F306061

General Info

Members Datasets Scaffolds Average Seq Length
199 175 398 313

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0310712|Ga0395898_0310712_54_1094
Length 339
Sequence VVDNDFQFHLDIYVLSVDQNDRILEILETIMKKRYLLPTLIVLSLISLFIGVSNITPLDLLDVQSEETQIFLISRLPRLVAILLAGAGMSIAGIIMQQLSRNKFVSPTTAGTLDATRLGILVSMLLFANASMMEKMAVAFVFALAGTFLFMQILDRIKFKDAIFIPLVGMMFGNILSSVTTFFAYRADVIQNMSAWLQGDFSSIMKGRYELLYISIPILVIAYLYANRFTVAGMGEDFSKNLGLAYRRIVNIGLILVALITGIIPFIGLIIPNIISIFKGDHLQKTLPHTALLGTIFLLICDILGRIIIYPYEISISLMVGVIGSGIFLYLLFRRKAHA

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
9 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
10 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
11 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
12 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
13 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
14 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
15 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
16 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
17 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
18 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
19 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
23 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
24 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
25 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
26 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
27 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
28 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
29 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
30 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
31 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
32 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
33 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
34 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
35 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
36 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
37 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
38 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
39 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
40 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
41 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
42 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
43 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
44 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
45 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
46 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
47 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
48 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
49 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
50 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
56 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
57 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
58 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
59 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
60 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
61 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
62 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
63 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
64 2554235283 Bacillus safensis VK Isolate Rhizosphere
65 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
66 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
67 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
68 2643221732 Bacillus sp. Root239 Isolate Unclassified
69 2643221735 Bacillus sp. Root920 Isolate Unclassified
70 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
71 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
72 2671180694 Paenibacillus sp. A3 Isolate Unclassified
73 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
74 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
75 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
76 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
77 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
78 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
79 2738541295 Bacillus sp. OK085 Isolate Unclassified
80 2738543010 Bacillus sp. YR335 Isolate Unclassified
81 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
82 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
83 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
84 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
85 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
86 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
87 2811994870 Bacillus sp. JB4 Isolate Unclassified
88 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
89 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
90 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
91 2818991441 Niallia circulans 3243 Isolate Rhizosphere
92 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
93 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
94 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
95 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
96 2842682962 Bacillus sp. R-72492 Isolate Unclassified
97 2842882022 Bacillus sp. R-71893 Isolate Unclassified
98 2849139964 Bacillus sp. R-71875 Isolate Unclassified
99 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
100 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
101 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
102 2857581216 Bacillus sp. R-71922 Isolate Unclassified
103 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
104 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
105 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
106 2860837431 Bacillus sp. WR11 Isolate Unclassified
107 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
108 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
109 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
110 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
111 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
112 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
113 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
114 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
115 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
116 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
117 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
118 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
119 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
120 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
121 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
122 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
123 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
124 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
125 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
126 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
127 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
128 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
129 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
130 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
131 2919720352 Priestia megaterium 4340 Isolate Unclassified
132 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
133 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
134 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
135 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
136 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
137 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
138 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
139 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
140 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
141 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
142 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
143 2969141011 Bacillus velezensis MH25 Isolate Unclassified
144 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
145 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
146 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
147 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
148 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
149 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
150 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
151 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
152 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
153 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
154 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
155 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
156 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
157 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
158 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
159 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
160 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
161 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
162 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
163 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
164 8022653035 Bacillus sp. Rc4 Isolate Unclassified
165 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
166 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
167 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
168 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
169 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
170 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
171 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
172 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
173 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
174 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
175 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 35.18
Metatranscriptomes 5.53
Isolates 59.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.56
Nodule 1.01
Rhizoplane 5.53
Rhizosphere 49.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0310712 3300037466 Bacteria 1504
2 JGI25151J46595_10008159 3300003187 Bacteria 5064
3 JGI25151J46595_10010264 3300003187 Bacteria 4363
4 JGI25151J46595_10032651 3300003187 Bacteria 2015
5 JGI25151J46595_10036122 3300003187 Bacteria 1868
6 rootH1_10019422 3300003316 Bacteria 13956
7 Ga0006562J51391_1007902 3300003578 Bacteria 13430
8 Ga0055538_1000187 3300003751 Bacteria 37729
9 Ga0055538_1000276 3300003751 Bacteria 26446
10 Ga0055532_1000553 3300003758 Bacteria 15893
11 Ga0055532_1002106 3300003758 Bacteria 4517
12 Ga0055528_1004515 3300003790 Bacteria 6680
13 Ga0105244_10059921 3300009036 Bacteria 1918
14 Ga0105242_10228988 3300009176 Bacteria 1665
15 Ga0157371_10004890 3300013102 Bacteria 11511
16 Ga0157371_10348427 3300013102 Bacteria 1078
17 Ga0157378_10306091 3300013297 Bacteria 1540
18 Ga0157372_10481020 3300013307 Bacteria 1448
19 Ga0157377_10105896 3300014745 Bacteria 1684
20 Ga0157376_10459937 3300014969 Bacteria 1243
21 Ga0209784_100078 3300025224 Bacteria 137701
22 Ga0209784_100165 3300025224 Bacteria 57266
23 Ga0209147_100115 3300025229 Bacteria 143934
24 Ga0209147_101199 3300025229 Bacteria 10470
25 Ga0209147_102699 3300025229 Bacteria 4071
26 Ga0209025_1002600 3300025294 Bacteria 18617
27 Ga0209025_1004973 3300025294 Bacteria 11123
28 Ga0209025_1008020 3300025294 Bacteria 7690
29 Ga0209025_1012214 3300025294 Bacteria 5536
30 Ga0209025_1016965 3300025294 Bacteria 4244
31 Ga0209025_1021589 3300025294 Bacteria 3461
32 Ga0209025_1025252 3300025294 Bacteria 3031
33 Ga0209025_1027927 3300025294 Bacteria 2781
34 Ga0207426_1021267 3300025302 Bacteria 2243
35 Ga0207655_1025668 3300025728 Bacteria 2854
36 Ga0207655_1033612 3300025728 Bacteria 2321
37 Ga0207655_1035457 3300025728 Bacteria 2227
38 Ga0207713_1008463 3300025735 Bacteria 5922
39 Ga0207686_10169813 3300025934 Bacteria 1537
40 Ga0209371_1008402 3300027312 Bacteria 3440
41 Ga0268256_1008750 3300030500 Bacteria 3440
42 Ga0307408_100034834 3300031548 Bacteria 3529
43 Ga0307416_100205157 3300032002 Bacteria 1874
44 Ga0307416_100592568 3300032002 Bacteria 1187
45 Ga0495603_0015951 3300046455 Bacteria 4540
46 Ga0495603_0192713 3300046455 Bacteria 1178
47 Ga0495633_0073856 3300046558 Bacteria 1590
48 Ga0495661_0089992 3300046665 Bacteria 1748
49 Ga0496100_0002137 3300048903 Bacteria 9951
50 Ga0496101_0060541 3300048904 Bacteria 2747
51 Ga0496104_0380273 3300048907 Bacteria 1324
52 Ga0496105_0001127 3300048908 Bacteria 18616
53 Ga0496106_0006249 3300048909 Bacteria 8817
54 Ga0496107_0000352 3300048910 Bacteria 25045
55 Ga0496109_0005408 3300048912 Bacteria 10680
56 Ga0496110_0000317 3300048913 Bacteria 31945
57 Ga0496111_0004205 3300048914 Bacteria 9065
58 Ga0496112_0024824 3300048915 Bacteria 5749
59 Ga0496113_0151510 3300048916 Bacteria 1829
60 Ga0496116_0243528 3300048919 Bacteria 901
61 Ga0496117_0040482 3300048920 Bacteria 3426
62 Ga0496118_0113110 3300048921 Bacteria 1794
63 Ga0496119_0005454 3300048922 Bacteria 12183
64 Ga0496119_0007104 3300048922 Bacteria 10177
65 Ga0496121_0093405 3300048924 Bacteria 2342
66 Ga0496121_0109276 3300048924 Bacteria 2113
67 Ga0496121_0313267 3300048924 Bacteria 1060
68 Ga0496123_0057725 3300048926 Bacteria 2524
69 Ga0496124_0091988 3300048927 Bacteria 2471
70 Ga0496125_0004188 3300048928 Bacteria 16805
71 Ga0496126_0024762 3300048929 Bacteria 5788
72 Ga0501306_003412 3300049127 Bacteria 1709
73 Ga0501305_002965 3300049161 Bacteria 1881
74 Ga0501315_001765 3300049531 Bacteria 1922
75 Ga0501318_001444 3300049534 Bacteria 1869
76 Ga0501320_005859 3300049536 Bacteria 1134
77 Ga0501321_000165 3300049537 Bacteria 3615
78 Ga0501323_002085 3300049539 Bacteria 1894
79 Ga0501323_002417 3300049539 Bacteria 1805
80 Ga0501324_002879 3300049540 Bacteria 1282
81 Ga0501328_00207 3300049544 Bacteria 1718
82 2511176904 2510917027 Bacteria 5287437
83 2511698252 2511231119 Bacteria 4019861
84 2512639189 2512564013 Bacteria 6286191
85 2512736825 2512564039 Bacteria 8739048
86 2540605491 2540341094 Bacteria 4061186
87 2545558545 2545555800 Bacteria 4222588
88 2555470739 2554235283 Bacteria 3683090
89 2563927293 2563366752 Bacteria 4961801
90 2578932997 2576861599 Bacteria 4217202
91 2631983420 2630968484 Bacteria 3876276
92 2644725899 2643221732 Bacteria 5756404
93 2644739369 2643221735 Bacteria 3676263
94 2651532293 2648501850 Bacteria 3975476
95 2672338463 2671180330 Bacteria 5521719
96 2673819268 2671180694 Bacteria 7506943
97 2674420880 2671180844 Bacteria 4164150
98 2687497505 2687453109 Bacteria 3860091
99 2695630163 2695420354 Bacteria 3922431
100 2717917928 2716884898 Bacteria 3928789
101 2723606002 2721755693 Bacteria 6126117
102 2730136668 2728369359 Bacteria 5621728
103 2738815241 2738541295 Bacteria 5730091
104 2739231815 2738543010 Bacteria 5583595
105 2745168720 2744054657 Bacteria 5016802
106 2753811382 2751185905 Bacteria 6142767
107 2791215618 2788500588 Bacteria 4584915
108 2802439717 2802428803 Bacteria 5806948
109 2808867159 2808606364 Bacteria 4465927
110 2809055335 2808606399 Bacteria 4021018
111 2812315378 2811994870 Bacteria 3776934
112 2816865604 2816332186 Bacteria 5331395
113 2817478543 2816332295 Bacteria 4352468
114 2817618328 2816332336 Bacteria 5207640
115 2819569740 2818991441 Bacteria 5062707
116 2819627184 2818991451 Bacteria 4697364
117 2819710503 2818991465 Bacteria 5388835
118 2821116599 2821111986 Bacteria 6894338
119 2823527358 2823526263 Bacteria 3765752
120 2842686435 2842682962 Bacteria 5589973
121 2842883461 2842882022 Bacteria 6158489
122 2849143308 2849139964 Bacteria 5613304
123 2852676738 2852673933 Bacteria 3347676
124 2857463515 2857460504 Bacteria 5194327
125 2857468688 2857465823 Bacteria 6772595
126 2857583400 2857581216 Bacteria 5522813
127 2857595664 2857591370 Bacteria 6569758
128 2857604988 2857604169 Bacteria 5111450
129 2857609907 2857609550 Bacteria 3753890
130 2860837863 2860837431 Bacteria 4202080
131 2864999918 2864997549 Bacteria 5139696
132 2865007175 2865002811 Bacteria 6333767
133 2877769041 2877768649 Bacteria 3957164
134 2880169983 2880169592 Bacteria 3900066
135 2881647129 2881644220 Bacteria 5302661
136 2885532353 2885526491 Bacteria 7164189
137 2889276553 2889276214 Bacteria 5979355
138 2889296160 2889295896 Bacteria 4704906
139 2897110016 2897109615 Bacteria 4009619
140 2904167881 2904162308 Bacteria 7086713
141 2904525865 2904524088 Bacteria 5887454
142 2904562505 2904560550 Bacteria 4029838
143 2904599763 2904595352 Bacteria 6124848
144 2904609298 2904606771 Bacteria 4684500
145 2904756159 2904755435 Bacteria 7986759
146 2907207091 2907202186 Bacteria 6632024
147 2908666425 2908665501 Bacteria 3678115
148 2915598086 2915597211 Bacteria 6475886
149 2915612757 2915606848 Bacteria 6032732
150 2916975146 2916971899 Bacteria 4250608
151 2919093458 2919093281 Bacteria 3660974
152 2919145543 2919143609 Bacteria 6219228
153 2919430228 2919425241 Bacteria 8055701
154 2919517482 2919517244 Bacteria 5858162
155 2919721865 2919720352 Bacteria 5986006
156 2928094378 2928093941 Bacteria 5965005
157 2928512877 2928510474 Bacteria 4815308
158 2929189605 2929183550 Bacteria 6377511
159 2929211755 2929206907 Bacteria 5918291
160 2939595792 2939593269 Bacteria 4798695
161 2954775139 2954773129 Bacteria 3741715
162 2960321734 2960319331 Bacteria 5502575
163 2960380010 2960375949 Bacteria 5361395
164 2962291176 2962290636 Bacteria 4072939
165 2964378457 2964375228 Bacteria 4909004
166 2969137287 2969136845 Bacteria 3923176
167 2969141422 2969141011 Bacteria 4118468
168 2969766207 2969765954 Bacteria 4216713
169 2969773820 2969770375 Bacteria 4271280
170 2971893788 2971893375 Bacteria 3929648
171 2980128628 2980125574 Bacteria 5567337
172 2980493035 2980492589 Bacteria 4072961
173 2981287903 2981284811 Bacteria 4641497
174 2981292384 2981289755 Bacteria 4641509
175 2981983522 2981980479 Bacteria 4641628
176 2981988440 2981985349 Bacteria 4641497
177 2996709953 2996706504 Bacteria 5757485
178 3001270842 3001267043 Bacteria 4823521
179 3001276471 3001272096 Bacteria 4729684
180 3006828634 3006826541 Bacteria 4678913
181 3006858865 3006858327 Bacteria 4317835
182 3006881951 3006879489 Bacteria 4064221
183 3006973531 3006969106 Bacteria 4739423
184 3006978283 3006973921 Bacteria 4423788
185 3006991773 3006988479 Bacteria 4767936
186 648172016 648028048 Bacteria 5394884
187 8022634098 8022630665 Bacteria 3886130
188 8022656439 8022653035 Bacteria 4035078
189 8022898619 8022893055 Bacteria 5300455
190 8022920532 8022914991 Bacteria 5584517
191 8022952968 8022948649 Bacteria 5366783
192 8051955945 8051952484 Bacteria 3926774
193 8052177718 8052174270 Bacteria 3881265
194 8054799732 8054795415 Bacteria 9785225
195 8055536796 8055531788 Bacteria 5249694
196 8056534913 8056533031 Bacteria 8964429
197 8057474865 8057473075 Bacteria 5892720
198 8057632651 8057632132 Bacteria 4726859
199 8057734935 8057733483 Bacteria 6578323
200 Ga0395898_0310712
201 JGI25151J46595_10008159
202 JGI25151J46595_10010264
203 JGI25151J46595_10032651
204 JGI25151J46595_10036122
205 rootH1_10019422
206 Ga0006562J51391_1007902
207 Ga0055538_1000187
208 Ga0055538_1000276
209 Ga0055532_1000553
210 Ga0055532_1002106
211 Ga0055528_1004515
212 Ga0105244_10059921
213 Ga0105242_10228988
214 Ga0157371_10004890
215 Ga0157371_10348427
216 Ga0157378_10306091
217 Ga0157372_10481020
218 Ga0157377_10105896
219 Ga0157376_10459937
220 Ga0209784_100078
221 Ga0209784_100165
222 Ga0209147_100115
223 Ga0209147_101199
224 Ga0209147_102699
225 Ga0209025_1002600
226 Ga0209025_1004973
227 Ga0209025_1008020
228 Ga0209025_1012214
229 Ga0209025_1016965
230 Ga0209025_1021589
231 Ga0209025_1025252
232 Ga0209025_1027927
233 Ga0207426_1021267
234 Ga0207655_1025668
235 Ga0207655_1033612
236 Ga0207655_1035457
237 Ga0207713_1008463
238 Ga0207686_10169813
239 Ga0209371_1008402
240 Ga0268256_1008750
241 Ga0307408_100034834
242 Ga0307416_100205157
243 Ga0307416_100592568
244 Ga0495603_0015951
245 Ga0495603_0192713
246 Ga0495633_0073856
247 Ga0495661_0089992
248 Ga0496100_0002137
249 Ga0496101_0060541
250 Ga0496104_0380273
251 Ga0496105_0001127
252 Ga0496106_0006249
253 Ga0496107_0000352
254 Ga0496109_0005408
255 Ga0496110_0000317
256 Ga0496111_0004205
257 Ga0496112_0024824
258 Ga0496113_0151510
259 Ga0496116_0243528
260 Ga0496117_0040482
261 Ga0496118_0113110
262 Ga0496119_0005454
263 Ga0496119_0007104
264 Ga0496121_0093405
265 Ga0496121_0109276
266 Ga0496121_0313267
267 Ga0496123_0057725
268 Ga0496124_0091988
269 Ga0496125_0004188
270 Ga0496126_0024762
271 Ga0501306_003412
272 Ga0501305_002965
273 Ga0501315_001765
274 Ga0501318_001444
275 Ga0501320_005859
276 Ga0501321_000165
277 Ga0501323_002085
278 Ga0501323_002417
279 Ga0501324_002879
280 Ga0501328_00207
281 2511176904
282 2511698252
283 2512639189
284 2512736825
285 2540605491
286 2545558545
287 2555470739
288 2563927293
289 2578932997
290 2631983420
291 2644725899
292 2644739369
293 2651532293
294 2672338463
295 2673819268
296 2674420880
297 2687497505
298 2695630163
299 2717917928
300 2723606002
301 2730136668
302 2738815241
303 2739231815
304 2745168720
305 2753811382
306 2791215618
307 2802439717
308 2808867159
309 2809055335
310 2812315378
311 2816865604
312 2817478543
313 2817618328
314 2819569740
315 2819627184
316 2819710503
317 2821116599
318 2823527358
319 2842686435
320 2842883461
321 2849143308
322 2852676738
323 2857463515
324 2857468688
325 2857583400
326 2857595664
327 2857604988
328 2857609907
329 2860837863
330 2864999918
331 2865007175
332 2877769041
333 2880169983
334 2881647129
335 2885532353
336 2889276553
337 2889296160
338 2897110016
339 2904167881
340 2904525865
341 2904562505
342 2904599763
343 2904609298
344 2904756159
345 2907207091
346 2908666425
347 2915598086
348 2915612757
349 2916975146
350 2919093458
351 2919145543
352 2919430228
353 2919517482
354 2919721865
355 2928094378
356 2928512877
357 2929189605
358 2929211755
359 2939595792
360 2954775139
361 2960321734
362 2960380010
363 2962291176
364 2964378457
365 2969137287
366 2969141422
367 2969766207
368 2969773820
369 2971893788
370 2980128628
371 2980493035
372 2981287903
373 2981292384
374 2981983522
375 2981988440
376 2996709953
377 3001270842
378 3001276471
379 3006828634
380 3006858865
381 3006881951
382 3006973531
383 3006978283
384 3006991773
385 648172016
386 8022634098
387 8022656439
388 8022898619
389 8022920532
390 8022952968
391 8051955945
392 8052177718
393 8054799732
394 8055536796
395 8056534913
396 8057474865
397 8057632651
398 8057734935

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01032

FecCD

FecCD transport family

39

334

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.8824 1 323
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.8773 1 323
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.8772 1 323
1l7v-assembly1.cif.gz_B bacterial abc transporter involved in b12 uptake 0.8722 1 323
4g1u-assembly1.cif.gz_B x-ray structure of the bacterial heme transporter hmuuv from yersinia pestis 0.8489 16 321
ID Description Score Start End Superfamily
af_Q2G074_3_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9438 13 323 1.10.3470.10
af_Q2G074_3_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9294 13 323 1.10.3470.10
af_Q57552_11_347_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8826 10 325 1.10.3470.10
1l7vB00 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.868 7 323 1.10.3470.10
1l7vB00 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8604 7 323 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A7X6WVM4-F1-model_v4 Iron chelate uptake ABC transporter family permease subunit 0.9592 16 327 GO:0005886
GO:0022857
GO:0033214
AF-A0A5J5HIA6-F1-model_v4 ABC transporter permease 0.9588 16 327 GO:0005886
GO:0022857
GO:0033214
AF-A0A6I6A687-F1-model_v4 Iron chelate uptake ABC transporter family permease subunit 0.9568 19 326 GO:0005886
GO:0022857
GO:0033214
AF-A0A2S2FID3-F1-model_v4 Iron chelate uptake ABC transporter family permease subunit 0.9545 16 327 GO:0005886
GO:0022857
GO:0033214
AF-A0A133CZA3-F1-model_v4 Iron chelate uptake ABC transporter family permease subunit 0.9542 16 327 GO:0005886
GO:0022857
GO:0033214

Map