ga0495589_0031586 3300046794 Bacteria 2665
95 Ga0495589_0034862 3300046794 Bacteria 2524
96 Ga0495589_0084228 3300046794 Bacteria 1545
97 Ga0495600_0051226 3300046809 Bacteria 2695
98 Ga0495660_0021187 3300046810 Bacteria 3723
99 Ga0495660_0038516 3300046810 Bacteria 2658
100 Ga0495660_0049985 3300046810 Bacteria 2279
101 Ga0495581_0027137 3300047315 Bacteria 3321
102 Ga0495581_0050928 3300047315 Bacteria 2392
103 Ga0495581_0056533 3300047315 Bacteria 2265
104 Ga0495604_0120891 3300047317 Bacteria 1896
105 Ga0495636_0000961 3300047318 Bacteria 10738
106 Ga0495636_0001349 3300047318 Bacteria 9322
107 Ga0495636_0006266 3300047318 Bacteria 4673
108 Ga0495676_0047199 3300047321 Bacteria 3485
109 Ga0495676_0066545 3300047321 Bacteria 2791
110 Ga0495676_0163652 3300047321 Bacteria 1571
111 Ga0495680_0001580 3300047322 Bacteria 24370
112 Ga0495683_0034949 3300047323 Bacteria 2554
113 Ga0495687_003000 3300047443 Bacteria 12757
114 Ga0495687_031334 3300047443 Bacteria 2440
115 Ga0495687_082977 3300047443 Bacteria 1249
116 Ga0495687_161351 3300047443 Bacteria 753
117 Ga0495675_0004740 3300047444 Bacteria 8258
118 Ga0495677_0129839 3300047445 Bacteria 964
119 Ga0495679_022532 3300047446 Bacteria 2154
120 Ga0495685_000646 3300047447 Bacteria 10653
121 Ga0495685_000820 3300047447 Bacteria 9482
122 Ga0495685_013689 3300047447 Bacteria 2754
123 Ga0495685_027645 3300047447 Bacteria 1951
124 Ga0495685_057019 3300047447 Bacteria 1320
125 Ga0495685_065476 3300047447 Bacteria 1221
126 Ga0495681_0003711 3300047470 Bacteria 10588
127 Ga0495681_0138091 3300047470 Bacteria 1032
128 Ga0495686_0091947 3300047472 Bacteria 1841
129 Ga0495593_0025091 3300047673 Bacteria 3298
130 Ga0495593_0036892 3300047673 Bacteria 2647
131 Ga0495602_0179610 3300048088 Bacteria 1634
132 Ga0495614_0057413 3300048089 Bacteria 1671
133 Ga0495614_0106023 3300048089 Bacteria 1231
134 Ga0501308_002214 3300049128 Bacteria 1679
135 Ga0501031_0063514 3300049568 Bacteria 2405
136 Ga0501033_0001467 3300049570 Bacteria 20887
137 Ga0501033_0159857 3300049570 Bacteria 1622
138 Ga0501034_0161479 3300049571 Bacteria 2211
139 Ga0501036_0153975 3300049572 Bacteria 1939
140 Ga0501037_0015112 3300049573 Bacteria 5678
141 Ga0501037_0255165 3300049573 Bacteria 1226
142 Ga0501038_0086801 3300049574 Bacteria 2628
143 Ga0501042_0092414 3300049578 Bacteria 2172
144 Ga0501043_0043525 3300049579 Bacteria 3528
145 Ga0501046_0099162 3300049580 Bacteria 2236
146 Ga0501047_0136785 3300049581 Bacteria 2330
147 Ga0501048_0017276 3300049582 Bacteria 5315
148 Ga0501048_0354342 3300049582 Bacteria 1047
149 Ga0501070_0106376 3300049586 Bacteria 2319
150 Ga0501080_0023218 3300049742 Bacteria 5752
151 Ga0501035_0013935 3300049822 Bacteria 7418
152 Ga0501044_0030983 3300049823 Bacteria 5632
153 Ga0501044_0081713 3300049823 Bacteria 3270
154 Ga0501044_0182121 3300049823 Bacteria 2067
155 nmdc:mga03n38_11281_c1 3300050490 Bacteria 2970
156 nmdc:mga03n38_128403_c1 3300050490 Bacteria 1254
157 nmdc:mga06z11_3549_c1 3300050494 Bacteria 6046
158 nmdc:mga04h51_4578_c1 3300050495 Bacteria 3455
159 Ga0500578_0036706 3300053086 Bacteria 3148
160 Ga0500566_0025031 3300053094 Bacteria 3500
161 Ga0500553_025223 3300053101 Bacteria 2998
162 Ga0500569_001848 3300053109 Bacteria 4075
163 Ga0500652_004154 3300053131 Bacteria 4454
164 Ga0500658_0012808 3300053134 Bacteria 3097
165 Ga0500600_0004374 3300053149 Bacteria 8284
166 Ga0500616_0178392 3300053153 Bacteria 958
167 Ga0500634_0153968 3300053161 Bacteria 1070
168 Ga0500587_002672 3300053739 Bacteria 2529
169 2616695035 2616644814 Bacteria 11555299
170 2616695036 2616644814 Bacteria 11555299
171 2643764974 2643221548 Bacteria 8053412
172 2643902548 2643221578 Bacteria 9213798
173 2644404943 2643221673 Bacteria 9196637
174 2644437191 2643221678 Bacteria 9540101
175 2644461186 2643221682 Bacteria 6743283
176 2808842089 2808606359 Bacteria 9866990
177 2808920614 2808606375 Bacteria 9466072
178 2812480489 2811994917 Bacteria 7761064
179 2852636615 2852635781 Bacteria 8251373
180 2862285701 2862281513 Bacteria 9621493
181 2862387620 2862382967 Bacteria 10317375
182 2862511775 2862507626 Bacteria 9425308
183 2912724317 2912723979 Bacteria 8557534
184 2919469483 2919468124 Bacteria 9133025
185 2946048935 2946045630 Bacteria 8527308
186 2946067796 2946064051 Bacteria 8957905
187 2966601665 2966598605 Bacteria 7676064
188 8008567262 8008558824 Bacteria 10610750
189 Ga0307511_10017301
190 JGI24739J22299_10006400
191 JGI24737J22298_10017800
192 rootH1_10158275
193 Ga0075368_10007409
194 Ga0075363_100026626
195 Ga0075363_100029736
196 Ga0075367_10010854
197 Ga0105244_10051110
198 Ga0105246_10011578
199 Ga0157372_10535260
200 Ga0182008_10001431
201 Ga0182007_10001295
202 Ga0183367_1005
203 Ga0209758_1001951
204 Ga0207655_1073305
205 Ga0207647_10022767
206 Ga0207702_10183206
207 Ga0209813_10005723
208 Ga0307517_10005563
209 Ga0307515_10320343
210 Ga0307511_10046931
211 Ga0307513_10057870
212 Ga0307508_10003587
213 Ga0307508_10008335
214 Ga0307514_10021941
215 Ga0307516_10174694
216 Ga0307518_10009928
217 Ga0307507_10011359
218 Ga0307510_10006030
219 Ga0395900_0709379
220 Ga0451853_1542209
221 Ga0439449_0007762
222 Ga0439449_0008002
223 Ga0450903_015184
224 Ga0466972_0188714
225 Ga0466963_0002506
226 Ga0466970_0003671
227 Ga0466967_0017634
228 Ga0495617_065153
229 Ga0495617_074075
230 Ga0495592_0004234
231 Ga0495603_0006199
232 Ga0495603_0213825
233 Ga0495638_0132220
234 Ga0495651_0102416
235 Ga0495580_0056412
236 Ga0495580_0273389
237 Ga0495580_0282784
238 Ga0495605_0028245
239 Ga0495605_0031531
240 Ga0495662_0008175
241 Ga0495585_0128090
242 Ga0495607_0091672
243 Ga0495583_0018845
244 Ga0495583_0047506
245 Ga0495606_0002906
246 Ga0495606_0033344
247 Ga0495608_0178284
248 Ga0495618_0030962
249 Ga0495620_0037431
250 Ga0495628_0023927
251 Ga0495632_0037849
252 Ga0495643_0002257
253 Ga0495643_0098494
254 Ga0495652_0134293
255 Ga0495640_0026290
256 Ga0495640_0114383
257 Ga0495640_0232827
258 Ga0495597_0041887
259 Ga0495622_0162080
260 Ga0495633_0041524
261 Ga0495633_0118563
262 Ga0495667_0091410
263 Ga0495667_0102356
264 Ga0495634_0163207
265 Ga0495611_0011153
266 Ga0495611_0227017
267 Ga0495625_0023175
268 Ga0495625_0100903
269 Ga0495635_0020379
270 Ga0495588_0004158
271 Ga0495657_0030327
272 Ga0495657_0148095
273 Ga0495599_0097796
274 Ga0495623_0007300
275 Ga0495646_0158477
276 Ga0495613_0024658
277 Ga0495613_0063117
278 Ga0495624_0078838
279 Ga0495624_0158407
280 Ga0495670_0003161
281 Ga0495589_0026192
282 Ga0495589_0031586
283 Ga0495589_0034862
284 Ga0495589_0084228
285 Ga0495600_0051226
286 Ga0495660_0021187
287 Ga0495660_0038516
288 Ga0495660_0049985
289 Ga0495581_0027137
290 Ga0495581_0050928
291 Ga0495581_0056533
292 Ga0495604_0120891
293 Ga0495636_0000961
294 Ga0495636_0001349
295 Ga0495636_0006266
296 Ga0495676_0047199
297 Ga0495676_0066545
298 Ga0495676_0163652
299 Ga0495680_0001580
300 Ga0495683_0034949
301 Ga0495687_003000
302 Ga0495687_031334
303 Ga0495687_082977
304 Ga0495687_161351
305 Ga0495675_0004740
306 Ga0495677_0129839
307 Ga0495679_022532
308 Ga0495685_000646
309 Ga0495685_000820
310 Ga0495685_013689
311 Ga0495685_027645
312 Ga0495685_057019
313 Ga0495685_065476
314 Ga0495681_0003711
315 Ga0495681_0138091
316 Ga0495686_0091947
317 Ga0495593_0025091
318 Ga0495593_0036892
319 Ga0495602_0179610
320 Ga0495614_0057413
321 Ga0495614_0106023
322 Ga0501308_002214
323 Ga0501031_0063514
324 Ga0501033_0001467
325 Ga0501033_0159857
326 Ga0501034_0161479
327 Ga0501036_0153975
328 Ga0501037_0015112
329 Ga0501037_0255165
330 Ga0501038_0086801
331 Ga0501042_0092414
332 Ga0501043_0043525
333 Ga0501046_0099162
334 Ga0501047_0136785
335 Ga0501048_0017276
336 Ga0501048_0354342
337 Ga0501070_0106376
338 Ga0501080_0023218
339 Ga0501035_0013935
340 Ga0501044_0030983
341 Ga0501044_0081713
342 Ga0501044_0182121
343 nmdc:mga03n38_11281_c1
344 nmdc:mga03n38_128403_c1
345 nmdc:mga06z11_3549_c1
346 nmdc:mga04h51_4578_c1
347 Ga0500578_0036706
348 Ga0500566_0025031
349 Ga0500553_025223
350 Ga0500569_001848
351 Ga0500652_004154
352 Ga0500658_0012808
353 Ga0500600_0004374
354 Ga0500616_0178392
355 Ga0500634_0153968
356 Ga0500587_002672
357 2616695035
358 2616695036
359 2643764974
360 2643902548
361 2644404943
362 2644437191
363 2644461186
364 2808842089
365 2808920614
366 2812480489
367 2852636615
368 2862285701
369 2862387620
370 2862511775
371 2912724317
372 2919469483
373 2946048935
374 2946067796
375 2966601665
376 8008567262

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o26-assembly2.cif.gz_W structure of a class iii rtk signaling assembly 0.5466 65 188
4ofy-assembly3.cif.gz_C crystal structure of the complex of syg-1 d1-d2 and syg-2 d1-d4 0.5168 61 188
7e8t-assembly1.cif.gz_J monomer of ypt32-trappii 0.5163 58 188
7ea3-assembly1.cif.gz_J intact ypt32-trappii (dimer). 0.5163 58 188
4fqx-assembly2.cif.gz_C crystal structure of hla-dm bound to hla-dr1 0.5158 61 181
ID Description Score Start End Superfamily
af_Q57737_49_195_2.70.50.30 Mainly Beta;Distorted Sandwich;Coagulation Factor XIII; Chain A, domain 1;Coagulation Factor XIII, subunit A, domain 1 0.6516 70 189 2.70.50.30
af_A0A1D6HVY7_239_453_2.60.40.1930 Mainly Beta;Sandwich;Immunoglobulin-like;Macroglobulin (MG2) domain 0.6459 189 281 2.60.40.1930
af_Q9I8N6_212_309_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5765 65 188 2.60.40.10
af_Q4V892_6_111_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5586 57 190 2.60.40.10
af_Q12866_95_193_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.5549 61 189 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A6B3IMP3-F1-model_v4 Calcium-binding protein 0.9341 189 281
AF-A0A1J4NR57-F1-model_v4 Calcium-binding protein 0.9295 189 281
AF-A0A542W7E3-F1-model_v4 deleted 0.9291 189 281
AF-A0A7K3C0G9-F1-model_v4 deleted 0.9223 193 281
AF-A0A2M9L876-F1-model_v4 Single-stranded DNA-binding protein 0.902 189 281

Map