F305880

General Info

Members Datasets Scaffolds Average Seq Length
199 133 398 404

Family's Representative Sequence

Representative Sequence 3300025928|Ga0207700_10179090|Ga0207700_101790901
Length 449
Sequence MPWSSMKACSNSSVRWSAGTRAAGAAAGYNRTMHRTFVVALALFAAAATVLAEPQKPTTAPAAQKPQEGVLTPXXQQTPVIRRSVDLVTTDLIVRDDQGQFVSSLAKKDFDVYEDGVKQDVVTFVLTHGGRVLSPTNDASGRIFLIFVDDLHMDFRNTGRIRDLFKKISKELIHQDDMFGIVSTGPSSIAVDMTYDHKRLDEAINKISGNGLKPDEIIDVPDGSQGPPEVRYRAHVAFSTAYDVLKNLEQVHNRRKAFIYVSDGYDYDPFKKARQAASIERQGGSCTNPADPTSCSAVNPFDQNHTSNEFAAADLAAELSELTKEANRANVTMYTIDPRGLVGGPDLDQTKVDMTDWQDYVRESQNSLRVIAELTGGMAVVNQNDFDKALKRIDAETSDYYVLGYYSSNPDPLKKKRNIEIKVNKGGKYDLRYKTSYTLKPLPGPKVSK

Samples

Sample ID Description Type Environment
1 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
94 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
95 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
96 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
97 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
98 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
99 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
116 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
117 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
118 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
119 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
120 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
121 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
122 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
123 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
132 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
133 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.08
Nodule 0
Rhizoplane 2.01
Rhizosphere 82.91
Stem 0
Stem Tuber 0
Unclassified 15.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207700_10179090 3300025928 Bacteria 1774
2 Ga0065712_10083231 3300005290 Bacteria 2853
3 Ga0065712_10092295 3300005290 Bacteria 2336
4 Ga0065712_10110029 3300005290 Unclassified 1840
5 Ga0065715_10097872 3300005293 Unclassified 3637
6 Ga0065715_10126321 3300005293 Unclassified 2107
7 Ga0070670_100006131 3300005331 Bacteria 10167
8 Ga0070670_100051777 3300005331 Bacteria 3525
9 Ga0070670_100070461 3300005331 Bacteria 3001
10 Ga0068869_100006316 3300005334 Bacteria 7503
11 Ga0070689_100036049 3300005340 Bacteria 3782
12 Ga0070689_100077049 3300005340 Bacteria 2612
13 Ga0070691_10056818 3300005341 Unclassified 1877
14 Ga0070669_100019575 3300005353 Bacteria 4834
15 Ga0070675_100001605 3300005354 Bacteria 16679
16 Ga0070671_100005119 3300005355 Bacteria 10439
17 Ga0070674_100063897 3300005356 Bacteria 2578
18 Ga0070674_100108382 3300005356 Unclassified 2035
19 Ga0070673_100004033 3300005364 Bacteria 9246
20 Ga0070673_100061220 3300005364 Bacteria 2986
21 Ga0070688_100015922 3300005365 Bacteria 4288
22 Ga0070701_10004502 3300005438 Bacteria 5653
23 Ga0070705_100122840 3300005440 Bacteria 1679
24 Ga0070694_100127600 3300005444 Bacteria 1833
25 Ga0070678_100016655 3300005456 Bacteria 4708
26 Ga0068867_100008307 3300005459 Bacteria 7329
27 Ga0070685_10031789 3300005466 Bacteria 2952
28 Ga0070685_10094166 3300005466 Bacteria 1819
29 Ga0070679_100048666 3300005530 Unclassified 4223
30 Ga0070684_100129465 3300005535 Bacteria 2276
31 Ga0070693_100047161 3300005547 Bacteria 2451
32 Ga0070664_100023467 3300005564 Bacteria 5096
33 Ga0068857_100010905 3300005577 Bacteria 7910
34 Ga0068852_100139184 3300005616 Bacteria 2244
35 Ga0068859_100079161 3300005617 Bacteria 3326
36 Ga0068864_100130040 3300005618 Bacteria 2261
37 Ga0068858_100018512 3300005842 Bacteria 6520
38 Ga0075365_10006436 3300006038 Bacteria 6463
39 Ga0075365_10015405 3300006038 Bacteria 4626
40 Ga0075365_10079635 3300006038 Bacteria 2217
41 Ga0075363_100022921 3300006048 Bacteria 3161
42 Ga0075364_10011012 3300006051 Bacteria 5485
43 Ga0075364_10030102 3300006051 Bacteria 3483
44 Ga0075364_10045993 3300006051 Bacteria 2841
45 Ga0075364_10072653 3300006051 Unclassified 2267
46 Ga0075362_10004087 3300006177 Bacteria 5202
47 Ga0075362_10008565 3300006177 Bacteria 3918
48 Ga0075367_10013082 3300006178 Bacteria 4446
49 Ga0075367_10033828 3300006178 Bacteria 2948
50 Ga0075367_10073404 3300006178 Unclassified 2061
51 Ga0075366_10000516 3300006195 Bacteria 17834
52 Ga0075366_10011462 3300006195 Bacteria 5007
53 Ga0075370_10012439 3300006353 Bacteria 4497
54 Ga0075428_100024655 3300006844 Bacteria 6658
55 Ga0075430_100099992 3300006846 Unclassified 2422
56 Ga0075431_100019374 3300006847 Bacteria 6934
57 Ga0075429_100075613 3300006880 Bacteria 2934
58 Ga0075429_100099791 3300006880 Bacteria 2533
59 Ga0068865_100033730 3300006881 Bacteria 3429
60 Ga0097620_100079160 3300006931 Bacteria 3326
61 Ga0075435_100004954 3300007076 Bacteria 9239
62 Ga0105240_10074575 3300009093 Bacteria 4187
63 Ga0111539_10003932 3300009094 Bacteria 19530
64 Ga0111539_10029114 3300009094 Bacteria 6733
65 Ga0105245_10065943 3300009098 Bacteria 3275
66 Ga0114129_10001069 3300009147 Bacteria 36016
67 Ga0114129_10026562 3300009147 Bacteria 8200
68 Ga0114129_10045766 3300009147 Bacteria 6150
69 Ga0114129_10150755 3300009147 Unclassified 3182
70 Ga0105241_10034421 3300009174 Bacteria 3805
71 Ga0105242_10037403 3300009176 Bacteria 3898
72 Ga0105248_10069014 3300009177 Bacteria 3968
73 Ga0105248_10083964 3300009177 Bacteria 3583
74 Ga0105239_10071784 3300010375 Bacteria 3804
75 Ga0157375_10282851 3300013308 Bacteria 1822
76 Ga0163163_10029464 3300014325 Bacteria 5281
77 Ga0163163_10032750 3300014325 Bacteria 5022
78 Ga0157380_10011201 3300014326 Bacteria 6473
79 Ga0157380_10024234 3300014326 Unclassified 4590
80 Ga0157380_10108085 3300014326 Unclassified 2331
81 Ga0207697_10003352 3300025315 Bacteria 7963
82 Ga0207682_10046392 3300025893 Bacteria 1786
83 Ga0207642_10014442 3300025899 Bacteria 2915
84 Ga0207688_10144595 3300025901 Bacteria 1401
85 Ga0207680_10041664 3300025903 Bacteria 2681
86 Ga0207699_10036573 3300025906 Bacteria 2800
87 Ga0207645_10059160 3300025907 Bacteria 2447
88 Ga0207654_10075345 3300025911 Bacteria 2016
89 Ga0207695_10117330 3300025913 Bacteria 2634
90 Ga0207662_10001397 3300025918 Bacteria 11669
91 Ga0207652_10067328 3300025921 Bacteria 3105
92 Ga0207681_10042617 3300025923 Unclassified 3033
93 Ga0207681_10242810 3300025923 Unclassified 1403
94 Ga0207650_10009789 3300025925 Bacteria 6552
95 Ga0207650_10013100 3300025925 Bacteria 5736
96 Ga0207659_10059269 3300025926 Bacteria 2751
97 Ga0207644_10014497 3300025931 Bacteria 5272
98 Ga0207706_10048151 3300025933 Bacteria 3770
99 Ga0207670_10020894 3300025936 Bacteria 4030
100 Ga0207691_10073791 3300025940 Bacteria 3077
101 Ga0207711_10016817 3300025941 Bacteria 6075
102 Ga0207689_10018657 3300025942 Bacteria 5852
103 Ga0207651_10002308 3300025960 Bacteria 9081
104 Ga0207651_10011973 3300025960 Bacteria 4882
105 Ga0207712_10121984 3300025961 Bacteria 1973
106 Ga0207708_10014632 3300026075 Bacteria 5871
107 Ga0207708_10140115 3300026075 Unclassified 1896
108 Ga0207648_10020888 3300026089 Bacteria 5895
109 Ga0207648_10100606 3300026089 Unclassified 2533
110 Ga0207676_10111562 3300026095 Bacteria 2289
111 Ga0207674_10017271 3300026116 Bacteria 7872
112 Ga0207675_100176817 3300026118 Unclassified 2042
113 Ga0207683_10025057 3300026121 Bacteria 5143
114 Ga0207683_10068855 3300026121 Bacteria 3125
115 Ga0207698_10289934 3300026142 Unclassified 1518
116 Ga0207428_10014604 3300027907 Bacteria 6810
117 Ga0207428_10017280 3300027907 Bacteria 6193
118 Ga0307408_100010751 3300031548 Bacteria 6039
119 Ga0307408_100046997 3300031548 Bacteria 3089
120 Ga0307408_100070229 3300031548 Bacteria 2585
121 Ga0307413_10000281 3300031824 Bacteria 15624
122 Ga0307407_10000476 3300031903 Bacteria 12313
123 Ga0307412_10045239 3300031911 Bacteria 2876
124 Ga0307416_100001676 3300032002 Bacteria 12247
125 Ga0307416_100070483 3300032002 Bacteria 2899
126 Ga0307416_100289499 3300032002 Bacteria 1621
127 Ga0307411_10004778 3300032005 Bacteria 6559
128 Ga0307411_10044745 3300032005 Bacteria 2842
129 Ga0373933_0079235 3300035724 Bacteria 2011
130 Ga0373937_0016673 3300036401 Bacteria 6527
131 Ga0373925_0005881 3300037068 Bacteria 9091
132 Ga0451793_0884404 3300041452 Bacteria 1352
133 Ga0439449_0005618 3300042007 Bacteria 4796
134 Ga0439446_0005326 3300042156 Bacteria 3306
135 Ga0439434_0022892 3300042435 Bacteria 1879
136 Ga0439435_0010141 3300042436 Unclassified 2228
137 Ga0451577_0120517 3300042876 Bacteria 2350
138 Ga0496103_0097681 3300048906 Unclassified 1857
139 Ga0496108_0090777 3300048911 Bacteria 2597
140 Ga0496110_0043497 3300048913 Bacteria 3922
141 Ga0501034_0014418 3300049571 Bacteria 8141
142 Ga0501036_0153548 3300049572 Bacteria 1942
143 Ga0501036_0173188 3300049572 Bacteria 1818
144 Ga0501038_0090715 3300049574 Unclassified 2561
145 Ga0501038_0196517 3300049574 Bacteria 1621
146 Ga0501039_0056450 3300049575 Bacteria 3042
147 Ga0501039_0212797 3300049575 Unclassified 1520
148 Ga0501040_0013108 3300049576 Bacteria 5452
149 Ga0501040_0078673 3300049576 Bacteria 2282
150 Ga0501042_0057932 3300049578 Unclassified 2765
151 Ga0501042_0126009 3300049578 Bacteria 1844
152 Ga0501046_0124556 3300049580 Bacteria 1959
153 Ga0501047_0076374 3300049581 Bacteria 3224
154 Ga0501067_0070595 3300049583 Bacteria 1934
155 Ga0501071_0013030 3300049587 Bacteria 5657
156 Ga0501071_0025947 3300049587 Unclassified 4108
157 Ga0501071_0078614 3300049587 Unclassified 2411
158 Ga0501071_0215635 3300049587 Bacteria 1444
159 Ga0501071_0254947 3300049587 Unclassified 1324
160 Ga0501072_0011382 3300049588 Bacteria 6799
161 Ga0501072_0028992 3300049588 Bacteria 4321
162 Ga0501075_0044547 3300049591 Bacteria 3329
163 Ga0501076_0017372 3300049592 Bacteria 5468
164 Ga0501076_0163266 3300049592 Bacteria 1815
165 Ga0501076_0182419 3300049592 Bacteria 1711
166 Ga0501077_0148196 3300049593 Bacteria 1489
167 Ga0501079_0028200 3300049741 Bacteria 4307
168 Ga0501079_0077285 3300049741 Unclassified 2575
169 nmdc:mga03683_2319_c1 3300050489 Bacteria 5887
170 nmdc:mga03683_6555_c1 3300050489 Bacteria 3992
171 nmdc:mga03n38_50086_c1 3300050490 Bacteria 1860
172 nmdc:mga00v17_34613_c1 3300050491 Bacteria 3002
173 nmdc:mga00v17_5028_c1 3300050491 Bacteria 6943
174 nmdc:mga0yw44_10420_c1 3300050492 Bacteria 4748
175 nmdc:mga0yw44_67442_c1 3300050492 Bacteria 2211
176 nmdc:mga0k408_3217_c1 3300050493 Bacteria 2752
177 nmdc:mga0k408_5686_c1 3300050493 Bacteria 6630
178 nmdc:mga0k408_8645_c1 3300050493 Bacteria 5473
179 nmdc:mga06z11_32941_c1 3300050494 Bacteria 2531
180 nmdc:mga06z11_68002_c1 3300050494 Bacteria 1877
181 nmdc:mga04h51_29737_c1 3300050495 Bacteria 1714
182 nmdc:mga05p37_1014_c1 3300050507 Bacteria 31952
183 nmdc:mga05p37_141615_c1 3300050507 Unclassified 2946
184 nmdc:mga05p37_4374_c2 3300050507 Bacteria 15031
185 nmdc:mga05p37_47463_c1 3300050507 Bacteria 5281
186 nmdc:mga09592_195752_c1 3300050508 Bacteria 1750
187 nmdc:mga09592_84133_c1 3300050508 Bacteria 2712
188 nmdc:mga0qj67_19519_c1 3300050509 Bacteria 5179
189 nmdc:mga0qj67_4199_c1 3300050509 Bacteria 10434
190 nmdc:mga06r32_57087_c1 3300050510 Unclassified 3750
191 nmdc:mga08y16_16474_c1 3300050511 Bacteria 7774
192 nmdc:mga08y16_209260_c1 3300050511 Unclassified 2020
193 nmdc:mga08y16_3381_c1 3300050511 Bacteria 16532
194 nmdc:mga08y16_49180_c1 3300050511 Bacteria 4413
195 nmdc:mga0n895_57361_c1 3300050512 Bacteria 3838
196 nmdc:mga0a205_181449_c1 3300050515 Bacteria 1999
197 Ga0500646_0007642 3300053090 Bacteria 2763
198 Ga0590077_002256 3300059426 Bacteria 4169
199 Ga0530510_0035718 3300061734 Bacteria 3582
200 Ga0207700_10179090
201 Ga0065712_10083231
202 Ga0065712_10092295
203 Ga0065712_10110029
204 Ga0065715_10097872
205 Ga0065715_10126321
206 Ga0070670_100006131
207 Ga0070670_100051777
208 Ga0070670_100070461
209 Ga0068869_100006316
210 Ga0070689_100036049
211 Ga0070689_100077049
212 Ga0070691_10056818
213 Ga0070669_100019575
214 Ga0070675_100001605
215 Ga0070671_100005119
216 Ga0070674_100063897
217 Ga0070674_100108382
218 Ga0070673_100004033
219 Ga0070673_100061220
220 Ga0070688_100015922
221 Ga0070701_10004502
222 Ga0070705_100122840
223 Ga0070694_100127600
224 Ga0070678_100016655
225 Ga0068867_100008307
226 Ga0070685_10031789
227 Ga0070685_10094166
228 Ga0070679_100048666
229 Ga0070684_100129465
230 Ga0070693_100047161
231 Ga0070664_100023467
232 Ga0068857_100010905
233 Ga0068852_100139184
234 Ga0068859_100079161
235 Ga0068864_100130040
236 Ga0068858_100018512
237 Ga0075365_10006436
238 Ga0075365_10015405
239 Ga0075365_10079635
240 Ga0075363_100022921
241 Ga0075364_10011012
242 Ga0075364_10030102
243 Ga0075364_10045993
244 Ga0075364_10072653
245 Ga0075362_10004087
246 Ga0075362_10008565
247 Ga0075367_10013082
248 Ga0075367_10033828
249 Ga0075367_10073404
250 Ga0075366_10000516
251 Ga0075366_10011462
252 Ga0075370_10012439
253 Ga0075428_100024655
254 Ga0075430_100099992
255 Ga0075431_100019374
256 Ga0075429_100075613
257 Ga0075429_100099791
258 Ga0068865_100033730
259 Ga0097620_100079160
260 Ga0075435_100004954
261 Ga0105240_10074575
262 Ga0111539_10003932
263 Ga0111539_10029114
264 Ga0105245_10065943
265 Ga0114129_10001069
266 Ga0114129_10026562
267 Ga0114129_10045766
268 Ga0114129_10150755
269 Ga0105241_10034421
270 Ga0105242_10037403
271 Ga0105248_10069014
272 Ga0105248_10083964
273 Ga0105239_10071784
274 Ga0157375_10282851
275 Ga0163163_10029464
276 Ga0163163_10032750
277 Ga0157380_10011201
278 Ga0157380_10024234
279 Ga0157380_10108085
280 Ga0207697_10003352
281 Ga0207682_10046392
282 Ga0207642_10014442
283 Ga0207688_10144595
284 Ga0207680_10041664
285 Ga0207699_10036573
286 Ga0207645_10059160
287 Ga0207654_10075345
288 Ga0207695_10117330
289 Ga0207662_10001397
290 Ga0207652_10067328
291 Ga0207681_10042617
292 Ga0207681_10242810
293 Ga0207650_10009789
294 Ga0207650_10013100
295 Ga0207659_10059269
296 Ga0207644_10014497
297 Ga0207706_10048151
298 Ga0207670_10020894
299 Ga0207691_10073791
300 Ga0207711_10016817
301 Ga0207689_10018657
302 Ga0207651_10002308
303 Ga0207651_10011973
304 Ga0207712_10121984
305 Ga0207708_10014632
306 Ga0207708_10140115
307 Ga0207648_10020888
308 Ga0207648_10100606
309 Ga0207676_10111562
310 Ga0207674_10017271
311 Ga0207675_100176817
312 Ga0207683_10025057
313 Ga0207683_10068855
314 Ga0207698_10289934
315 Ga0207428_10014604
316 Ga0207428_10017280
317 Ga0307408_100010751
318 Ga0307408_100046997
319 Ga0307408_100070229
320 Ga0307413_10000281
321 Ga0307407_10000476
322 Ga0307412_10045239
323 Ga0307416_100001676
324 Ga0307416_100070483
325 Ga0307416_100289499
326 Ga0307411_10004778
327 Ga0307411_10044745
328 Ga0373933_0079235
329 Ga0373937_0016673
330 Ga0373925_0005881
331 Ga0451793_0884404
332 Ga0439449_0005618
333 Ga0439446_0005326
334 Ga0439434_0022892
335 Ga0439435_0010141
336 Ga0451577_0120517
337 Ga0496103_0097681
338 Ga0496108_0090777
339 Ga0496110_0043497
340 Ga0501034_0014418
341 Ga0501036_0153548
342 Ga0501036_0173188
343 Ga0501038_0090715
344 Ga0501038_0196517
345 Ga0501039_0056450
346 Ga0501039_0212797
347 Ga0501040_0013108
348 Ga0501040_0078673
349 Ga0501042_0057932
350 Ga0501042_0126009
351 Ga0501046_0124556
352 Ga0501047_0076374
353 Ga0501067_0070595
354 Ga0501071_0013030
355 Ga0501071_0025947
356 Ga0501071_0078614
357 Ga0501071_0215635
358 Ga0501071_0254947
359 Ga0501072_0011382
360 Ga0501072_0028992
361 Ga0501075_0044547
362 Ga0501076_0017372
363 Ga0501076_0163266
364 Ga0501076_0182419
365 Ga0501077_0148196
366 Ga0501079_0028200
367 Ga0501079_0077285
368 nmdc:mga03683_2319_c1
369 nmdc:mga03683_6555_c1
370 nmdc:mga03n38_50086_c1
371 nmdc:mga00v17_34613_c1
372 nmdc:mga00v17_5028_c1
373 nmdc:mga0yw44_10420_c1
374 nmdc:mga0yw44_67442_c1
375 nmdc:mga0k408_3217_c1
376 nmdc:mga0k408_5686_c1
377 nmdc:mga0k408_8645_c1
378 nmdc:mga06z11_32941_c1
379 nmdc:mga06z11_68002_c1
380 nmdc:mga04h51_29737_c1
381 nmdc:mga05p37_1014_c1
382 nmdc:mga05p37_141615_c1
383 nmdc:mga05p37_4374_c2
384 nmdc:mga05p37_47463_c1
385 nmdc:mga09592_195752_c1
386 nmdc:mga09592_84133_c1
387 nmdc:mga0qj67_19519_c1
388 nmdc:mga0qj67_4199_c1
389 nmdc:mga06r32_57087_c1
390 nmdc:mga08y16_16474_c1
391 nmdc:mga08y16_209260_c1
392 nmdc:mga08y16_3381_c1
393 nmdc:mga08y16_49180_c1
394 nmdc:mga0n895_57361_c1
395 nmdc:mga0a205_181449_c1
396 Ga0500646_0007642
397 Ga0590077_002256
398 Ga0530510_0035718

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7n1o-assembly1.cif.gz_A the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone 0.6885 118 383
8fz4-assembly2.cif.gz_B the von willebrand factor a domain of anthrax toxin receptor 2 0.6878 122 382
1sht-assembly1.cif.gz_X crystal structure of the von willebrand factor a domain of human capillary morphogenesis protein 2: an anthrax toxin receptor 0.6849 123 381
8fz4-assembly2.cif.gz_B the von willebrand factor a domain of anthrax toxin receptor 2 0.6709 122 382
8ft8-assembly1.cif.gz_A the von willebrand factor a domain of human capillary morphogenesis gene ii, flexibly fused to the 1tel crystallization chaperone, thr-val linker variant, sumo tag-free preparation 0.6688 122 383
ID Description Score Start End Superfamily
af_Q75J93_415_620_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.7647 304 381 3.40.50.410
af_F4IDC8_324_504_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6908 123 381 3.40.50.410
af_F4IDC8_324_504_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.681 123 381 3.40.50.410
af_Q502W6_1_507_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6709 123 367 3.40.50.410
af_Q21394_33_251_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.6665 124 383 3.40.50.410
ID Description Score Start End GO Terms
AF-A0A7X4FQ04-F1-model_v4 VWA domain-containing protein 0.858 133 401
AF-A0A7X4FQ04-F1-model_v4 VWA domain-containing protein 0.8284 133 401
AF-A0A1Q7JVA6-F1-model_v4 VWFA domain-containing protein 0.755 94 383
AF-A0A1Q7JVA6-F1-model_v4 VWFA domain-containing protein 0.7491 94 383
AF-A0A7W0R9T4-F1-model_v4 VWA domain-containing protein 0.7337 168 429

Map