F306392

General Info

Members Datasets Scaffolds Average Seq Length
199 132 399 165

Family's Representative Sequence

Representative Sequence 3300049758|Ga0501241_004200|Ga0501241_004200_246_755
Length 169
Sequence MENEIIIRPIYNNYCKQVQELILPIQQIEFNVPVTLEGQPDLLDIETNYHKGGGGFWGALDKAKPDGEELTGTIGLINVGEHIGVIRKMFVKKEYRGKEFGIGQNLLDTLISYCNAHEINDLYLGTVEILKAAHRFYEKNGFGEINVDELPAIFPRMMADNKFYHLKLQ

Samples

Sample ID Description Type Environment
1 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
27 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
40 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
43 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
56 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
57 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
58 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
59 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
60 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
67 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
68 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
69 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
70 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
71 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
72 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
73 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
77 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
82 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
85 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
86 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
87 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
92 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
93 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
96 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
97 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
98 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
99 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
105 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
111 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
112 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
113 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
114 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
117 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
118 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
119 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
120 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
121 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
122 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
123 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
124 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
125 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
126 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
127 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
128 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
129 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
130 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
131 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
132 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.97
Metatranscriptomes 0
Isolates 6.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.08
Nodule 2.51
Rhizoplane 2.01
Rhizosphere 64.82
Stem 0
Stem Tuber 0
Unclassified 3.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501241_004200 3300049758 Unclassified 2704
2 JGI24740J21852_10049528 3300001979 Bacteria 1213
3 JGI24739J22299_10011148 3300001989 Bacteria 3322
4 JGI24737J22298_10000116 3300001990 Bacteria 24197
5 JGI24737J22298_10018284 3300001990 Bacteria 2250
6 JGI24735J21928_10000015 3300002067 Bacteria 167231
7 JGI25162J39368_1000016 3300002737 Bacteria 288734
8 JGI25162J39368_1000866 3300002737 Bacteria 19829
9 JGI25164J39214_1001979 3300002772 Bacteria 3689
10 JGI25150J39212_1000002 3300002774 Bacteria 537631
11 JGI25165J46597_1001674 3300003214 Bacteria 10067
12 rootH1_10034433 3300003316 Bacteria 16075
13 rootH2_10002774 3300003320 Bacteria 18398
14 rootL2_10060856 3300003322 Bacteria 1286
15 rootL2_10179523 3300003322 Bacteria 5475
16 rootH1_10045308 3300003316 Bacteria 1669
17 rootH1_10045308 3300003323 Bacteria 7684
18 rootH1_10052179 3300003323 Bacteria 38243
19 rootH1_10196814 3300003323 Unclassified 3638
20 rootH1_10288310 3300003323 Bacteria 1853
21 Ga0065165_1001218 3300005262 Bacteria 29602
22 Ga0065714_10079493 3300005288 Bacteria 2510
23 Ga0065714_10107469 3300005288 Bacteria 1531
24 Ga0070658_10281859 3300005327 Bacteria 1415
25 Ga0070682_100054480 3300005337 Bacteria 2510
26 Ga0070659_100005000 3300005366 Bacteria 9499
27 Ga0070681_10029310 3300005458 Bacteria 5526
28 Ga0068853_100622294 3300005539 Bacteria 1026
29 Ga0068855_100204667 3300005563 Bacteria 2221
30 Ga0068855_101304727 3300005563 Bacteria 751
31 Ga0068857_100118292 3300005577 Bacteria 2385
32 Ga0068857_100449999 3300005577 Bacteria 1204
33 Ga0068854_100066525 3300005578 Bacteria 2623
34 Ga0075369_10209794 3300006186 Bacteria 900
35 Ga0075366_10000261 3300006195 Bacteria 23266
36 Ga0075366_10150012 3300006195 Bacteria 1411
37 Ga0079104_1000005 3300006946 Bacteria 407099
38 Ga0099826_10064639 3300006948 Bacteria 2357
39 Ga0105240_10270730 3300009093 Bacteria 1956
40 Ga0105237_10000220 3300009545 Bacteria 80336
41 Ga0105237_10002729 3300009545 Bacteria 21530
42 Ga0105237_10003434 3300009545 Bacteria 18811
43 Ga0105237_10186182 3300009545 Bacteria 2076
44 Ga0105239_10008608 3300010375 Bacteria 11568
45 Ga0105239_10028319 3300010375 Bacteria 6163
46 Ga0105239_11959270 3300010375 Bacteria 680
47 Ga0157373_10000036 3300013100 Bacteria 122723
48 Ga0157373_10003820 3300013100 Bacteria 11390
49 Ga0157373_10008118 3300013100 Bacteria 7805
50 Ga0157371_10002946 3300013102 Bacteria 15852
51 Ga0157371_10040503 3300013102 Bacteria 3327
52 Ga0157371_10043428 3300013102 Bacteria 3202
53 Ga0157370_10000399 3300013104 Bacteria 54642
54 Ga0157370_10198825 3300013104 Bacteria 1860
55 Ga0157370_10199497 3300013104 Bacteria 1856
56 Ga0157370_11261730 3300013104 Bacteria 666
57 Ga0157369_10010263 3300013105 Bacteria 10686
58 Ga0157369_10044949 3300013105 Bacteria 4805
59 Ga0157369_10221609 3300013105 Bacteria 1980
60 Ga0157369_11249031 3300013105 Bacteria 758
61 Ga0163162_10002529 3300013306 Bacteria 17304
62 Ga0157372_10000173 3300013307 Bacteria 71416
63 Ga0157372_10001390 3300013307 Bacteria 26087
64 Ga0157372_12053323 3300013307 Bacteria 657
65 Ga0182008_10000011 3300014497 Bacteria 297770
66 Ga0182006_1054700 3300015261 Bacteria 1526
67 Ga0182006_1075021 3300015261 Bacteria 1245
68 Ga0163161_10000168 3300017792 Bacteria 60064
69 Ga0163161_10001157 3300017792 Bacteria 19859
70 Ga0163161_10050013 3300017792 Bacteria 3023
71 Ga0207427_100122 3300025231 Bacteria 99064
72 Ga0207427_106393 3300025231 Bacteria 1498
73 Ga0209437_100048 3300025233 Bacteria 405107
74 Ga0209437_100119 3300025233 Bacteria 206549
75 Ga0207425_1000004 3300025245 Bacteria 1092421
76 Ga0209129_1000005 3300025258 Bacteria 777812
77 Ga0209129_1010646 3300025258 Bacteria 2275
78 Ga0209233_1000029 3300025261 Bacteria 641642
79 Ga0209233_1001847 3300025261 Bacteria 8130
80 Ga0209025_1000009 3300025294 Bacteria 1092561
81 Ga0209758_1000010 3300025297 Bacteria 1092782
82 Ga0207655_1000381 3300025728 Bacteria 61849
83 Ga0207647_10002110 3300025904 Bacteria 15216
84 Ga0207707_10038435 3300025912 Bacteria 4182
85 Ga0207671_10001993 3300025914 Bacteria 22502
86 Ga0207671_10007421 3300025914 Bacteria 9515
87 Ga0207671_10012842 3300025914 Bacteria 6709
88 Ga0207690_10067555 3300025932 Bacteria 2452
89 Ga0207667_10527497 3300025949 Bacteria 1196
90 Ga0207667_10576728 3300025949 Bacteria 1136
91 Ga0207640_10009382 3300025981 Bacteria 5478
92 Ga0207674_10033219 3300026116 Bacteria 5402
93 Ga0207674_10248299 3300026116 Bacteria 1726
94 Ga0209281_1000566 3300027111 Bacteria 44512
95 Ga0209489_117438 3300027361 Bacteria 3264
96 Ga0209282_1052071 3300027666 Bacteria 2341
97 Ga0307515_10001710 3300028794 Bacteria 48899
98 Ga0307515_10001900 3300028794 Bacteria 46488
99 Ga0316181_1019090 3300030744 Bacteria 2913
100 Ga0307516_10332405 3300031730 Unclassified 1188
101 Ga0307516_10460108 3300031730 Bacteria 928
102 Ga0307410_10000089 3300031852 Bacteria 30766
103 Ga0307406_10000037 3300031901 Bacteria 80899
104 Ga0307407_10005460 3300031903 Bacteria 5519
105 Ga0307412_10684386 3300031911 Bacteria 878
106 Ga0307414_10000012 3300032004 Bacteria 322675
107 Ga0307414_10007370 3300032004 Bacteria 6180
108 Ga0307414_10045487 3300032004 Bacteria 3006
109 Ga0307414_10100319 3300032004 Unclassified 2177
110 Ga0307507_10000309 3300033179 Bacteria 98028
111 Ga0307510_10000671 3300033180 Bacteria 34905
112 Ga0373946_0439707 3300035171 Bacteria 663
113 Ga0395900_0372718 3300037418 Bacteria 1397
114 Ga0439466_0002630 3300041411 Bacteria 7029
115 Ga0451804_0383802 3300041463 Bacteria 884
116 Ga0451841_0526097 3300041498 Bacteria 679
117 Ga0466972_0000159 3300044658 Bacteria 54274
118 Ga0466970_0001499 3300044765 Bacteria 11236
119 Ga0495638_0114009 3300046460 Bacteria 1603
120 Ga0495650_0000144 3300046471 Bacteria 165957
121 Ga0495585_0000091 3300046492 Bacteria 95620
122 Ga0495585_0000241 3300046492 Bacteria 56727
123 Ga0495585_0170418 3300046492 Bacteria 1125
124 Ga0495606_0009540 3300046507 Bacteria 8195
125 Ga0495606_0021269 3300046507 Bacteria 4755
126 Ga0495606_0166956 3300046507 Bacteria 1280
127 Ga0495606_0220509 3300046507 Bacteria 1069
128 Ga0495606_0251495 3300046507 Bacteria 980
129 Ga0495610_0008174 3300046512 Bacteria 6824
130 Ga0495610_0175887 3300046512 Bacteria 894
131 Ga0495616_0011104 3300046513 Bacteria 5175
132 Ga0495616_0011972 3300046513 Bacteria 4939
133 Ga0495616_0198102 3300046513 Bacteria 884
134 Ga0495648_0004406 3300046524 Bacteria 12040
135 Ga0495648_0005249 3300046524 Bacteria 10824
136 Ga0495648_0087712 3300046524 Unclassified 1751
137 Ga0495663_0000151 3300046525 Bacteria 28138
138 Ga0495652_0216762 3300046529 Bacteria 1441
139 Ga0495609_0048637 3300046538 Bacteria 1895
140 Ga0495609_0084056 3300046538 Bacteria 1389
141 Ga0495622_0043496 3300046557 Bacteria 2088
142 Ga0495633_0000006 3300046558 Bacteria 326774
143 Ga0495633_0007299 3300046558 Bacteria 6381
144 Ga0495668_0000054 3300046616 Bacteria 203960
145 Ga0495668_0166329 3300046616 Bacteria 1208
146 Ga0495625_0000059 3300046660 Bacteria 180330
147 Ga0495625_0000355 3300046660 Bacteria 69806
148 Ga0495625_0000548 3300046660 Bacteria 55064
149 Ga0495625_0260091 3300046660 Bacteria 1123
150 Ga0495661_0057199 3300046665 Bacteria 2329
151 Ga0495588_0219320 3300046674 Bacteria 1004
152 Ga0495658_0020053 3300046683 Bacteria 3501
153 Ga0495670_0298134 3300046691 Bacteria 864
154 Ga0495671_0068767 3300046692 Bacteria 1741
155 Ga0495649_0000031 3300046694 Bacteria 151547
156 Ga0495600_0544270 3300046809 Bacteria 710
157 Ga0495660_0113604 3300046810 Bacteria 1379
158 Ga0495660_0346065 3300046810 Bacteria 662
159 Ga0495683_0071605 3300047323 Bacteria 1701
160 Ga0495687_037873 3300047443 Bacteria 2144
161 Ga0495673_0050763 3300047469 Bacteria 1819
162 Ga0495686_0000066 3300047472 Bacteria 225023
163 Ga0495614_0004728 3300048089 Bacteria 6140
164 Ga0496114_0370695 3300048917 Bacteria 1267
165 Ga0496115_0026826 3300048918 Bacteria 4501
166 Ga0496116_0000030 3300048919 Bacteria 420761
167 Ga0496117_0160796 3300048920 Bacteria 1316
168 Ga0496121_0033430 3300048924 Bacteria 4653
169 Ga0496121_0152902 3300048924 Bacteria 1696
170 Ga0496124_0015286 3300048927 Bacteria 7366
171 Ga0496124_0878574 3300048927 Bacteria 546
172 Ga0496125_0000035 3300048928 Bacteria 339737
173 Ga0496125_0459270 3300048928 Bacteria 727
174 Ga0496126_0012027 3300048929 Bacteria 8893
175 Ga0495678_008057 3300049459 Bacteria 5372
176 Ga0495682_0011476 3300049460 Bacteria 3409
177 Ga0501238_000032 3300049671 Bacteria 24802
178 Ga0501280_000125 3300049776 Bacteria 19989
179 nmdc:mga0k408_1202_c1 3300050493 Bacteria 14176
180 nmdc:mga0k408_245_c1 3300050493 Bacteria 29347
181 nmdc:mga0k408_762610_c1 3300050493 Bacteria 565
182 nmdc:mga07m45_206109_c1 3300050496 Bacteria 1144
183 Ga0500583_0416995 3300053092 Unclassified 642
184 Ga0500614_010285 3300053123 Bacteria 2007
185 Ga0500618_000018 3300053125 Bacteria 163272
186 Ga0500618_020719 3300053125 Bacteria 1609
187 Ga0500652_168863 3300053131 Bacteria 901
188 Ga0500658_0000024 3300053134 Bacteria 117952
189 2513234806 2513020052 Bacteria 5120511
190 2599481991 2599185184 Bacteria 6430550
191 2738736530 2738541279 Bacteria 6149495
192 2738766831 2738541285 Bacteria 6150075
193 2739218112 2738543007 Bacteria 6149845
194 2896089822 2896085136 Bacteria 6129793
195 2928082099 2928078545 Bacteria 6534839
196 2928149323 2928147474 Bacteria 6512076
197 2929180799 2929177148 Bacteria 7883697
198 2932087941 2932082852 Bacteria 6563563
199 2945983196 2945977869 Bacteria 7777518
200 2946017413 2946013367 Bacteria 7766675
201 Ga0501241_004200
202 JGI24740J21852_10049528
203 JGI24739J22299_10011148
204 JGI24737J22298_10000116
205 JGI24737J22298_10018284
206 JGI24735J21928_10000015
207 JGI25162J39368_1000016
208 JGI25162J39368_1000866
209 JGI25164J39214_1001979
210 JGI25150J39212_1000002
211 JGI25165J46597_1001674
212 rootH1_10034433
213 rootH2_10002774
214 rootL2_10060856
215 rootL2_10179523
216 rootH1_10045308
217 rootH1_10052179
218 rootH1_10196814
219 rootH1_10288310
220 Ga0065165_1001218
221 Ga0065714_10079493
222 Ga0065714_10107469
223 Ga0070658_10281859
224 Ga0070682_100054480
225 Ga0070659_100005000
226 Ga0070681_10029310
227 Ga0068853_100622294
228 Ga0068855_100204667
229 Ga0068855_101304727
230 Ga0068857_100118292
231 Ga0068857_100449999
232 Ga0068854_100066525
233 Ga0075369_10209794
234 Ga0075366_10000261
235 Ga0075366_10150012
236 Ga0079104_1000005
237 Ga0099826_10064639
238 Ga0105240_10270730
239 Ga0105237_10000220
240 Ga0105237_10002729
241 Ga0105237_10003434
242 Ga0105237_10186182
243 Ga0105239_10008608
244 Ga0105239_10028319
245 Ga0105239_11959270
246 Ga0157373_10000036
247 Ga0157373_10003820
248 Ga0157373_10008118
249 Ga0157371_10002946
250 Ga0157371_10040503
251 Ga0157371_10043428
252 Ga0157370_10000399
253 Ga0157370_10198825
254 Ga0157370_10199497
255 Ga0157370_11261730
256 Ga0157369_10010263
257 Ga0157369_10044949
258 Ga0157369_10221609
259 Ga0157369_11249031
260 Ga0163162_10002529
261 Ga0157372_10000173
262 Ga0157372_10001390
263 Ga0157372_12053323
264 Ga0182008_10000011
265 Ga0182006_1054700
266 Ga0182006_1075021
267 Ga0163161_10000168
268 Ga0163161_10001157
269 Ga0163161_10050013
270 Ga0207427_100122
271 Ga0207427_106393
272 Ga0209437_100048
273 Ga0209437_100119
274 Ga0207425_1000004
275 Ga0209129_1000005
276 Ga0209129_1010646
277 Ga0209233_1000029
278 Ga0209233_1001847
279 Ga0209025_1000009
280 Ga0209758_1000010
281 Ga0207655_1000381
282 Ga0207647_10002110
283 Ga0207707_10038435
284 Ga0207671_10001993
285 Ga0207671_10007421
286 Ga0207671_10012842
287 Ga0207690_10067555
288 Ga0207667_10527497
289 Ga0207667_10576728
290 Ga0207640_10009382
291 Ga0207674_10033219
292 Ga0207674_10248299
293 Ga0209281_1000566
294 Ga0209489_117438
295 Ga0209282_1052071
296 Ga0307515_10001710
297 Ga0307515_10001900
298 Ga0316181_1019090
299 Ga0307516_10332405
300 Ga0307516_10460108
301 Ga0307410_10000089
302 Ga0307406_10000037
303 Ga0307407_10005460
304 Ga0307412_10684386
305 Ga0307414_10000012
306 Ga0307414_10007370
307 Ga0307414_10045487
308 Ga0307414_10100319
309 Ga0307507_10000309
310 Ga0307510_10000671
311 Ga0373946_0439707
312 Ga0395900_0372718
313 Ga0439466_0002630
314 Ga0451804_0383802
315 Ga0451841_0526097
316 Ga0466972_0000159
317 Ga0466970_0001499
318 Ga0495638_0114009
319 Ga0495650_0000144
320 Ga0495585_0000091
321 Ga0495585_0000241
322 Ga0495585_0170418
323 Ga0495606_0009540
324 Ga0495606_0021269
325 Ga0495606_0166956
326 Ga0495606_0220509
327 Ga0495606_0251495
328 Ga0495610_0008174
329 Ga0495610_0175887
330 Ga0495616_0011104
331 Ga0495616_0011972
332 Ga0495616_0198102
333 Ga0495648_0004406
334 Ga0495648_0005249
335 Ga0495648_0087712
336 Ga0495663_0000151
337 Ga0495652_0216762
338 Ga0495609_0048637
339 Ga0495609_0084056
340 Ga0495622_0043496
341 Ga0495633_0000006
342 Ga0495633_0007299
343 Ga0495668_0000054
344 Ga0495668_0166329
345 Ga0495625_0000059
346 Ga0495625_0000355
347 Ga0495625_0000548
348 Ga0495625_0260091
349 Ga0495661_0057199
350 Ga0495588_0219320
351 Ga0495658_0020053
352 Ga0495670_0298134
353 Ga0495671_0068767
354 Ga0495649_0000031
355 Ga0495600_0544270
356 Ga0495660_0113604
357 Ga0495660_0346065
358 Ga0495683_0071605
359 Ga0495687_037873
360 Ga0495673_0050763
361 Ga0495686_0000066
362 Ga0495614_0004728
363 Ga0496114_0370695
364 Ga0496115_0026826
365 Ga0496116_0000030
366 Ga0496117_0160796
367 Ga0496121_0033430
368 Ga0496121_0152902
369 Ga0496124_0015286
370 Ga0496124_0878574
371 Ga0496125_0000035
372 Ga0496125_0459270
373 Ga0496126_0012027
374 Ga0495678_008057
375 Ga0495682_0011476
376 Ga0501238_000032
377 Ga0501280_000125
378 nmdc:mga0k408_1202_c1
379 nmdc:mga0k408_245_c1
380 nmdc:mga0k408_762610_c1
381 nmdc:mga07m45_206109_c1
382 Ga0500583_0416995
383 Ga0500614_010285
384 Ga0500618_000018
385 Ga0500618_020719
386 Ga0500652_168863
387 Ga0500658_0000024
388 2513234806
389 2599481991
390 2738736530
391 2738766831
392 2739218112
393 2896089822
394 2928082099
395 2928149323
396 2929180799
397 2932087941
398 2945983196
399 2946017413

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

46

150

0.83

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

19

142

0.8

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

52

144

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9657 4 163
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9645 4 163
3d8p-assembly2.cif.gz_B crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.954 4 163
3d8p-assembly1.cif.gz_A crystal structure of acetyltransferase of gnat family (np_373092.1) from staphylococcus aureus mu50 at 2.20 a resolution 0.9526 4 163
2q7b-assembly1.cif.gz_A-2 crystal structure of acetyltransferase (np_689019.1) from streptococcus agalactiae 2603 at 2.00 a resolution 0.9435 1 163
ID Description Score Start End Superfamily
3d8pA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9551 4 162 3.40.630.30
3d8pA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9372 4 162 3.40.630.30
2q7bA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9134 1 163 3.40.630.30
2q7bA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.908 1 163 3.40.630.30
af_Q5A798_297_388_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8898 54 70 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A443YL61-F1-model_v4 GNAT family N-acetyltransferase 0.9952 4 163 GO:0008080
AF-A0A2T7BNZ0-F1-model_v4 GNAT family N-acetyltransferase 0.993 6 163 GO:0008080
AF-A0A316XKD0-F1-model_v4 GNAT family N-acetyltransferase 0.9922 4 163 GO:0008080
AF-A0A1I3VVI8-F1-model_v4 deleted 0.9917 4 163
AF-A0A4S5J0A2-F1-model_v4 deleted 0.9908 4 122

Map