F306935

General Info

Members Datasets Scaffolds Average Seq Length
200 143 200 218

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10000003|Ga0081455_10000003251
Length 246
Sequence MIGEFKSFVICFCFSTELKSAIPIYTMAKIIPTKPLLVLLYGFPGAGKTYFARQLCEHIQAAHLQADRIRAELFENPRNDRQENEVVTQLMEYMTTEFLNAGLSVVYDANALRASQRRQLRDLARKCHAQPLLIWLQIDVESAFNRGLKRDRRRADDKYALTYDRSSFDTIGAHMQNPTMAEDYCVVSGKHVFTTQYSAVTKKMREIGLLSLDDAGTGVVKPGLVNLVPNPAAGRVDMTRRNIVIR

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
100 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
108 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
109 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
110 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
111 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
112 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
113 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
114 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
115 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
116 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
117 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
118 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
119 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
120 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
121 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
122 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
123 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
124 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
125 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
126 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
127 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
128 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
129 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
130 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
131 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
132 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
133 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
134 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
135 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
136 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
137 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
138 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
142 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
143 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 35
Nodule 0
Rhizoplane 1.5
Rhizosphere 61
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001496 3300001915 Bacteria 6667
2 JGI24735J21928_10000243 3300002067 Bacteria 19158
3 rootH2_10149469 3300003320 Bacteria 1808
4 rootL2_10084998 3300003322 Bacteria 2040
5 rootL2_10305596 3300003322 Bacteria 1316
6 rootH1_10159911 3300003323 Bacteria 4682
7 Ga0065704_10399538 3300005289 Unclassified 753
8 Ga0070658_10019477 3300005327 Bacteria 5434
9 Ga0070676_10367047 3300005328 Bacteria 993
10 Ga0070683_100117183 3300005329 Bacteria 2515
11 Ga0070661_100106758 3300005344 Bacteria 2088
12 Ga0070669_100540857 3300005353 Unclassified 970
13 Ga0070671_100000001 3300005355 Bacteria 1228151
14 Ga0070674_100007525 3300005356 Bacteria 6427
15 Ga0070674_100030920 3300005356 Bacteria 3543
16 Ga0070673_100006194 3300005364 Bacteria 7759
17 Ga0070667_100078563 3300005367 Bacteria 2819
18 Ga0070663_100182764 3300005455 Bacteria 1628
19 Ga0070678_100000962 3300005456 Bacteria 14844
20 Ga0070681_10068811 3300005458 Bacteria 3507
21 Ga0068867_100092238 3300005459 Bacteria 2300
22 Ga0070685_10000179 3300005466 Bacteria 42215
23 Ga0070685_10005491 3300005466 Bacteria 6423
24 Ga0070672_100030581 3300005543 Bacteria 4047
25 Ga0070686_100022017 3300005544 Bacteria 3794
26 Ga0070665_100028769 3300005548 Bacteria 5596
27 Ga0070665_100137605 3300005548 Bacteria 2445
28 Ga0068855_100369857 3300005563 Bacteria 1576
29 Ga0068857_100201506 3300005577 Bacteria 1814
30 Ga0068856_100006455 3300005614 Bacteria 11505
31 Ga0068858_100046512 3300005842 Bacteria 4022
32 Ga0068860_100190287 3300005843 Bacteria 1986
33 Ga0068862_100042605 3300005844 Bacteria 3867
34 Ga0081455_10000003 3300005937 Bacteria 367763
35 Ga0075368_10000177 3300006042 Bacteria 17391
36 Ga0075363_100000606 3300006048 Bacteria 11853
37 Ga0075364_10041612 3300006051 Bacteria 2983
38 Ga0075364_10117656 3300006051 Unclassified 1777
39 Ga0075364_10129923 3300006051 Bacteria 1690
40 Ga0075364_10205832 3300006051 Bacteria 1334
41 Ga0075364_10415391 3300006051 Bacteria 918
42 Ga0075367_10000734 3300006178 Bacteria 12758
43 Ga0075367_10004866 3300006178 Bacteria 6614
44 Ga0075369_10000500 3300006186 Bacteria 12203
45 Ga0075366_10000001 3300006195 Bacteria 569172
46 Ga0075366_10000005 3300006195 Bacteria 107438
47 Ga0075366_10000548 3300006195 Bacteria 17480
48 Ga0075366_10006051 3300006195 Bacteria 6591
49 Ga0075366_10278406 3300006195 Bacteria 1022
50 Ga0075370_10004024 3300006353 Bacteria 7066
51 Ga0075370_10367892 3300006353 Bacteria 860
52 Ga0075428_100001047 3300006844 Bacteria 29378
53 Ga0105240_10000003 3300009093 Bacteria 1183681
54 Ga0105240_10073864 3300009093 Bacteria 4210
55 Ga0105245_10000050 3300009098 Bacteria 128014
56 Ga0105245_10002473 3300009098 Bacteria 16702
57 Ga0105245_10288809 3300009098 Bacteria 1606
58 Ga0105243_10000001 3300009148 Bacteria 1156578
59 Ga0105241_10000003 3300009174 Bacteria 839043
60 Ga0105241_10062833 3300009174 Bacteria 2864
61 Ga0105241_10561399 3300009174 Bacteria 1026
62 Ga0105242_10000011 3300009176 Bacteria 149791
63 Ga0105242_10006388 3300009176 Bacteria 9074
64 Ga0105237_10013205 3300009545 Bacteria 8664
65 Ga0105238_10241191 3300009551 Bacteria 1785
66 Ga0105238_10607064 3300009551 Bacteria 1102
67 Ga0105249_10001720 3300009553 Bacteria 19150
68 Ga0105239_10047121 3300010375 Bacteria 4724
69 Ga0105239_10074107 3300010375 Bacteria 3743
70 Ga0105239_10089021 3300010375 Bacteria 3404
71 Ga0157373_10000318 3300013100 Bacteria 38857
72 Ga0157371_10000605 3300013102 Bacteria 42830
73 Ga0157370_10341870 3300013104 Bacteria 1379
74 Ga0157369_10000290 3300013105 Bacteria 67067
75 Ga0157374_10000115 3300013296 Bacteria 73739
76 Ga0157374_10003536 3300013296 Bacteria 13145
77 Ga0157374_10087542 3300013296 Bacteria 2965
78 Ga0157374_10148171 3300013296 Unclassified 2280
79 Ga0157378_10504014 3300013297 Bacteria 1210
80 Ga0157378_10551019 3300013297 Bacteria 1158
81 Ga0157372_10002139 3300013307 Bacteria 21472
82 Ga0157375_10498096 3300013308 Bacteria 1382
83 Ga0163163_10026228 3300014325 Bacteria 5567
84 Ga0163163_10470459 3300014325 Bacteria 1318
85 Ga0157377_10001016 3300014745 Bacteria 11829
86 Ga0157377_10013509 3300014745 Bacteria 4134
87 Ga0157376_10000007 3300014969 Bacteria 368004
88 Ga0207705_10000038 3300025909 Bacteria 193812
89 Ga0207654_10000002 3300025911 Bacteria 1460142
90 Ga0207654_10001196 3300025911 Bacteria 13911
91 Ga0207654_10267432 3300025911 Unclassified 1152
92 Ga0207707_10151447 3300025912 Unclassified 2027
93 Ga0207695_10000005 3300025913 Bacteria 1196715
94 Ga0207687_10000375 3300025927 Bacteria 29944
95 Ga0207687_10086529 3300025927 Bacteria 2276
96 Ga0207644_10000001 3300025931 Bacteria 1243214
97 Ga0207644_10677743 3300025931 Bacteria 859
98 Ga0207686_10000001 3300025934 Bacteria 1169580
99 Ga0207686_10003014 3300025934 Bacteria 9074
100 Ga0207709_10000002 3300025935 Bacteria 1171536
101 Ga0207669_10010932 3300025937 Bacteria 4392
102 Ga0207691_10033384 3300025940 Bacteria 4791
103 Ga0207661_10001152 3300025944 Bacteria 17665
104 Ga0207679_10243073 3300025945 Unclassified 1526
105 Ga0207667_10000008 3300025949 Bacteria 625138
106 Ga0207667_10185604 3300025949 Bacteria 2135
107 Ga0207667_10274657 3300025949 Bacteria 1723
108 Ga0207651_10003550 3300025960 Bacteria 7665
109 Ga0207712_10004275 3300025961 Bacteria 9011
110 Ga0207658_10000003 3300025986 Bacteria 1151934
111 Ga0207658_10084454 3300025986 Bacteria 2443
112 Ga0207703_10118594 3300026035 Bacteria 2269
113 Ga0207678_10073341 3300026067 Bacteria 2934
114 Ga0207708_10305054 3300026075 Unclassified 1296
115 Ga0207702_10000001 3300026078 Bacteria 895738
116 Ga0207648_10136285 3300026089 Bacteria 2162
117 Ga0207683_10010942 3300026121 Bacteria 7737
118 Ga0207698_10598318 3300026142 Bacteria 1087
119 Ga0209813_10000009 3300027866 Bacteria 102315
120 Ga0268266_10015379 3300028379 Bacteria 6566
121 Ga0268266_10037183 3300028379 Bacteria 4148
122 Ga0268265_10006198 3300028380 Bacteria 8102
123 Ga0268264_10050519 3300028381 Bacteria 3463
124 Ga0265338_10000419 3300028800 Bacteria 76060
125 Ga0265338_10000841 3300028800 Bacteria 51708
126 Ga0265327_10004581 3300031251 Bacteria 12169
127 Ga0265342_10202736 3300031712 Bacteria 1077
128 Ga0395901_0030286 3300038443 Bacteria 5575
129 Ga0395901_0062731 3300038443 Bacteria 3868
130 Ga0451807_1514507 3300041486 Bacteria 1059
131 Ga0495629_0085466 3300046459 Unclassified 2201
132 Ga0495582_0481486 3300046473 Unclassified 717
133 Ga0495583_0030342 3300046506 Bacteria 2634
134 Ga0495587_0071942 3300046536 Bacteria 2011
135 Ga0495622_0000035 3300046557 Bacteria 122963
136 Ga0495658_0049003 3300046683 Bacteria 2384
137 Ga0495671_0287284 3300046692 Unclassified 792
138 Ga0495600_0003585 3300046809 Bacteria 9144
139 Ga0495672_0000016 3300047320 Bacteria 500601
140 Ga0495593_0115844 3300047673 Unclassified 1366
141 Ga0495602_0160987 3300048088 Unclassified 1752
142 Ga0496109_0788444 3300048912 Unclassified 888
143 Ga0496112_0012521 3300048915 Bacteria 7791
144 Ga0496126_0464785 3300048929 Bacteria 1016
145 Ga0501070_0142906 3300049586 Bacteria 1976
146 Ga0501070_0225585 3300049586 Bacteria 1536
147 Ga0501080_0001480 3300049742 Bacteria 19793
148 nmdc:mga03683_28224_c2 3300050489 Bacteria 1814
149 nmdc:mga03683_312_c1 3300050489 Bacteria 13132
150 nmdc:mga03n38_96_c1 3300050490 Bacteria 19359
151 nmdc:mga00v17_14305_c1 3300050491 Bacteria 4425
152 nmdc:mga00v17_150130_c1 3300050491 Bacteria 1497
153 nmdc:mga00v17_153126_c1 3300050491 Unclassified 1482
154 nmdc:mga00v17_15755_c1 3300050491 Bacteria 4249
155 nmdc:mga0yw44_615_c1 3300050492 Bacteria 12909
156 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
157 nmdc:mga0k408_2331_c1 3300050493 Bacteria 10106
158 nmdc:mga0k408_36_c1 3300050493 Bacteria 72881
159 nmdc:mga0k408_42_c1 3300050493 Bacteria 17491
160 nmdc:mga06z11_268_c1 3300050494 Bacteria 6616
161 nmdc:mga06z11_86_c1 3300050494 Bacteria 39643
162 nmdc:mga04h51_10_c1 3300050495 Bacteria 102434
163 nmdc:mga07m45_44257_c1 3300050496 Unclassified 2498
164 nmdc:mga08x19_638040_c1 3300050514 Unclassified 755
165 nmdc:mga0sz30_8_c1 3300050516 Bacteria 107909
166 Ga0500610_0000001 3300053079 Bacteria 185468
167 Ga0500643_000011 3300053087 Bacteria 385630
168 Ga0500643_000541 3300053087 Bacteria 26390
169 Ga0500643_002235 3300053087 Bacteria 10214
170 Ga0500644_0000199 3300053088 Bacteria 36622
171 Ga0500644_0009479 3300053088 Bacteria 2605
172 Ga0500646_0000654 3300053090 Bacteria 9905
173 Ga0500583_0008937 3300053092 Bacteria 3633
174 Ga0500583_0100170 3300053092 Bacteria 1418
175 Ga0500651_0000050 3300053093 Bacteria 78674
176 Ga0500651_0012374 3300053093 Bacteria 5174
177 Ga0500651_0227028 3300053093 Bacteria 1093
178 Ga0500566_0000001 3300053094 Bacteria 1101031
179 Ga0500650_0000001 3300053098 Bacteria 818797
180 Ga0500555_000002 3300053103 Bacteria 1314346
181 Ga0500562_000009 3300053108 Bacteria 187538
182 Ga0500562_003237 3300053108 Bacteria 4068
183 Ga0500593_000001 3300053117 Bacteria 784404
184 Ga0500594_0000001 3300053118 Bacteria 1178472
185 Ga0500614_001534 3300053123 Bacteria 5477
186 Ga0500614_049031 3300053123 Unclassified 1102
187 Ga0500628_032293 3300053129 Bacteria 1144
188 Ga0500642_0024333 3300053130 Bacteria 2446
189 Ga0500652_000054 3300053131 Bacteria 52348
190 Ga0500655_000396 3300053133 Bacteria 9237
191 Ga0500559_0014165 3300053136 Bacteria 3370
192 Ga0500561_0000001 3300053137 Bacteria 957685
193 Ga0500577_0000516 3300053142 Bacteria 9986
194 Ga0500579_011773 3300053143 Bacteria 5600
195 Ga0500589_000008 3300053147 Bacteria 137145
196 Ga0500616_0000005 3300053153 Bacteria 961725
197 Ga0500622_0098921 3300053156 Bacteria 1439
198 Ga0500633_0004596 3300053160 Bacteria 3189
199 Ga0500570_000007 3300053724 Bacteria 117035
200 Ga0500611_000825 3300053727 Unclassified 3212

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_100106758 Ga0070661_1001067582 195
2 3300009098 Ga0105245_10288809 Ga0105245_102888092 195
3 3300013102 Ga0157371_10000605 Ga0157371_1000060524 195
4 3300005289 Ga0065704_10399538 Ga0065704_103995381 197
5 3300003320 rootH2_10149469 rootH2_101494693 204
6 3300013296 Ga0157374_10003536 Ga0157374_100035365 204
7 3300014745 Ga0157377_10001016 Ga0157377_100010167 204
8 3300005842 Ga0068858_100046512 Ga0068858_1000465122 206
9 3300006195 Ga0075366_10000548 Ga0075366_1000054818 206
10 3300050489 nmdc:mga03683_312_c1 nmdc:mga03683_312_c1_11978_12637 206
11 3300050493 nmdc:mga0k408_42_c1 nmdc:mga0k408_42_c1_4359_5018 206
12 3300003322 rootL2_10084998 rootL2_100849983 207
13 3300006186 Ga0075369_10000500 Ga0075369_100005006 207
14 3300006195 Ga0075366_10000001 Ga0075366_10000001304 207
15 3300025945 Ga0207679_10243073 Ga0207679_102430732 207
16 3300046459 Ga0495629_0085466 Ga0495629_0085466_336_998 207
17 3300046473 Ga0495582_0481486 Ga0495582_0481486_28_690 207
18 3300046536 Ga0495587_0071942 Ga0495587_0071942_1065_1727 207
19 3300046557 Ga0495622_0000035 Ga0495622_0000035_100903_101565 207
20 3300046683 Ga0495658_0049003 Ga0495658_0049003_1365_2027 207
21 3300046809 Ga0495600_0003585 Ga0495600_0003585_934_1596 207
22 3300047673 Ga0495593_0115844 Ga0495593_0115844_647_1309 207
23 3300048088 Ga0495602_0160987 Ga0495602_0160987_649_1311 207
24 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_786213_786875 207
25 3300050516 nmdc:mga0sz30_8_c1 nmdc:mga0sz30_8_c1_62733_63395 207
26 3300053094 Ga0500566_0000001 Ga0500566_0000001_748752_749414 207
27 3300053123 Ga0500614_049031 Ga0500614_049031_405_1067 207
28 3300053136 Ga0500559_0014165 Ga0500559_0014165_1487_2149 207
29 3300005458 Ga0070681_10068811 Ga0070681_100688112 210
30 3300005327 Ga0070658_10019477 Ga0070658_100194772 211
31 3300053117 Ga0500593_000001 Ga0500593_000001_539539_540189 215
32 3300025911 Ga0207654_10001196 Ga0207654_100011969 216
33 3300053087 Ga0500643_000541 Ga0500643_000541_23754_24413 216
34 3300053092 Ga0500583_0008937 Ga0500583_0008937_97_756 216
35 3300005329 Ga0070683_100117183 Ga0070683_1001171833 217
36 3300005844 Ga0068862_100042605 Ga0068862_1000426054 217
37 3300009553 Ga0105249_10001720 Ga0105249_1000172019 217
38 3300025961 Ga0207712_10004275 Ga0207712_100042759 217
39 3300028380 Ga0268265_10006198 Ga0268265_1000619814 217
40 3300005355 Ga0070671_100000001 Ga0070671_100000001378 218
41 3300025931 Ga0207644_10000001 Ga0207644_100000011060 218
42 3300025949 Ga0207667_10274657 Ga0207667_102746573 218
43 3300025986 Ga0207658_10000003 Ga0207658_10000003533 218
44 3300026035 Ga0207703_10118594 Ga0207703_101185942 218
45 3300047320 Ga0495672_0000016 Ga0495672_0000016_134973_135632 218
46 3300053153 Ga0500616_0000005 Ga0500616_0000005_433704_434363 218
47 3300001915 JGI24741J21665_1001496 JGI24741J21665_10014962 219
48 3300002067 JGI24735J21928_10000243 JGI24735J21928_100002433 219
49 3300003322 rootL2_10305596 rootL2_103055961 219
50 3300003323 rootH1_10159911 rootH1_101599113 219
51 3300005328 Ga0070676_10367047 Ga0070676_103670471 219
52 3300005353 Ga0070669_100540857 Ga0070669_1005408572 219
53 3300005356 Ga0070674_100007525 Ga0070674_1000075254 219
54 3300005356 Ga0070674_100030920 Ga0070674_1000309207 219
55 3300005364 Ga0070673_100006194 Ga0070673_1000061946 219
56 3300005367 Ga0070667_100078563 Ga0070667_1000785633 219
57 3300005455 Ga0070663_100182764 Ga0070663_1001827642 219
58 3300005456 Ga0070678_100000962 Ga0070678_1000009627 219
59 3300005459 Ga0068867_100092238 Ga0068867_1000922383 219
60 3300005466 Ga0070685_10000179 Ga0070685_1000017923 219
61 3300005466 Ga0070685_10005491 Ga0070685_100054913 219
62 3300005543 Ga0070672_100030581 Ga0070672_1000305814 219
63 3300005544 Ga0070686_100022017 Ga0070686_1000220177 219
64 3300005548 Ga0070665_100028769 Ga0070665_1000287694 219
65 3300005548 Ga0070665_100137605 Ga0070665_1001376051 219
66 3300005563 Ga0068855_100369857 Ga0068855_1003698572 219
67 3300005577 Ga0068857_100201506 Ga0068857_1002015062 219
68 3300005614 Ga0068856_100006455 Ga0068856_10000645511 219
69 3300005843 Ga0068860_100190287 Ga0068860_1001902872 219
70 3300005937 Ga0081455_10000003 Ga0081455_10000003251 219
71 3300006042 Ga0075368_10000177 Ga0075368_1000017716 219
72 3300006048 Ga0075363_100000606 Ga0075363_1000006068 219
73 3300006051 Ga0075364_10041612 Ga0075364_100416122 219
74 3300006051 Ga0075364_10117656 Ga0075364_101176562 219
75 3300006051 Ga0075364_10129923 Ga0075364_101299232 219
76 3300006051 Ga0075364_10205832 Ga0075364_102058322 219
77 3300006051 Ga0075364_10415391 Ga0075364_104153911 219
78 3300006178 Ga0075367_10000734 Ga0075367_1000073414 219
79 3300006178 Ga0075367_10004866 Ga0075367_100048666 219
80 3300006195 Ga0075366_10000005 Ga0075366_1000000569 219
81 3300006195 Ga0075366_10006051 Ga0075366_100060515 219
82 3300006195 Ga0075366_10278406 Ga0075366_102784061 219
83 3300006353 Ga0075370_10004024 Ga0075370_100040244 219
84 3300006353 Ga0075370_10367892 Ga0075370_103678921 219
85 3300006844 Ga0075428_100001047 Ga0075428_10000104718 219
86 3300009093 Ga0105240_10000003 Ga0105240_10000003942 219
87 3300009093 Ga0105240_10073864 Ga0105240_100738642 219
88 3300009098 Ga0105245_10000050 Ga0105245_1000005081 219
89 3300009098 Ga0105245_10002473 Ga0105245_1000247313 219
90 3300009148 Ga0105243_10000001 Ga0105243_10000001349 219
91 3300009174 Ga0105241_10000003 Ga0105241_1000000333 219
92 3300009174 Ga0105241_10062833 Ga0105241_100628333 219
93 3300009174 Ga0105241_10561399 Ga0105241_105613992 219
94 3300009176 Ga0105242_10000011 Ga0105242_10000011102 219
95 3300009176 Ga0105242_10006388 Ga0105242_1000638810 219
96 3300009545 Ga0105237_10013205 Ga0105237_100132053 219
97 3300009551 Ga0105238_10241191 Ga0105238_102411913 219
98 3300009551 Ga0105238_10607064 Ga0105238_106070642 219
99 3300010375 Ga0105239_10047121 Ga0105239_100471214 219
100 3300010375 Ga0105239_10074107 Ga0105239_100741074 219
101 3300010375 Ga0105239_10089021 Ga0105239_100890213 219
102 3300013100 Ga0157373_10000318 Ga0157373_1000031825 219
103 3300013104 Ga0157370_10341870 Ga0157370_103418702 219
104 3300013105 Ga0157369_10000290 Ga0157369_1000029062 219
105 3300013296 Ga0157374_10000115 Ga0157374_1000011516 219
106 3300013296 Ga0157374_10087542 Ga0157374_100875423 219
107 3300013296 Ga0157374_10148171 Ga0157374_101481711 219
108 3300013297 Ga0157378_10504014 Ga0157378_105040142 219
109 3300013297 Ga0157378_10551019 Ga0157378_105510192 219
110 3300013307 Ga0157372_10002139 Ga0157372_1000213918 219
111 3300013308 Ga0157375_10498096 Ga0157375_104980962 219
112 3300014325 Ga0163163_10026228 Ga0163163_100262287 219
113 3300014325 Ga0163163_10470459 Ga0163163_104704592 219
114 3300014745 Ga0157377_10013509 Ga0157377_100135092 219
115 3300014969 Ga0157376_10000007 Ga0157376_10000007373 219
116 3300025909 Ga0207705_10000038 Ga0207705_10000038110 219
117 3300025911 Ga0207654_10000002 Ga0207654_100000021176 219
118 3300025911 Ga0207654_10267432 Ga0207654_102674321 219
119 3300025912 Ga0207707_10151447 Ga0207707_101514473 219
120 3300025913 Ga0207695_10000005 Ga0207695_10000005952 219
121 3300025927 Ga0207687_10000375 Ga0207687_1000037530 219
122 3300025927 Ga0207687_10086529 Ga0207687_100865294 219
123 3300025931 Ga0207644_10677743 Ga0207644_106777431 219
124 3300025934 Ga0207686_10000001 Ga0207686_10000001793 219
125 3300025934 Ga0207686_10003014 Ga0207686_100030144 219
126 3300025935 Ga0207709_10000002 Ga0207709_10000002911 219
127 3300025937 Ga0207669_10010932 Ga0207669_100109323 219
128 3300025940 Ga0207691_10033384 Ga0207691_100333844 219
129 3300025944 Ga0207661_10001152 Ga0207661_1000115210 219
130 3300025949 Ga0207667_10000008 Ga0207667_10000008280 219
131 3300025949 Ga0207667_10185604 Ga0207667_101856042 219
132 3300025960 Ga0207651_10003550 Ga0207651_100035506 219
133 3300025986 Ga0207658_10084454 Ga0207658_100844544 219
134 3300026067 Ga0207678_10073341 Ga0207678_100733413 219
135 3300026075 Ga0207708_10305054 Ga0207708_103050542 219
136 3300026078 Ga0207702_10000001 Ga0207702_10000001883 219
137 3300026089 Ga0207648_10136285 Ga0207648_101362852 219
138 3300026121 Ga0207683_10010942 Ga0207683_100109427 219
139 3300026142 Ga0207698_10598318 Ga0207698_105983182 219
140 3300027866 Ga0209813_10000009 Ga0209813_10000009110 219
141 3300028379 Ga0268266_10015379 Ga0268266_100153795 219
142 3300028379 Ga0268266_10037183 Ga0268266_100371834 219
143 3300028381 Ga0268264_10050519 Ga0268264_100505194 219
144 3300028800 Ga0265338_10000419 Ga0265338_1000041914 219
145 3300028800 Ga0265338_10000841 Ga0265338_1000084157 219
146 3300031251 Ga0265327_10004581 Ga0265327_1000458112 219
147 3300031712 Ga0265342_10202736 Ga0265342_102027361 219
148 3300038443 Ga0395901_0030286 Ga0395901_0030286_2606_3268 219
149 3300038443 Ga0395901_0062731 Ga0395901_0062731_2114_2776 219
150 3300041486 Ga0451807_1514507 Ga0451807_1514507_322_993 219
151 3300046506 Ga0495583_0030342 Ga0495583_0030342_1932_2591 219
152 3300046692 Ga0495671_0287284 Ga0495671_0287284_103_762 219
153 3300048912 Ga0496109_0788444 Ga0496109_0788444_127_789 219
154 3300048915 Ga0496112_0012521 Ga0496112_0012521_4509_5171 219
155 3300048929 Ga0496126_0464785 Ga0496126_0464785_166_828 219
156 3300049586 Ga0501070_0142906 Ga0501070_0142906_841_1506 219
157 3300049586 Ga0501070_0225585 Ga0501070_0225585_405_1064 219
158 3300049742 Ga0501080_0001480 Ga0501080_0001480_13109_13771 219
159 3300050489 nmdc:mga03683_28224_c2 nmdc:mga03683_28224_c2_826_1485 219
160 3300050490 nmdc:mga03n38_96_c1 nmdc:mga03n38_96_c1_5673_6335 219
161 3300050491 nmdc:mga00v17_14305_c1 nmdc:mga00v17_14305_c1_2785_3447 219
162 3300050491 nmdc:mga00v17_150130_c1 nmdc:mga00v17_150130_c1_527_1189 219
163 3300050491 nmdc:mga00v17_153126_c1 nmdc:mga00v17_153126_c1_107_766 219
164 3300050491 nmdc:mga00v17_15755_c1 nmdc:mga00v17_15755_c1_1779_2486 219
165 3300050492 nmdc:mga0yw44_615_c1 nmdc:mga0yw44_615_c1_10718_11425 219
166 3300050493 nmdc:mga0k408_2331_c1 nmdc:mga0k408_2331_c1_2212_2871 219
167 3300050493 nmdc:mga0k408_36_c1 nmdc:mga0k408_36_c1_59323_59982 219
168 3300050494 nmdc:mga06z11_268_c1 nmdc:mga06z11_268_c1_5362_6021 219
169 3300050494 nmdc:mga06z11_86_c1 nmdc:mga06z11_86_c1_28829_29491 219
170 3300050495 nmdc:mga04h51_10_c1 nmdc:mga04h51_10_c1_95970_96632 219
171 3300050496 nmdc:mga07m45_44257_c1 nmdc:mga07m45_44257_c1_949_1611 219
172 3300050514 nmdc:mga08x19_638040_c1 nmdc:mga08x19_638040_c1_21_683 219
173 3300053079 Ga0500610_0000001 Ga0500610_0000001_1115_1777 219
174 3300053087 Ga0500643_000011 Ga0500643_000011_103389_104051 219
175 3300053087 Ga0500643_002235 Ga0500643_002235_6966_7628 219
176 3300053088 Ga0500644_0000199 Ga0500644_0000199_2857_3519 219
177 3300053088 Ga0500644_0009479 Ga0500644_0009479_884_1546 219
178 3300053090 Ga0500646_0000654 Ga0500646_0000654_2710_3372 219
179 3300053092 Ga0500583_0100170 Ga0500583_0100170_317_979 219
180 3300053093 Ga0500651_0000050 Ga0500651_0000050_56597_57259 219
181 3300053093 Ga0500651_0012374 Ga0500651_0012374_766_1428 219
182 3300053093 Ga0500651_0227028 Ga0500651_0227028_33_701 219
183 3300053098 Ga0500650_0000001 Ga0500650_0000001_583929_584591 219
184 3300053103 Ga0500555_000002 Ga0500555_000002_407596_408258 219
185 3300053108 Ga0500562_000009 Ga0500562_000009_25311_25973 219
186 3300053108 Ga0500562_003237 Ga0500562_003237_3130_3792 219
187 3300053118 Ga0500594_0000001 Ga0500594_0000001_67493_68155 219
188 3300053123 Ga0500614_001534 Ga0500614_001534_3866_4528 219
189 3300053129 Ga0500628_032293 Ga0500628_032293_181_843 219
190 3300053130 Ga0500642_0024333 Ga0500642_0024333_1550_2218 219
191 3300053131 Ga0500652_000054 Ga0500652_000054_38750_39412 219
192 3300053133 Ga0500655_000396 Ga0500655_000396_3480_4142 219
193 3300053137 Ga0500561_0000001 Ga0500561_0000001_430998_431657 219
194 3300053142 Ga0500577_0000516 Ga0500577_0000516_4352_5014 219
195 3300053143 Ga0500579_011773 Ga0500579_011773_4171_4833 219
196 3300053147 Ga0500589_000008 Ga0500589_000008_92167_92835 219
197 3300053156 Ga0500622_0098921 Ga0500622_0098921_390_1052 219
198 3300053160 Ga0500633_0004596 Ga0500633_0004596_1411_2073 219
199 3300053724 Ga0500570_000007 Ga0500570_000007_102596_103258 219
200 3300053727 Ga0500611_000825 Ga0500611_000825_1425_2087 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13671

AAA_33

AAA domain

37

178

0.89

PF08433

KTI12

Chromatin associated protein KTI12

35

182

0.83

PF06414

Zeta_toxin

Zeta toxin

25

177

0.82

PF01583

APS_kinase

Adenylylsulphate kinase

34

182

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ia5-assembly1.cif.gz_A t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium. 0.8327 9 149
4xrp-assembly1.cif.gz_D structure of the pnkp1/rnl/hen1 rna repair complex 0.8316 1 149
2ia5-assembly2.cif.gz_H t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium. 0.8313 9 149
2ia5-assembly3.cif.gz_L t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium. 0.8275 9 149
1rrc-assembly1.cif.gz_A t4 polynucleotide kinase bound to 5'-gtc-3' ssdna 0.827 9 135
ID Description Score Start End Superfamily
af_Q54TE2_1_167_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8509 8 161 3.40.50.300
af_A4IA87_99_253_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8401 6 135 3.40.50.300
af_A0A0G2JUH4_338_483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8263 7 145 3.40.50.300
af_Q96EK9_1_110_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8217 10 109 3.40.50.300
af_Q54U78_366_535_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8144 1 159 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N5KCT1-F1-model_v4 ATP-binding protein 0.9351 7 137
AF-C0ZXX0-F1-model_v4 Putative polynucleotide kinase (EC 2.7.1.78) 0.9351 9 124 GO:0051734
AF-A0A431HJ19-F1-model_v4 ATP-binding protein 0.9271 8 174 GO:0005524
AF-A0A7L4QFG1-F1-model_v4 AAA family ATPase 0.9245 11 179
AF-A0A2M7TV87-F1-model_v4 ATP-binding protein 0.9231 7 174

Feature Viewer

pLDDT pTM Quality
85.1 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map