F305720

General Info

Members Datasets Scaffolds Average Seq Length
199 131 398 211

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_11210442|Ga0105240_112104421
Length 241
Sequence MACTVSFDPGSKFDEARPTMSLRGRFFAATYDRQIARTEKAGLRALRQQLLGAAAGDVLEIGGGTGANLPYYGSDVQSLTITEPEAPMLRRLERKAHELAPEAMVLRAPAEDLPFDDDTFDVAVSTLVLCGVTDQPRALRQLRRVLRPGGHLLFIEHVRSDDPRLARRQDRMNPINRFVVHCDCNRPTLTSIHQAGFTVTQIEHQTMPKAPSFVSPLIVGTATAPLNADAGHAPLALHSPS

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
75 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
76 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
77 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
99 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
105 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
108 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
115 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
116 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
117 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
118 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
119 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
120 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
127 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
128 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
129 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
130 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
131 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.01
Nodule 0
Rhizoplane 21.61
Rhizosphere 75.88
Stem 0
Stem Tuber 0
Unclassified 13.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_11210442 3300009093 Bacteria 799
2 Ga0070683_100555350 3300005329 Bacteria 1098
3 Ga0070682_100271123 3300005337 Bacteria 1233
4 Ga0070682_100685342 3300005337 Bacteria 820
5 Ga0068868_100472738 3300005338 Bacteria 1094
6 Ga0070660_100014035 3300005339 Bacteria 5767
7 Ga0070668_100415704 3300005347 Bacteria 1151
8 Ga0070674_100115752 3300005356 Bacteria 1977
9 Ga0070714_100424167 3300005435 Bacteria 1260
10 Ga0070713_100139808 3300005436 Bacteria 2143
11 Ga0070705_100009001 3300005440 Bacteria 4955
12 Ga0070694_100063268 3300005444 Bacteria 2529
13 Ga0070708_100312862 3300005445 Bacteria 1479
14 Ga0070681_10219643 3300005458 Bacteria 1816
15 Ga0070681_10378546 3300005458 Bacteria 1326
16 Ga0068867_100009169 3300005459 Bacteria 6985
17 Ga0070706_100150304 3300005467 Bacteria 2174
18 Ga0070706_100270798 3300005467 Bacteria 1585
19 Ga0070707_100082625 3300005468 Bacteria 3103
20 Ga0070707_100986296 3300005468 Bacteria 808
21 Ga0070698_100038787 3300005471 Bacteria 4908
22 Ga0070698_100430611 3300005471 Bacteria 1254
23 Ga0070679_100399133 3300005530 Bacteria 1321
24 Ga0070684_100272750 3300005535 Bacteria 1549
25 Ga0070697_100098049 3300005536 Bacteria 2433
26 Ga0070695_100090661 3300005545 Bacteria 2040
27 Ga0070704_100082452 3300005549 Bacteria 2371
28 Ga0070704_100152509 3300005549 Bacteria 1818
29 Ga0070704_100348678 3300005549 Unclassified 1249
30 Ga0068857_100900892 3300005577 Unclassified 848
31 Ga0068861_100083637 3300005719 Bacteria 2504
32 Ga0068858_100215699 3300005842 Bacteria 1817
33 Ga0081538_10003504 3300005981 Bacteria 14788
34 Ga0081538_10006931 3300005981 Bacteria 9858
35 Ga0081538_10056613 3300005981 Bacteria 2295
36 Ga0070717_10041304 3300006028 Bacteria 3760
37 Ga0070717_10185046 3300006028 Bacteria 1817
38 Ga0070717_10611958 3300006028 Bacteria 988
39 Ga0070715_10001632 3300006163 Bacteria 6632
40 Ga0070716_100018348 3300006173 Bacteria 3643
41 Ga0070716_100052326 3300006173 Bacteria 2324
42 Ga0070712_100007113 3300006175 Bacteria 6983
43 Ga0070712_100040838 3300006175 Bacteria 3182
44 Ga0105243_10541682 3300009148 Bacteria 1110
45 Ga0105242_10312537 3300009176 Bacteria 1438
46 Ga0105238_10701820 3300009551 Bacteria 1024
47 Ga0105239_10137309 3300010375 Bacteria 2722
48 Ga0105239_10334150 3300010375 Bacteria 1709
49 Ga0105239_10370731 3300010375 Bacteria 1618
50 Ga0105239_10831244 3300010375 Bacteria 1059
51 Ga0157374_10055967 3300013296 Unclassified 3682
52 Ga0157374_10644643 3300013296 Bacteria 1071
53 Ga0157375_10422148 3300013308 Unclassified 1500
54 Ga0157376_10384942 3300014969 Unclassified 1352
55 Ga0207692_10375007 3300025898 Bacteria 882
56 Ga0207699_10084891 3300025906 Bacteria 1973
57 Ga0207707_10241032 3300025912 Unclassified 1572
58 Ga0207693_10006721 3300025915 Bacteria 9497
59 Ga0207693_10016899 3300025915 Bacteria 5826
60 Ga0207663_10013984 3300025916 Bacteria 4380
61 Ga0207663_10223107 3300025916 Bacteria 1372
62 Ga0207657_10016240 3300025919 Bacteria 7185
63 Ga0207652_10632487 3300025921 Bacteria 958
64 Ga0207646_10032243 3300025922 Unclassified 4742
65 Ga0207700_10086726 3300025928 Bacteria 2460
66 Ga0207664_10012863 3300025929 Bacteria 5996
67 Ga0207664_10079153 3300025929 Bacteria 2667
68 Ga0207664_10250982 3300025929 Bacteria 1544
69 Ga0207706_10699892 3300025933 Unclassified 866
70 Ga0207686_10368390 3300025934 Bacteria 1086
71 Ga0207709_10113348 3300025935 Bacteria 1817
72 Ga0207709_10337588 3300025935 Bacteria 1133
73 Ga0207669_10080116 3300025937 Bacteria 2087
74 Ga0207665_10000063 3300025939 Bacteria 69485
75 Ga0207712_10108350 3300025961 Bacteria 2079
76 Ga0207668_10590586 3300025972 Bacteria 966
77 Ga0207668_10621674 3300025972 Unclassified 943
78 Ga0207677_10021455 3300026023 Bacteria 3947
79 Ga0207639_10648530 3300026041 Bacteria 977
80 Ga0268264_10281909 3300028381 Bacteria 1557
81 Ga0265338_10062515 3300028800 Bacteria 3253
82 Ga0265338_10340341 3300028800 Bacteria 1081
83 Ga0265330_10097302 3300031235 Unclassified 1261
84 Ga0265325_10055346 3300031241 Bacteria 2029
85 Ga0265340_10002625 3300031247 Bacteria 10223
86 Ga0265316_10121802 3300031344 Bacteria 1970
87 Ga0307408_100476242 3300031548 Bacteria 1088
88 Ga0307405_10053011 3300031731 Bacteria 2525
89 Ga0307406_10054107 3300031901 Bacteria 2560
90 Ga0307409_100456966 3300031995 Bacteria 1234
91 Ga0307409_100798395 3300031995 Bacteria 951
92 Ga0307416_100848794 3300032002 Bacteria 1011
93 Ga0307415_100971979 3300032126 Unclassified 787
94 Ga0373923_0321158 3300035111 Bacteria 735
95 Ga0373936_0112514 3300035113 Bacteria 1157
96 Ga0373960_0027136 3300035121 Unclassified 1570
97 Ga0373943_0009123 3300035170 Unclassified 4446
98 Ga0373943_0193771 3300035170 Unclassified 1122
99 Ga0373935_0115757 3300035692 Bacteria 1785
100 Ga0373947_0464527 3300035725 Bacteria 858
101 Ga0373947_0493309 3300035725 Bacteria 832
102 Ga0373925_0324488 3300037068 Bacteria 1246
103 Ga0436365_0541760 3300039437 Bacteria 1666
104 Ga0439466_0050515 3300041411 Bacteria 1364
105 Ga0451577_0138983 3300042876 Bacteria 2182
106 Ga0453683_0116825 3300044673 Bacteria 1679
107 Ga0466963_0211874 3300044694 Bacteria 1356
108 Ga0466964_0015036 3300044706 Bacteria 2948
109 Ga0453684_0751381 3300044712 Bacteria 1056
110 Ga0451576_0056037 3300045051 Bacteria 4123
111 Ga0451576_0420050 3300045051 Bacteria 1403
112 Ga0466967_0005632 3300045976 Bacteria 8715
113 Ga0466967_0491327 3300045976 Bacteria 1203
114 Ga0495629_0123761 3300046459 Bacteria 1801
115 Ga0495582_0094368 3300046473 Bacteria 1670
116 Ga0495582_0112194 3300046473 Unclassified 1532
117 Ga0495639_0040039 3300046475 Unclassified 2107
118 Ga0495662_0080312 3300046476 Bacteria 1586
119 Ga0495664_0004124 3300046477 Bacteria 7933
120 Ga0495606_0045371 3300046507 Unclassified 2913
121 Ga0495628_0118062 3300046516 Bacteria 2037
122 Ga0495630_0006287 3300046517 Bacteria 8436
123 Ga0495630_0025227 3300046517 Bacteria 4395
124 Ga0495640_0149060 3300046533 Bacteria 1504
125 Ga0495586_0047391 3300046535 Bacteria 2320
126 Ga0495645_0029735 3300046543 Bacteria 3975
127 Ga0495645_0274133 3300046543 Unclassified 1112
128 Ga0495667_0017870 3300046559 Bacteria 4792
129 Ga0495667_0351683 3300046559 Bacteria 931
130 Ga0495634_0223532 3300046642 Bacteria 1161
131 Ga0495657_0015899 3300046675 Bacteria 5493
132 Ga0495647_0024010 3300046681 Bacteria 2216
133 Ga0495658_0035034 3300046683 Unclassified 2758
134 Ga0495613_0063959 3300046689 Bacteria 2691
135 Ga0495649_0430954 3300046694 Bacteria 660
136 Ga0495581_0039782 3300047315 Unclassified 2722
137 Ga0495674_0004967 3300047319 Bacteria 12802
138 Ga0495676_0042335 3300047321 Unclassified 3740
139 Ga0495676_0108404 3300047321 Bacteria 2043
140 Ga0495680_0038997 3300047322 Bacteria 3793
141 Ga0495680_0416239 3300047322 Bacteria 925
142 Ga0495675_0002623 3300047444 Bacteria 10774
143 Ga0495675_0022480 3300047444 Bacteria 4020
144 Ga0496100_0039532 3300048903 Bacteria 2996
145 Ga0496100_0106379 3300048903 Bacteria 1942
146 Ga0496101_0005114 3300048904 Bacteria 8337
147 Ga0496101_0094235 3300048904 Bacteria 2231
148 Ga0496102_0045591 3300048905 Bacteria 3981
149 Ga0496102_0158434 3300048905 Bacteria 2129
150 Ga0496102_0258049 3300048905 Bacteria 1643
151 Ga0496102_0584364 3300048905 Bacteria 1040
152 Ga0496103_0206341 3300048906 Bacteria 1264
153 Ga0496103_0266678 3300048906 Unclassified 1102
154 Ga0496104_0122071 3300048907 Bacteria 2501
155 Ga0496104_1016680 3300048907 Bacteria 733
156 Ga0496106_0027228 3300048909 Bacteria 4257
157 Ga0496106_0077577 3300048909 Bacteria 2548
158 Ga0496107_0035627 3300048910 Bacteria 3567
159 Ga0496107_0068918 3300048910 Bacteria 2567
160 Ga0496108_0003838 3300048911 Bacteria 12053
161 Ga0496108_0031118 3300048911 Bacteria 4425
162 Ga0496108_0426096 3300048911 Bacteria 1159
163 Ga0496109_0000806 3300048912 Bacteria 26126
164 Ga0496109_0032756 3300048912 Bacteria 4674
165 Ga0496109_0057992 3300048912 Bacteria 3536
166 Ga0496109_0211442 3300048912 Bacteria 1824
167 Ga0496109_1069605 3300048912 Bacteria 744
168 Ga0496110_0025746 3300048913 Bacteria 5029
169 Ga0496110_0038579 3300048913 Bacteria 4157
170 Ga0496110_0267947 3300048913 Bacteria 1555
171 Ga0496111_0000083 3300048914 Bacteria 39397
172 Ga0496111_0005215 3300048914 Bacteria 8289
173 Ga0496111_0346316 3300048914 Bacteria 1100
174 Ga0496111_0393512 3300048914 Bacteria 1024
175 Ga0496112_0043465 3300048915 Bacteria 4399
176 Ga0496112_0098319 3300048915 Bacteria 2896
177 Ga0496112_0139739 3300048915 Bacteria 2391
178 Ga0496112_0335701 3300048915 Bacteria 1455
179 Ga0496112_0534566 3300048915 Bacteria 1107
180 Ga0496113_0012565 3300048916 Bacteria 5697
181 Ga0496113_0088152 3300048916 Unclassified 2387
182 Ga0496114_0018010 3300048917 Bacteria 5707
183 Ga0496114_0236339 3300048917 Bacteria 1606
184 Ga0496114_1044255 3300048917 Archaea 701
185 Ga0496115_0069725 3300048918 Bacteria 2848
186 Ga0496115_0639488 3300048918 Bacteria 842
187 Ga0501068_0038124 3300049584 Bacteria 2878
188 Ga0501068_0532693 3300049584 Bacteria 763
189 Ga0501072_0251396 3300049588 Bacteria 1408
190 Ga0501075_0655870 3300049591 Unclassified 800
191 Ga0495601_0031199 3300053077 Bacteria 3312
192 Ga0495595_0286198 3300053084 Bacteria 828
193 Ga0495619_0086719 3300053085 Unclassified 2116
194 Ga0495619_0179632 3300053085 Unclassified 1464
195 Ga0495619_0180590 3300053085 Bacteria 1460
196 Ga0500641_0002286 3300053096 Bacteria 6798
197 Ga0500556_0035275 3300053104 Bacteria 1727
198 Ga0500616_0002196 3300053153 Bacteria 16795
199 Ga0500616_0039956 3300053153 Bacteria 2526
200 Ga0105240_11210442
201 Ga0070683_100555350
202 Ga0070682_100271123
203 Ga0070682_100685342
204 Ga0068868_100472738
205 Ga0070660_100014035
206 Ga0070668_100415704
207 Ga0070674_100115752
208 Ga0070714_100424167
209 Ga0070713_100139808
210 Ga0070705_100009001
211 Ga0070694_100063268
212 Ga0070708_100312862
213 Ga0070681_10219643
214 Ga0070681_10378546
215 Ga0068867_100009169
216 Ga0070706_100150304
217 Ga0070706_100270798
218 Ga0070707_100082625
219 Ga0070707_100986296
220 Ga0070698_100038787
221 Ga0070698_100430611
222 Ga0070679_100399133
223 Ga0070684_100272750
224 Ga0070697_100098049
225 Ga0070695_100090661
226 Ga0070704_100082452
227 Ga0070704_100152509
228 Ga0070704_100348678
229 Ga0068857_100900892
230 Ga0068861_100083637
231 Ga0068858_100215699
232 Ga0081538_10003504
233 Ga0081538_10006931
234 Ga0081538_10056613
235 Ga0070717_10041304
236 Ga0070717_10185046
237 Ga0070717_10611958
238 Ga0070715_10001632
239 Ga0070716_100018348
240 Ga0070716_100052326
241 Ga0070712_100007113
242 Ga0070712_100040838
243 Ga0105243_10541682
244 Ga0105242_10312537
245 Ga0105238_10701820
246 Ga0105239_10137309
247 Ga0105239_10334150
248 Ga0105239_10370731
249 Ga0105239_10831244
250 Ga0157374_10055967
251 Ga0157374_10644643
252 Ga0157375_10422148
253 Ga0157376_10384942
254 Ga0207692_10375007
255 Ga0207699_10084891
256 Ga0207707_10241032
257 Ga0207693_10006721
258 Ga0207693_10016899
259 Ga0207663_10013984
260 Ga0207663_10223107
261 Ga0207657_10016240
262 Ga0207652_10632487
263 Ga0207646_10032243
264 Ga0207700_10086726
265 Ga0207664_10012863
266 Ga0207664_10079153
267 Ga0207664_10250982
268 Ga0207706_10699892
269 Ga0207686_10368390
270 Ga0207709_10113348
271 Ga0207709_10337588
272 Ga0207669_10080116
273 Ga0207665_10000063
274 Ga0207712_10108350
275 Ga0207668_10590586
276 Ga0207668_10621674
277 Ga0207677_10021455
278 Ga0207639_10648530
279 Ga0268264_10281909
280 Ga0265338_10062515
281 Ga0265338_10340341
282 Ga0265330_10097302
283 Ga0265325_10055346
284 Ga0265340_10002625
285 Ga0265316_10121802
286 Ga0307408_100476242
287 Ga0307405_10053011
288 Ga0307406_10054107
289 Ga0307409_100456966
290 Ga0307409_100798395
291 Ga0307416_100848794
292 Ga0307415_100971979
293 Ga0373923_0321158
294 Ga0373936_0112514
295 Ga0373960_0027136
296 Ga0373943_0009123
297 Ga0373943_0193771
298 Ga0373935_0115757
299 Ga0373947_0464527
300 Ga0373947_0493309
301 Ga0373925_0324488
302 Ga0436365_0541760
303 Ga0439466_0050515
304 Ga0451577_0138983
305 Ga0453683_0116825
306 Ga0466963_0211874
307 Ga0466964_0015036
308 Ga0453684_0751381
309 Ga0451576_0056037
310 Ga0451576_0420050
311 Ga0466967_0005632
312 Ga0466967_0491327
313 Ga0495629_0123761
314 Ga0495582_0094368
315 Ga0495582_0112194
316 Ga0495639_0040039
317 Ga0495662_0080312
318 Ga0495664_0004124
319 Ga0495606_0045371
320 Ga0495628_0118062
321 Ga0495630_0006287
322 Ga0495630_0025227
323 Ga0495640_0149060
324 Ga0495586_0047391
325 Ga0495645_0029735
326 Ga0495645_0274133
327 Ga0495667_0017870
328 Ga0495667_0351683
329 Ga0495634_0223532
330 Ga0495657_0015899
331 Ga0495647_0024010
332 Ga0495658_0035034
333 Ga0495613_0063959
334 Ga0495649_0430954
335 Ga0495581_0039782
336 Ga0495674_0004967
337 Ga0495676_0042335
338 Ga0495676_0108404
339 Ga0495680_0038997
340 Ga0495680_0416239
341 Ga0495675_0002623
342 Ga0495675_0022480
343 Ga0496100_0039532
344 Ga0496100_0106379
345 Ga0496101_0005114
346 Ga0496101_0094235
347 Ga0496102_0045591
348 Ga0496102_0158434
349 Ga0496102_0258049
350 Ga0496102_0584364
351 Ga0496103_0206341
352 Ga0496103_0266678
353 Ga0496104_0122071
354 Ga0496104_1016680
355 Ga0496106_0027228
356 Ga0496106_0077577
357 Ga0496107_0035627
358 Ga0496107_0068918
359 Ga0496108_0003838
360 Ga0496108_0031118
361 Ga0496108_0426096
362 Ga0496109_0000806
363 Ga0496109_0032756
364 Ga0496109_0057992
365 Ga0496109_0211442
366 Ga0496109_1069605
367 Ga0496110_0025746
368 Ga0496110_0038579
369 Ga0496110_0267947
370 Ga0496111_0000083
371 Ga0496111_0005215
372 Ga0496111_0346316
373 Ga0496111_0393512
374 Ga0496112_0043465
375 Ga0496112_0098319
376 Ga0496112_0139739
377 Ga0496112_0335701
378 Ga0496112_0534566
379 Ga0496113_0012565
380 Ga0496113_0088152
381 Ga0496114_0018010
382 Ga0496114_0236339
383 Ga0496114_1044255
384 Ga0496115_0069725
385 Ga0496115_0639488
386 Ga0501068_0038124
387 Ga0501068_0532693
388 Ga0501072_0251396
389 Ga0501075_0655870
390 Ga0495601_0031199
391 Ga0495595_0286198
392 Ga0495619_0086719
393 Ga0495619_0179632
394 Ga0495619_0180590
395 Ga0500641_0002286
396 Ga0500556_0035275
397 Ga0500616_0002196
398 Ga0500616_0039956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

59

154

0.96

PF13649

Methyltransf_25

Methyltransferase domain

58

150

0.94

PF08242

Methyltransf_12

Methyltransferase domain

59

152

0.92

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

35

182

0.82

PF13847

Methyltransf_31

Methyltransferase domain

53

206

0.8

PF13489

Methyltransf_23

Methyltransferase domain

31

202

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vl5-assembly4.cif.gz_D crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution 0.8303 25 206
6uv6-assembly2.cif.gz_B atmm with bound rebeccamycin analogue 0.8181 22 204
3bus-assembly1.cif.gz_A crystal structure of rebm 0.8058 18 206
4pne-assembly3.cif.gz_B crystal structure of the [4+2]-cyclase spnf 0.7985 24 208
4pne-assembly3.cif.gz_A crystal structure of the [4+2]-cyclase spnf 0.7966 24 208
ID Description Score Start End Superfamily
af_Q4DRI7_264_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9155 85 205 3.40.50.150
af_A4HWZ1_308_486_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8953 85 206 3.40.50.150
af_O43033_47_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.884 8 174 3.40.50.150
af_O06547_23_200_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8824 22 180 3.40.50.150
af_A0A1D8PLX3_221_417_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8625 12 201 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6J5YEP4-F1-model_v4 Unannotated protein 0.9534 91 206 GO:0008757
GO:0032259
AF-A0A2G6HFP0-F1-model_v4 Methyltransferase type 11 domain-containing protein 0.9432 89 204 GO:0008757
GO:0032259
AF-A0A7Y1U3M9-F1-model_v4 Methyltransferase domain-containing protein 0.9422 4 205 GO:0008757
GO:0032259
AF-A0A7H8NH65-F1-model_v4 Methyltransferase domain-containing protein 0.9418 8 206 GO:0008757
GO:0032259
AF-A0A495XMY9-F1-model_v4 Methyltransferase family protein 0.9274 8 208 GO:0008757
GO:0032259

Map